Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
4029 Night Heron Dr 17-2478; NEW SFH
COUNTY OF SEMINOLE IMPACT FEE STATEMENT tz C9. i -7 gym,+#,'),4'78 STATEMENT NUMBER: 17100006 BUILDING APPLICATION #: 17-10000692 BUILDING PERMIT NUMBER: 17-10000692 UNIT ADDRESS: NIGHT HERON DR 4029 TRAFFIC ZONE:022 JURISDICTION: SEC: TWP: RNG: SUF: SUBDIVISION: PLAT BOOK: PLAT BOOK PAGE: OWNER NAME: ADDRESS: DATE: September 20, 2017 17-20-31-S02-0000-1840 PARCEL: TRACT: BLOCK: LOT: APPLICANT NAME: BRISSON INVESTMENTS LLC ADDRESS: 27 N SUMMERLIN AVENUE ORLANDO FL 32801 LAND USE: SFR DETACHED TYPE USE: WORK DESCRIPTION: CITY-SANFORD SPECIAL NOTES: 4029 NIGHT HERON DR / LOT 184 SFR WYNDAM PRESERVE FEE BENEFIT RATE UNIT CALC UNIT TOTAL DUETYPEDISTSCHEDRATEUNITSTYPE ROADS-ARTERIALS CO -WIDE ORD Single Family ROADS Hou ing N%A 705.00 1.000 dwl unit 705.00COLLECTORS Housing 00 1.000 dwl unitFISSiingleCUEmilyR 00 LIBRARY CO -WIDE ORD 00 Single Family SCHOOLS Housing CO -WIDE ORD 54.00 1.000 dwl unit 54.00 P SSiingle Family Hou ' ng 5,000.00 1.000 dwl unit 5,000.00 LAW ENFORCE N/A 00 DRAINAGE N/A 00 QQ AMOUNT DUE 5,759.00 STATEMENT ORECEIVEDBY: SIGNATURE: / PLEASE PRINT NAM ) DATE: NOTE TO RECEIVING SIGNATO%APPLICANT: FAILURE NOTIFY OWNER AND ENSURE TIMELY PAYMENT MAY REESULT IN YOUR LIABILITY FOR THE FEE. *** DISTRIBUTION: 1-BLDG DEPT 3-APPLICANT 2-FINANCE 4-LAND MANAGEMENT NOTE** PERSONS ARE ADVISED THAT THIS IS A STATEMENT OF FEES DUE UNDER THE SEMINOLE COUNTY ROAD FIRE/RESCUE, LIBRARY AND/OR EDUCATIONAL ISSUANCE OF A BUILDING PERMIT. PERSONS ARE ALSO ADVISED THAT ANY RIGHTS OF THE APPLICANT, OR OWNER, TO APPEAL THE CALCULATION OF ANY OF THE ABOVE MENTIONED IMPACT FEES MUST BE EXERCISED BY FILING A WRITTEN REQUEST WITHIN 45 CALENDAR DAYS OF THE RECEIVING SIGNATURE DATE ABOVE BUT NOT LATER THAN CERTIFICATE OF OCCUPANCY OR OCCUPANCY. THk REQUEST FOR REVIEW MUST MEET THE REQUIREMENTS OF THE COUNTY LAND DEVELOPMENT CODE. COPIES OF RULES GOVERNING APPEALS MAY BE PICKED UP OR REQUESTED, FROM THE PLAN IMPLEMENTATION OFFICE: 1101 EAST FIRST STREET, SANFORD FL, 32771; 407-665-7356. PAYMENT SHOULD BE MADE TO: SEMINOLE COUNTY OR CITY OF SANFORD BUILDING DEPARTMENT 1101 EAST FIRST STREET SANFORD, FL 32771 PAYMENT SHOULD BE BY CHECK OR MONEY ORDER t AND SHOULD REFERENCETHECOUNTYBUILDINGPERMITNUMBERATTHETOPLEFTOFTHISSTATEMENT. THIS STATEMENT IS NO LONGER VALID IF A BUILDING PERMIT IS NOT*** ISSUED WITHIN 60 CALENDAR DAYS OF THE RECEIVING SIGNATURE DATE ABOVE DETAIL OF CALCULATION AVAILABLE UPON REQUEST. CALL 407-665-7356. Page 1 of 1 TH13Q18 PREPAgqEEAaY: IIIIIII IIIII IIIII IIIII IIIII IIIII IIII IIII HomesFbdOa.LLC GRAtir MA1.OY, SEMINOLE COUNTY 1akd6Aen-F 32fI8 CI_F.GI. OF CIRCUIT COURT h COMPTROLLER SY. 8770 Ps 1685 0 P95 ) CLERK'S Q 3017081859NOTICEOFCOMMENCEMENTRECORUErOS/14/2u17 01:17:41 or.. RECORDING FEES C-0.00 State of Florida RECORO.0 BY hdevore County of 1 Seminole Permit u Permit Number. 1 '1 2 "1 1 1; Parcel to Number 17-20-31-502-=G- ThWX 7T13 Flo hVebttrQI notloe that Improvement will be made to certain real property. and In aeowdance vAM fosowing Irdonnation is prodded in tint Nadca of Commerbemem. DESCRIPTION OF PROPERTY: (Legal description of the property and &W addmea it avellable) GENERAL DESCRIPTION OF WPROVEMENT: Construct New SFR OWNER INFORMATION: Name:_Stadight Homes Florida. LLC Address: 1405 Old Alabama Road, Suite 200, Roswell, GA 30076 Fee simple Title Molder (It o0w than owner) Name: NA Addresa: CONTRACTOR: Nam: Starlight Homes Florida, LLC Address: 1004 Greenwood Blvd Suite 124. Lake Mary, FL 32746 Persons within the state of Florida Designated by Owner upon whom notice or ct1w documents may be served as provided by Section 713.1t1(I)(b). Flords Slatutm Name: NA Address: In addlilon to himself. Owner Oesignales NA of To NoMm a copy of Ow Llenoes Notice as Prodded In Section 713.13(1)(b), Flcdda Statutes. EXPIretlon Date of Notice of Commencemannt (The expired" date Is 1 year from data of recording unless a dtRerent data Is spectfled) WARNING TO OWNER: ANY PAYMENTS MADE BY THE OWNER AFTER THE EXPIRATION OF THE NOTICE OF COMMENCEMENT ARE CONSIDERED IMPROPER PAYMENTS UNDER CHAPTER 713. PART I. SECTION 713.13. FLORIDA STATUTES. AND CAN RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. A NOTICE OF COMMENCEMENT MUST BE RECORDED AND POSTED ON THE JOB SITE BEFORE THE FIRST INSPECTION. IF YOU INTEND TO OBTAIN FINANCING. CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE COMMENCING WORK OR RECORDING YOUR NOTICE OF COMMENCEMENT. Under penalties of perjury. I declare that 1 have read the foregoing and that the facia stated In It are true to the and belief. 0wmre50uhn O*NW PAmeNkm RaeA&&"713.13(t)(gk-TMawrwmmdpew nailer. cram MONrwArrrb no au dery mgrM PW0ftW1DdgnhtbaIrvvWW Sheyne Mange, NOTARY PUBLIC Stele of 1-1 a ri ci..+ Countyof y STATE OF FLORIDA Commo Ga113111 The foregoing Inprument was acknowledged before me thle day of j by D Who Is personally known is an W mint» dpnorl mddrrp rbernere OR who has produced Identification two of Wenllllcallon produced: Shsyne Mengel NOTARY PUBLIC STATE OF FLORIDA Comm$ GG113111 Expires & 2112021 Book8970/ Page1685 CFN#2017081859 t - Page 1 of 1 http:// officialrecordsbv.seminoleclerk.org/BrowserView/ 10/10/2017 CITY OF SANFORD BUILDING & FIRE PREVENTION D AUG 1 4097 , ,; PERMIT APPLICATION Application No: Documented Construction Value: S t70 01- Job Address: 4 0al9Ni 3nr H -'0" 1 r.i/c Historic District: Yes No Parcel ID: 17-20-31-502-Q000- l %" Wyndham Preserve Lot • 1 Z4 Residential ® Commercial Type of Work: New ® Addition Alteration Repair Demo Change of Use Move Description of Work: Construct New SFR Plan Review Contact Person: Shayne Mangel Title: Permit Coordinator Phone: 407-708-0161 Fag: 407-647-0700 Email: Shayne.mangel@starlighthomes.com Property Owner Information Name Starlight Homes Florida, LLC Phone: 407-708-0161 Street: 1405 Old Alabama Road, Suite 200 Resident of property?: No City, State Zip: Roswell, GA 30076 Contractor Information Name Starlight Homes Florida, LLC/Robert Willets Phone: 407-647-3700 1' Street: 1064 Greenwood Blvd, Suite 124 Fax: 407-647-0700 City, State Zip: Lake Mary, FL 32746 State License No.: CGC1522347 . Arch itect/EngIneer Information Name: Mulhem & Kulp Phone: 215-646-8001 IQ Street: 20 South Maple Street, Suite 150 Fax: V , City, St, Zip: Ambler, PA E-mail: sives@mulhemkulp.com Eft Bonding Company: NA Mortgage Lender: NA Address: Address: WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT.MAY RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. A NOTICE OF COMMENCEMENT MUST BE RECORDED AND POSTED ON THE JOB SITE BEFORE THE FIRST INSPECTION. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installation has commenced prior to the issuance of a permit and that all work will be performed to meet standards of all laws regulating construction in this jurisdiction. I understand that a separate permit must be secured for electrical work, plumbing, signs, wells, pools, furnaces;, boilers, beaters, tanks, and air conditioners, etc. FBC 1053 Shall be inscribed with the date of application and the code in effect as of that date: 5i6 Edition (2014) Florida Building Code Revised: June 30, 2015 Permit Application NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may be found in the public records of this county, and there may be additional permits required from other governmental entities such as water management districts, state agencies, or federal agencies. Acceptance of permit is verification that I will notify the owner of the property of the requirements of Florida Lien Law, FS 713. The City of Sanford requires payment of a plan review fee at the time of permit submittal. A copy of the executed contract is required in order to calculate a plan review charge and will be considered the estimated construction value of the job at the time of submittal. The actual construction value will be figured based on the current ICC Valuation Table in effect at the time the permit is issued, in accordance with local brdiriance. Should calculated charges figured off the executed contract exceed the actual construction value, credit will be applied to your permit fees when the permit is issued. OWNER'S AFFIDAVIT: i?.certify that all of the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. lm"7. Signature of Owner/Agent Date Print Owner/Agent's Name 3Lak-'ra. --+Y\ Q.na g 8 ar Signature of N -State of F e Man9d Date I NOTARY PUBLIC STATE OF FLORIDA Comm# GG113111 0 ExQjces 6/21 /2021 Owner/Agent is Personally Known to Me or Produced ID Type of ID f5; - 818 i Signature of ontractor/Agent Date Robert wllets Print Contractor/Agent's Name Ja _ aI2 `tyl o—'r 1Chi v) a I Signature of N&tary-St%%%Wr%ngelU Date iV4 NOTARY PUBLIC STATE OF FLORIDA Comm## GG113111 cEiExpires 6/21/2021 Contractor/Agent is Personally Known to Me or Produced ID Type of ID BELOW IS FOR OFFICE USE ONLY Permits Required: Building E] Electrical (o Mechanical Z Plumbing® Gas[] Roof Construction Type: Occupancy Use: it Flood Zone: clot) iTA44ED Total Sq Ft of Bldg: 2.( LA Min. Occupancy Load: I t4 # of Stories: I New Construction: Electric - # of Amps 60 Plumbing - # of Fixtures 1' Fire Sprinkler Permit: Yes No [Z # of Heads Fire Alarm Permit: Yes No Q APPROVALS: ZONING: UTILITIES: WASTE WATER: ENGINEERING: M`tC, 00-VK1 FIRE: BUILDING: IF tp• I it Ok to construct single family home COMMENTS: _ with setbacks and impervious area shown on plan. yy. Iq `/o imp, 19bl *elio. Elty. - T-.0 G lz- Revised: June 30, 2015 Pertnit Application 77 CC Ell f79E { CITY OF SANFORD r~. . BUILDING St FIRE PREVENTION AUr i 11 i.7 PERMIT APPLICATION Application No: / 7" O) A Documented Construction Value: S 1091 9 A3 a Job Address: :. 4 0AI Ni 91eT" HCrvn Historic District: Yes No Parcel ID: 17-20-31-502-Q000- l %LVO Wyndham Preserve Lot ' 149" - Residential ® Commercial Type of Work: New ® Addition Alteration Repair Demo Change of Use Move Description of Work: Construct New SFR Plan Review Contact Person: Shayne Mangel Title.: Permit Coordinator Phone: 407-708-0161 tax: .407-647-0700 Email: Shayne.mangel@starlighthomes.com Property Owner Information Name Starlight Homes.Florida, LLC Phone: 407-708-0161 Street: 1405 Old Alabama Road, Suite 200 City, State Zip: Roswell, GA 30076 Resident of property?: Contractor Information Name Starlight Homes Florida, LLC/Robert Willets Phone: Street: 1064 Greenwood Blvd, Suite 124 City, State Zip: Lake Mary, FL 32746 407-647-3700 Fag: 407-647-0700 State License No.: No CGC1522347 N'•. Arch itect/Eng 1 neer Information Name: Mulhem & Kulp Phone: 215-646-8001 Street: 20 South Maple Street, Suite 150 Fag: City, St, Zip: Ambler, PA E-mail: sives@mulhemkulp.com Bonding Company: NA Mortgage Lender: Address: Address: NA WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT.MAY RESULT IN YOUR PAYING TWICE FOR I11:IPROVEMENTS TO YOUR PROPERTY. A NOTICE OF COMMENCEMENT MUST BE RECORDED AND POSTED ON THE JOB SITE BEFORE THE FIRST INSPECTION. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. Application is hereby made to obtain.a permit to do the work and installations as indicated. I certify that no work or installation has commenced prior to the issuance of a permit and that all work will be performed to meet standards of all la, fegulating construction in this jurisdiction. I understand that a separate permit must be secured for electrical work, plumbing, sighs, wells, pools, furnaces, boilers, heaters, tanks, and air conditioners, etc. FBC 1053 Shall be inscribed with the date of application and the code.in effect as of that date: 511 Edition (2014) Florida Building Code Revised: June 30. 2015 Permit Application NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may be found in the public records of this county, and there may be additional permits required from other governmental entities such as water management districts, state agencies, or federal agencies. Acceptance of permit is verification that I will notify the owner of the property of the requirements of Florida Lien Law, FS 713. The City of Sanford requires payment of a plan review fee at the time of permit submittal. A copy of the executed contract is required in order to calculate a plan review charge and will be considered the estimated construction value of the job at the time of submittal. The actual construction value will be figured based on the current ICC Valuation Table in effect at the time the permit is issued, in accordance with locill`brdinance. Should calculated charges figured off the executed contract exceed the actual construction value, credit will be applied to your permit fees when the permit is issued. i ` OWNER'S AFFIDAVIT: ).certify that all of the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. e' 00Z; lsl, Signature of Owner/Agent .Date Print Owner/Agent's Name 88 Signature of No -State of Fne Mangd Date 04vociz? NOTARY PUBLIC STATE OF FLORIDA Comm# GG113111 E t jtes 612112021 Owner/Agent is Personally Known to Me or Produced ID Type of ID 7'3 7 Sib i Signature of onttactor/Agent Date Robert Willets Print Contractor/Agent's Name 1 c14a62 —yn Ct 81 SII r Signature ofN tary-St% r%ngel 0 Date Y NOTARY PUBLIC STATE OF FLORIDA Comm# GG113111 ARE 11P Expires 612V2021 Contractor/Agent is Personally Known to Me or Produced ID Type of lD BELOW IS FOR OFFICE USE ONLY Permits Required: Building Electrical Mechanical Plumbing Gas[] Roof Construction Type: Total Sq Ft of Bldg: Occupancy Use: Flood Zone: Min. Occupancy Load: # of Stories: New Construction: Electric - # of Amps Plumbing - # of Fixtures Fire Sprinkler Permit: Yes No # of Heads Fire Alarm Permit: Yes No APPROVALS: - ZONING: ' UTILITIES: /? S/WASTE WATER: ENGINEERING: FIRE: COMMENTS: BUILDING: Revised: June 30, 2015 Permit Application J0 F. Revision Response to Comments Permit # Project Address: Contact: City of Sanford Building & Fire Prevention Division Ph: 407.688.5150 Fax: 407.688.5152 Email: building@sanfordfl.gov Submittal Date 9 1 Ph: oI L- v Fax: Email: rnana, (( .SA-l t J4 Kflw-2s ,- ccVy Trades encompassed in revision: General description of revision: II Building (aAC",-ke,—A l Plumbing Electrical Mechanical Life Safety Waste Water Department Utilities Waste Water Planning Engineering Fire Prevention ROUTING INFORMATION Approvals 11 Building w- AW STARLIGHT ASHTON WOODS, HOMES September 22, 2017 Shayne Mangel STARLIGHT HOMES—ORLANDO 1064 Greenwood Blvd. Suite 124 Lake Mary, FL 32746 Subject: Brisson East/ Wyndham Preserver Permitting Comments Plans updated for the follow codes based on review comments on the Architectural plan set FBC 107 Reference: Addressed the following comments 1. Plans must be a site specific plan set 2. Index on cover page should be consistent to the pages present in lot specific plan set. 3. Remove Call out for 200AMP if it was present Shayne, Per your request we have addressed the Architectural reference items on the enclosed site specific plans sets. Please use the new site specific plan for your resubmittal. We have revised these comments and will include them on any future lot specifics plans. office. If you have any questions or would like any further clarification, please feel free to contact our Respectfully, Adam Weaver Vice President of Purchasing and Starlight Product Development Ashton Woods - Corporate Headquarters 140S Old Alabama Road, Suite 200 1 Roswell, GA 30076 IRCITY Of S--------ORD FIRE DEPARTMENT L OT ` 9 Building &Fire Prevention Division PLAN REVIEW COMMENTS Application Number: 17-2478 Date: 09/07/2017 Project Description: New SFR Contact Name: Shayne Mangel Job Address: 4029 Night Heron Dr Contact Email: Shavne.Mangel a()starlighthomes.com This is a general overview for code compliance in accordance with the minimum plan review required by the Florida Building Code. It is not a complete detailed review. The comments noted in this review must be addressed before the plans can be approved. Changes to plans shall be submitted on the same size format as the original submittal — changes in letter form are not permitted. All references to FBC Chapter I are as amended by City of Sanford ordinance viewable on our website at www.sanfordfl.eov. Provide two conies ofaffected Plan sheets and/or supplemental information as reauested. Permit submittals will not be accepted without two conies. COMMENTS: 1. The City of Sanford is located within the 139mph (ultimate) 108mph (nominal) wind speed area for Risk Category 11 structures. The plans have been designed for 136 mph. Please revise the plans as they are required to be designed to meet the required wind speed for the City of Sanford, without interpolation. FBC 102.9.2; Submittal Guidelines (FBC 107.3.5) 2. The home appears to be "Elevation T" however there are multiple pages that include Elevation S & U. Please remove all references to different elevations on the applicable plan pages — plans are required to be site specific. In addition, the index on the cover sheet should only include the exact plan pages. FBC 107 3. The Electric Page specifies a 200 amp service while the electric load calculations specify a 150 amp service. Please either revise the electrical page or the electric load calculations to show the correct service size. FBC 107 Any error or omission in this plan review shall not be construed to grant approval of any violation of any of the adopted codes or municipal ordinances of this jurisdiction. Office meetings with the plans examiner to discuss comments will reouire an appointment, arrameed by phone or email prior to arrivaL Respectfully, Steve Fiorey, CBO Residential Plans Examiner P187on. City of Sanford Planning and Development Services Engineering — Floodplain Management Flood Zone Determination Request Form Name: Shayne Mangel Firm: Starlight Home Florida LLC Address: 1064 Greenwood Blvd Suite 124 City: Lake Mary State: FL Zip Code: 32746 Phone: 407-647-3700 Fax: 407-647-0700 Email: shayne.mangel@starlighthomes.com Property Address: 4029 Night Heron Drive Property Owner: Starlight Homes Florida, LLC Parcel identification Number: 17-20-31-502-0000-1840 Phone Number: 407.647.3700 Email: The reason for the flood plain determination is: 0 New structure Existing Structure (pre-2007 FIRM adoption) Expansion/Addition Existing Structure (post 2007 FIRM adoption) Pre 2007 FIRM adoption = finished floor elevation 12" above BFE Post 2007 FIRM adoption = finished floor elevation 24" above BFE (Ordinance 4360) O-FCAL S ON Flood Zone: X Base Flood Elevation: N/A Datum: N/A FIRM Panel Number: 120294 0090 F Map Date: Sept. 28, 2007 The referenced Flood Insurance Rate Map indicates the following: The parcel is in the: floodplain floodway A portion of the parcel is in the: floodplain floodway K The parcel is not in the: floodplain floodway The structure is in the: floodplain floodway The structure is not in the: floodplain floodway If the subject property is determined to be flood zone 'A', the best available information used to determine the base flood elevation is: BP# 17-2478 Reviewed by: Michael Cash, CFM Date: August 29, 2017 I Q o o Application for Paved Driveway, Sidewalk or Walkway Including Right -of -Way Use & Landscaping in Right -of -Way www.senrordf.gov Department of Planning & Development Services 300 North Park Avenue, Sanford, Florida 32771 Phone: 407.688.6140 Fax: 407.688.6141 1 l This permit authorizes work to be done on the subject property or in the City of Sanford's right-of-way in accordance with the Qys regulations and the attached construction plans approved as part of this permit. The permit is required for driveway or asidewalkconstructionover100squarefeetofconcreteorothermaterialonthesubjectparceland / or any construction of a ddveway, walkway or landscape Improvements within the city rightof-way. It does not approve any work within any other jurisdiction's right-of-way. All requested Information below as well as a current survey, alto plan or plat clearly Identifying the Knoa,,q,a%below size and location of the existing right-of-way and use shall be provided or application could be delayed. Callb.fororondlg. 1. Project Location/Address: 2 2. Proposed Activity. Driveway Walkway Other: 3. Schedule of Work: Start Date Completion Date I G PPEmergency Repairs 1 4. Brief Description of Work . -t 1L:.Cn.., c , t •;p This Signature: Address: Phone: 4 su4mitted by. Print Name., Fax: Email: `- %=6ate: Maintenance Resnonsibilitiesflndemnificati' The Requestor, and his successors and assigns, shag be responsible for perpetual maintenance of the Improvement installed under this Agreement This shall Include maintenance of the Improvement and unpaved portion of right-of-way adjeoent thereto. Requestor may, with written City authorization. remove said Inataliatlonflmprovement fully restoring the rlghtof-way to its previous condition. In the event that any future construction of roadways, utilities, stormwater facilities, or any general maintenance activities by the City becomes In conflict with the above permitted activity, the parmittee shag remove, relocate and/or repair as necessary at no cost to the City of Sanford insofar as such facilities are In the public right-of-way. If the Requestor does not continuously maintain the improvement and area In accordance with previously stated criteria, or corn lately restore the right-of-way to Its previous condition, the City shall, after appropriate notice, restore the area to Its previous condition at the RequestorQs expense and. If necessary, file a lien on the Requestor's property to recover costs of restoration. To the fullest extent permitted by law, Requestor agrees to defend. Indemnify, and hold harmless the City, Its councllpersone, agents, servants, or employ- ees (appointed, elected, or hire from and against any and ail liabilities, claims, penalties, demands, suits, judgments, losses, expenses, damages (direct, indirect or coneequent}al), or Injury of any nature whatsoever to person or property, and the costs and expenses Incident thereto (Including costs of defense, settlement, and reasonable altomey's fees up to and Including an appeap, resulting In any fashion from or arising directly or Indirectly out of or connected with the use aft -e right-of-way. read and Oderstago the above statement and by signing this application I agree to Its terms. Date: a 1,3111-:1 This permit shall be posted on the site during construction. Please call 407.688.5080 24 hours In advance to schedule a pro -pour inspection. Pro -pour Inspection by: Date: Application No: _ Reviewed: Public Works Official Use Only Fee: utilities % Approved: r /I t .,CI' Engineering Site Inspected by: Special Permit Conditions: Date: Date: Date: Date: ` —'' — W 1? Date: November 2016 -- RAW Use Driveweypcif LIMITED POWER OF ATTORNEY Altamonte Springs, Casselberry, Lake Mary, Longwood, Sanford, Seminole County, Winter Springs Date: -3 1-1 1 ' I hereby name and appoint: Amy Lacey, David Lacey, Amanda Smythe an agent of: Starlight Homes Florida, LLC Name of Company) to be my lawful attorney -in -fact to act for me to apply for, receipt for, sign for and do all things necessary to this appointment for (check only one option): 62' The specific permit and application for vrk located at: e,-nn ri v e, rt nrd Saw Address) Expiration Date for This Limited Power of Attorney: License Holder Name: Robert Willets State License Number: CGC1522347 Signature of License Holder: STATE OF FLORIDA COUNTY OF Seminole The fibrego ing,i4strument was acknowled ed before me this t5 day ool , 20 ff, by who trill perso Ily knownv to me or o who has produced as identification and who did (did not) take an oath. ILO 9 4 —IV\- ga-:4iSignature Notary Seal) rY1 I Shayne Mangel Print or type n me NOTARY PUBLIC STATE OF FLORIDA Notary Public - State of Comm# GG113111 Commission No. Expires 6/21/2021 My Commission Expires: Rev. 08.12) F -i 87- 7 9 APPLICATION FOR WATER AND/OR SEWER AVAILABILITY 300 N. Park Avenue Sanford FL 32771 P.O. Box 1788 Sanford FL 32772 1788 407-688-5090 Office 407-088 5091 Fax I. APPLICANT NAME: Starlight Homes f lorida, LLC Starlight Homes Florida, LLC V(Applicant) (Owner) ADDRESS: 1405 Old Alabama Rd, St 200, Roswell, GA 30076 TELEPHONE: 497-647-3700 2. PROPERTY STREET ADDRESS: 4'0a9 N i -Y e % -L>ri VC. Sanford, FL 32771 Parcel ID #i: 17-20-31-502-0000- i $y-p Wyndham Preserve Lot I $ Has the site plan been approved by the Planning Board? If yes, when? 3. PROPOSED DEVELOPMENT What is the property to be used for? SFR Type of Use) If commercial use, please give information on water and sewer flow requirements: FLOW/G.P.D.) 4. CERTIFICATION I certify that to the best of my knowledge that all information supplied with this application is true. Print Name)' (Signature) FOR CITY USE ONLY: FEE SUMMARY Water Water Impact Fees $ Meter $ Sewer Tap $ RC Meter $ Sewer Impact Fees $ Meter Tap $ Street Cut $ Meter Tap $ Other $ Road Bore $ Road Bore $ Water Line Depth Ft RC Line Depth Ft Sewer Line Depth Ft ADDITIONAL INFORMATION: PROPERTY STATUS: NEW STRUCTURE ( ) EXISTING STRUCTURE ( ) STRUCTURE DEMOLISHED ( ) APPROVED BY: UTILITIES ENGINEER OR OPERATIONS COORDINATOR) DATE) 8/26/2008 1111111111111111111111111111111111111111THIS' PREPARED BY: Name: Starlight Homes Florida, LLC Address: 1064 Greenwood Blvd Suite 124 Lake Marv. FL 32746 NOTICE OF COMMENCEMENT State of Florida County of Seminole Permit Number. Rn it i•Irigy? SENINOLE COUNTY CLIPI' OF CIRCUIT' COUfiT 2, CON'TROLLER PK 8970 F''7 1685 (IPvs} CLERK'S v 2017081859 RECORDED 08/14/21)17 Pr-1 KPCORDING FEES $10.00 RECORNI) BY hdewore Parcel 10 Number. 17-20-31-502-0000- The undersigned hereby gives notice that Improvement will be made to certain real property, and In accordance with Chapter 7C13, Florideltatutes, the following Information is provided in this Notice of Commencement. DESCRIPTION OF PROPERTY: (Legal description of the property and street address If available) t Address: Li-oa9 Nj *--d--},-o. "7rtve Sg, rtfo•d Tom. 3a'1"l i GENERAL DESCRIPTION OF IMPROVEMENT: Construct New SFR OWNER INFORMATION: Name: Starlight Homes Florida, LLC Address: 1405 Old Alabama Road, Suite 200, Roswell, GA 30076 Fee Simple Title Holder (d other than owner) Name: NA Address: CONTRACTOR: Name: Starlight Homes Florida, LLC Address: 1064 Greenwood Blvd Suite 124, Lake Mary, FL 32746 Persons wtthin the State of Florida Designated by Owner upon whom notice or other documents may be served as provided by Section 713.13(1)(b), Florida Statutes. Name: NA Address: In addition to himself, Owner Designates NA of To receive a copy of the Uenoes Notice as Provided in Section 713.13(1)(b), Florida Statutes. Expiration Date of Notice of Commencement (The expiration date Is 1 year from date of recording unless a different date Is specified) WARNING TO OWNER: ANY PAYMENTS MADE BY THE OWNER AFTER THE EXPIRATION OF THE NOTICE OF COMMENCEMENT ARE CONSIDERED IMPROPER PAYMENTS UNDER CHAPTER 713. PART I, SECTION 713.13, FLORIDA STATUTES, AND CAN RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. A NOTICE OF COMMENCEMENT MUST BE RECORDED AND POSTED ON THE JOB SITE BEFORE THE FIRST INSPECTION. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE COMMENCING WORK OR RECORDING YOUR NOTICE OF COMMENCEMENT. Under penalties of perjury, I declare that I have read the foregoing and that the facts stated In It are true to the be Wfk ge and belief. LC owners Signature Owners Printed Name Florida StaEute 713.13(1)(g): 'The owner must sign the notice of Commencement and no one aim may be permitted to sign In his or her steed Sh a Mengel NOTARY PUBLIC STATE OF FLORIDAStateCountyofComm# GG11311 t J Vic. The foregoing Instrument was acknowledged before me this day of 262 O J by--? Who Is personally known to me ; LJ Name of peon mddng statement QA OR who has produced Identfllcation type of Identification produced: ( dShare Mengel NOTARY PUBLIC r r STATE OF FLORIDA 1011 4L Notary Signature Comm# GG113111 l*cE 1 Expires 6/21/2021 w REQUIRED INSPECTION SEQUENCE STARLIGHT HOMES - DETACHED Permit # V 1- Z A 1 Cb Address: vrn4 ,J oH r tk"o,) BUILDING PERMIT Min Max Inspection Description 10 Foundation/Formboard Survey 10 Slab 20 Lintel 30 Sheathing — Roof 30 Sheathing — Walls 40 Roof Dry In 50 Frame 50 1000 Roof Final 60 Insulation 70 Drywall 70 1000 Final Insulation 1000 Final Single Family Residence ELECTRICAL PERMIT Min Max Inspection Description 10 Underground Electric 10 Footer / Slab Steel Bond 20 30 Temporary Underground Power (TUG) 30 Electric Rough 1000 Electric Final PLUMBING PERMIT Min Max Inspection Description 10 Plumbing Underground 20 Plumbing Tubset 10 1000 Plumbing Sewer 1000 Plumbing Final MECHANICAL PERMIT Min Max Inspection Description 10 Mechanical Rough 1000 Mechanical Final REVISED: June 2014 RECORD COPY FORM R405-2014 FLORIDA ENERGY EFFICIENCY CODE FOR BUILDING CONSTRUCTION Florida Department of Business and Professional Regulation - Residential Performance Method Project Name: Lot 184 1981 TR Builder Name: Ashton Woods Street: Permit Office: Seminole County BV/ 1p City, State, Zip: Sanford , FL , 32773 Permit Number. # ' ', _ 2 / y f p S, 20LOwner. Design Location: FL, Sanford Jurisdiction: qq s County:: v o A% SAihole ( londa Climate Zone 2) q9 % 1. New construction or existing New (From Plans) 9. Wall Types (1955.3 sqft.) Insulation Are 2. Single family or multiple family Single-family a. Concrete Block - Int Insul, Exterior R=4.1 1663.70 ft' b. Frame - Wood, Adjacent R=13.0 291.67 ft° 3. Number of units, if multiple family 1 c. N/A R= ft° 4. Number of Bedrooms 4 d. N/A R= ft' 5. Is this a worst case? No 10. Ceiling Types (1981.0 sqft.) Insulation Area a. Under Attic (Vented) R=30.0 1981.00 ft' 6. Conditioned floor area above grade (W) 1981 b. WA R= ft° Conditioned floor area below grade (W) 0 c. N/A R= ft' 11. Ducts R W 7. Windows(168.0 sqft.) Description Area a. Sup: Attic, Ret: Main, AH: Main 6 396.2 a. U-Factor: Dbl, U=0.34 120.00 ft' SHGC: SHGC=0.26 b. U-Factor: Dbl, U=0.58 48.00 ft° 12. Cooling systems kBtu/hr Efficiency SHGC: SHGC=0.25 a. Central Unit 30.0 SEER:14.00 c. U-Factor. N/A ft' SHGC: 13. Heating systems kStu/hr Efficiency d. U-Factor: N/A ft' a. Electric Heat Pump 30.0 HSPF:8.20 SHGC: Area Weighted Average Overhang Depth: 4.250 ft. Area Weighted Average SHGC: 0.257 14. Hot water systems 8. Floor Types (1981.0 sqft.) Insulation Area a. Electric Cap: 50 gallons a. Slab -On -Grade Edge Insulation R=0.0 1981.00 W b. Conservation features EF: 0.950 b. N/A R= ft' None c. N/A R= ft° 15. Credits Pstat Glass/Floor Area: 0.085 Total Proposed Modified Loads: 59.16 PASSTotalBaselineLoads: 60.13 1 hereby certify that the plans and specifications covered by Review of the plans and KE S7. this calculation are in compliance with the Florida Energy specifications covered by this O4- y Code. calculation indicates compliance Code. Ito %•, ' s:: ??aY3" with the Florida Energy 0 .,,,;:. ,,•, „ O PREPARED BY: "" Before construction is completed DATE: this building will be inspected for T1',' compliance with Section 553.908 I hereby certify that this building, as designed, is in compliance Florida Statutes. with the Florida Energy Code. COD WE' OWNER/AGENT: BUILDING OFFICIAL: DATE: DATE: /0- 2- 7 Compliance requires certification by the air handler unit manufacturer that the air handler enclosure qualifies as certified factory -sealed in accordance with R403.2.2.1. Compliance requires an Air Barrier and Insulation Inspection Checklist in accordance with R402.4.1.1 and an envelope leakage test report in accordance with R402.4.1.2. Compliance with a proposed duct leakage On requires a Duct Leakage Test Report confirming duct leakage to outdoors, tested in accordance with Section 803 of RESNET Standards, is not greater than 0.030 On for whole house. 4/24/2017 4:03 PM EnergyGauge® USA - FlaRes2014 Section R405.4.1 Compliant Software Page 1 of 4 FORM RAnz;-gn14 PROJECT Title: Building Type: Owner. of Units: Builder Name: Permit Office: Jurisdiction: Family Type: New/Existing: Comment: Lot 184 1981 TR User 1 Ashton Woods Seminole County Single-family New (From Plans) Bedrooms: 4 Conditioned Area: 1981 Total Stories: 1 Worst Case: No Rotate Angle: 0 Cross Ventilation: No Whole House Fan: No Address Type: Street Address Lot # 184 Block/SubDivision: PlatBook: Street: County: Seminole City, State, Zip: Sanford , FL. 32773 CLIMATE Design Location IECC Design Temp TMY Site Zone 97.5 % 2.5 % Int Design Temp Heating Design Daily Temp Winter Summer Degree Days Moisture Range FL, Sanford FL_ORLANDO_SANFOR 2 39 93 70 75 677 44 Medium BLOCKS Number Name Area Volume 1 Blockl 1981 18423.3 SPACES Number Name Area Volume Kitchen Occupants Bedrooms Infil10 Finished Cooled Heated 1 Main 1981 18423.3 Yes 5 4 1 Yes Yes Yes FLOORS Floor Type Space Perimeter R-Value Area Tile Wood Carpet 1 Slab -On -Grade Edge Insulatio Main 178.3 ft 0 1981 ft' 0 0 1 ROOF V # Type Roof Gable Roof Materials Area Area Color Solar Absor. SA Emitt Emitt Deck Pitch Tested Tested Insul. (deg) 1 Hip Composition shingles 2216 ft' 0 ft' Medium 0.6 N 0.5 No 0 26.6 ATTIC Type Ventilation Vent Ratio (1 in) Area RBS IRCC 1 Full attic Vented 300 1981 ft' N N CEILING Ceiling Type Space R-Value Ins Type Area Framing Frac Truss TypeE1UnderAttic (Vented) Main 30 Blown 1981 ft' 0.1 Wood 4/24/2017 4:03 PM EnergyGauge® USA - FlaRes2014 Section R405.4.1 Compliant Software Page 2 of 4 FORM R405-2014 WALLS At amt Adjacent Spate Cavity Width TA Wall Type Height Sheathing Framing Solar Below 1 2 3 4 5 N E S W W Exterior Concrete Block - Int Insul Main Exterior Concrete Block - Int Insul Main Exterior Concrete Block - Int Insul Main Exterior Concrete Block - Int Insul Main Garage Frame - Wood Main 4.1 60 0 9 4.1 44 9 9 4.1 48 9 9 4.1 24 9 9 13 31 3 9 4 560.0 ft' 4 417.7 ft' 4 455.0 ft' 4 231.0 ft' 4 291.7 ft' 0 0 0.6 0 0 0.6 0 0 0.6 0 0 0.6 0 0 0.01 0 0 0 0 0 DOORS Omt Door Type Space Storms U-Value Ft Width Height In Ft In Area 1 2 W Wood Main W Wood Main None None 39 3 39 2 6 10 20.5 ft' 10 6 10 19.4 ft' WINDOWS Orientation shown is the entered, Proposed orientation. J Wall Ornt ID Frame Panes NFRC U-Factor SHGC Overhang Area Depth Separation Int Shade Screening 1 2 3 4 5 N 1 Vinyl Low-E Double Yes e 2 Vinyl Low-E Double Yes e 2 Vinyl Low-E Double Yes e 2 Vinyl Low-E Double Yes W 4 Vinyl Low-E Double Yes 0.34 0.26 0.34 0.26 0.34 0.26 0.58 0.25 0.34 0.26 30.0 ft' 1 It 0 in 30.0 ft' 1 ft 0 in 30.0 ft' 8 ft 0 in 48.0 ft' 8 ft 0 in 30.0 ft' 1 It 0 in 1 ft 0 in None 1 ft 0 in None 1 ft 0 in None 1 ft 0 in None 1 ft 0 in None None None None None None GARAGE Floor Area Ceiling Area Exposed Wall Perimeter Avg. Wall Height Exposed Wall Insulation 1 402 ft' 384 ft' 64 ft 9.3 ft 0 INFILTRATION Scope Method SLA CFM 50 ELA EgLA ACH ACH 50 1 Wholehouse Proposed ACH(50) .000414 2149.4 118 221.91 .302 7 HEATING SYSTEM System Type Subtype Efficiency Capacity Block Ducts 1 Electric Heat Pump Split HSPF:8.2 30 kBtu/hr 1 sys#1 COOLING SYSTEM System Type Subtype Efficiency Capacity Air Flow SHR Block Ducts 1 Central Unit Split SEER: 14 30 k8tufir 900 cfm 0.75 1 sys#1 4/24/2017 4:03 PM EnergyGaugeO USA - FlaRes2014 Section R405.4.1 Compliant Software Page 3 of 4 FORM R405-2014 HOT WATER SYSTEM System Type SubType Location EF Cap Use SetPnt Conservation 1 Electric None Garage 0.95 50 gal 60.9 gal 120 deg None SOLAR HOT WATER SYSTEM FSEC Collector Storage Cert # Company Name System Model # Collector Model Area Volume FEF None None fta DUCTS Supply — Return— Air CFM 25 CFM25 HVAC # V # Location R-Value Area Location Area Leakage Type Handler TOT OUT ON RLF Heat Cool 1 Attic 6 396.2 ft Main 99.05 ft Prop. Leak Free Main cfm 59.4 cfm 0.03 0.50 1 1 TEMPERATURES Programable Thermostat: Y Ceiling Fans: Cooling((]] Jan Heatin[X] Jan Feb [[ ]] Mar fXl Feb [X] Mar r Apr [ pr [ May [X]]] Jun [X] Jul May [ Jun [ ] Jul XI AugX Aug Se Sep W Oct [ Nov Oct [X) Nov I Dec X] Dec Ventin [[ 11 Jan Feb [[XX]) Mar A r [) Ma [ Jun [ ] Jul Au Se Oct LXI Nov Dec Thermostat Schedule: HERS 2006 Reference Hours Schedule Type 1 2 3 4 5 6 7 8 9 10 11 12 Cooling (WD) AM 78 78 78 78 78 78 78 78 80 80 80 80 PM 80 80 78 78 78 78 78 78 78 78 78 78 Cooling (WEH) AM 78 78 78 78 78 78 78 78 78 78 78 78 PM 78 78 78 78 78 78 78 78 78 78 78 78 Heating (WO) AM 66 66 66 66 66 68 68 68 68 68 68 68 PM 68 68 68 68 68 68 68 68 68 68 66 66 Heating (WEH) AM 66 66 66 66 66 68 68 68 68 68 68 68 PM 68 68 68 68 68 68 68 68 68 68 66 66 MECHANICAL VENTILATION Type Supply CFM Exhaust CFM Fan Watts HRV Heating System Run Time Cooling System Runtime Vent 65 0 0 1 - Electric Heat Pump 1 - Central Unit 4/24/2017 4:03 PM EnergyGauge® USA - FlaRes2014 Section R405.4.1 Compliant Software Page 4 of 4 FORM R405-2014 ENERGY PERFORMANCE LEVEL (EPL) DISPLAY CARD ESTIMATED ENERGY PERFORMANCE INDEX" = 98 The lower the EnergyPerformance Index, the more efficient the home. 1. New construction or existing 2. Single family or multiple family 3. Number of units, if multiple family 4. Number of Bedrooms 5. Is this a worst case? 6. Conditioned floor area (ft ) 7. Windows" Description a. U-Factor. Dbl, U=0.34 SHGC: SHGC=0.26 b. U-Factor: Dbl, U=0.58 SHGC: SHGC=0.25 c. U-Factor. WA SHGC: d. U-Factor: N/A SHGC: Area Weighted Average Overhang Depth: Area Weighted Average SHGC: S. Floor Types a. Slab -On -Grade Edge Insulation b. N/A c. N/A Sanford, FL, 32773 New (From Plans) 9. Wall Types Insulation Area Single-family a. Concrete Block - Int Insul, Exterior R=4.1 1663.70 ft2 b. Frame - Wood, Adjacent R=13.0 291.67 ft 1 c. WA R= ft' 4 d. N/A R= ft' 10. Ceiling Types Insulation Area No a. Under Attic (Vented) R=30.0 1981.00 ft' 1981 b. N/A R= ft' Area c. WA R= ft' 120.00 ft' 11. Ducts R ft' a. Sup: Attic, Ret: Main, AH: Main 6 396.2 48.00 ft' 12. Cooling systems kBtu/hr Efficiency ft' a. Central Unit 30.0 SEER:14.00 Insulation R=0.0 R= R= ft' 13. Heating systems kBtu/hr Efficiency a. Electric Heat Pump 30.0 HSPF:8.20 4.250 ft. 0.257 Area 14. Hot water systems 1981.00 ft' a. Electric Cap: 50 gallons EF: 0.95 ft' ft, b. Conservation features None 15. Credits Pstat I certify that this home has complied with the Florida Energy Efficiency Code for Building Construction through the above energy saving features which will be installed (or exceeded) in this home before final inspection. Otherwise, a new EPL Display Card will be completed based on installed Code compliant features. Builder Signature: n .. ,y Date: $ lq l Py Address of New Home: Ukoac ` City/FL Zip: SaJ OA IPL otttt: sr-4 tea:. i;a` „ M2 Note: This is not a Building Energy Rating. If your Index is below 70, your home may qualify for energy efficient mortgage (EEM) incentives if you obtain a Florida EnergyGauge Rating. Contact the EnergyGauge Hotline at (321) 638-1492 or see the EnergyGauge web site at energygauge.com for information and a list of certified Raters. For information about the Florida Building Code, Energy Conservation, contact the Florida Building Commission's support staff. Label required by Section R303.1.3 of the Florida Building Code, Energy Conservation, if not DEFAULT. 4/24/2017 4:03 PM EnergyGauge® USA - FlaRes2014 - Section R405.4.1 Compliant Software Page 1 of 1 FORM R405-2014 TABLE 402.4.1. AIR BARRIER AND INSULATION INSPECTION COMPONENT CRITERIA Project Name: Lot 184 1981 TR Builder Name: Ashton Woods Street: Permit Office: Seminole County City, State, Zip: Sanford , FL. 32773 Permit Number. Owner. Jurisdiction: Design Location: FL, Sanford COMPONENT CRITERIA CHECK Air barrier and thermal barrier A continuous air barrier shall be installed in the building envelope. Exterior thermal envelope contains a continuous barrier. Breaks or joints in the air barrier shall be sealed. Air -permeable insulation shall not be used as a sealing material. Ceiling/attic The air barrier in any dropped ceiling/soffit shall be aligned with the insulation and any gaps in the air barrier shall be sealed. Access openings, drop down stairs or knee wall doors to unconditioned attic spaces shall be sealed. Corners and headers shall be insulated and the junction of the foundation Walls and sill plate shall be sealed. The junction of the top plate and the top or exterior walls shall be sealed. Exterior thermal envelope insulation for framed walls shall be installed in substantial contact and continuous alignment with the air barrier. Knee walls shall be sealed. Windows, skylights and doors The space between window/door jambs and framing and skylights and framing shall be sealed. Rim joists Rim joists are insulated and include an air barrier. Floors (including above -garage Insulation shall be installed to maintain permanent contact with underside and cantilevered floors) of subfloor decking. The air barrier shall be installed at any exposed edge of insulation. Crawl space walls Where provided in lieu of floor insulation, insulation shall be permanently attached to the crawlspace walls. Exposed earth in unvented crawl spaces shall be covered with a Class I vapor retarder with overlapping joints taped. Shafts, penetrations Duct shafts, utility penetrations, and flue shaft openings to exterior or unconditioned space shall be sealed. Narrow cavities Batts in narrow cavities shall be cut to fit, or narrow cavities shall be filled by insulation that on installation readily conforms to the available cavity spaces. Garage separation Air sealing shall be provided between the garage and conditioned spaces. Recessed lighting Recessed light fixtures installed in the building thermal envelope shall be air tight, IC rated, and sealed to the drywall. Plumbing and wiring Batt insulation shall be cut neatly to fit around wiring and plumbing in exterior walls, or insulation that on installation readily conforms to available space shall extend behind piping and wiring. Shower/tub on exterior wall Exterior walls adjacent to showers and tubs shall be insulated and the air barrier installed separating them from the showers and tubs. Electrical/phone box on The air barrier shall be installed behind electrical or communication boxes or air sealed boxes shall be installed. HVAC register boots HVAC register boots that penetrate building thermal envelope shall be sealed to the sub -floor or drywall. Fireplace An air barrier shall be installed on fireplace walls. Fireplaces shall have gasketed doors 4/24/2017 4:03 PM EnergyGauge® USA - FlaRes2014 Section R405.4.1 Compliant Software Page 1 of 1 FLORIDA ENERGY EFFICIENCY CODE FOR BUILDING CONSTRUCTION Envelope Leakage Test Report Prescriptive and Performance Method Project Name: Lot 184 1981 TR Builder Name: Ashton Woods Street: Permit Office: Seminole County City, State, Zip: Sanford, FL , 32773 Permit Number. Design Location: FL, Sanford Jurisdiction: Cond. Floor Area:: 1981 sq.ft. Cond. Volume: 18423 cu ft. Envelope Leakage Test Results Regression Data: C n: R: Single or Multi Point Test Data HOUSE PRESSURE I FLOW: Leakage Characteristics CFM(50): ELA: EgLA: ACH: ACH(50): SLA: R402.4.1.2 Testing. The building or dwelling unit shall be tested and verified as having an air leakage rate of not exceeding 5 air changes per hour in Climate Zones 1 and 2, 3 air changes per hour in Climate Zones 3 through 8. Testing shall be conducted with a blower door at a pressure of 0.2 inches w.g. (50 Pascals). Where required by the code official, testing shall be conducted by an approved third party. A written report of the results of the test shall be signed by the party conducting the test and provided to the code official. Testing shall be performed at any time after creation of all penetrations of the building thermal envelope. During testing: 1. Exterior windows and doors, fireplace and stove doors shall be dosed, but not sealed, beyond the intended weatherstripping or other infiltration control measures: 2. Dampers including exhaust, intake, makeup air, backdraft and flue dampers shall be closed, but not sealed beyond intended infiltration control measures; 3. Interior doors, if installed at the time of the test, shall be open; 4. Exterior doors for continuous ventilation systems and heat recovery ventilators shall be closed and sealed; 5. Heating and cooling systems, if installed at the time of the test, shall be turned off; and 6. Supply and return registers, if installed at the time of the test, shall be fully open. I hereby certify that the above envelope leakage performance results demonstrate compliance with Florida Energy Code requirements in accordance with Section R402.4.1.2. SIGNATURE: PRINTED NAME: DATE: Where required by the code official, testing shall be conducted by an approved third party. A written report of the results of the test shall be signed by the third party conducting the test and provided to the code official. BUILDING OFFICIAL: DATE: 0*-THE STgT ram "•''• ,.,:;.: rya r lit coo WE 4/24/2017 4:03 PM EnergyGauge® USA - FlaRes2014 - Section R405.4.1 Compliant Software Page 1 of 1 FORM R405-2014 Duct Leakage Test Report Performance Method FLORIDA ENERGY EFFICIENCY CODE FOR BUILDING CONSTRUCTION Form R405 Duct Leakage Test Report Performance Method Project Name: Lot 184 1981 TR Builder Name: Ashton Woods Street: Permit Office: Seminole County City, State, Zip: Sanford, FL , 32773 Permit Number: Design Location: FL, Sanford Jurisdiction: Duct Test Time: Post Construction Duct Leakage Test Results CFM25 Duct Leakage Test Values Line System Outside Duct Leakage 1 System 1 cfm25(Out) 2 System 2 cfm25(Out) 3 System 3 cfm25(Out) 4 System 4 cfm25(Out) 5 Total House Sum lines 1-4 Duct System Divide byLeakage Total Conditioned Floor Area) Qn,Out) I certify the tested duct leakage to outside. On, is not greater than the proposed duct leakage On specified on Form R405-2014. SIGNATURE: PRINTED NAME: DATE: Duct tightness shall be verified by testing to Section 803 of the RESNET Standards by an energy rater certified in accordance with Section 553.99, Florida Statutes. BUILDING OFFICIAL: DATE: 0,-tttE Srt u1,•. ;;?ram„ O 424/2017 4:04 PM EnergyGaugeO USA - FlaRes2014 - Section R405.4.1 Compliant S Page 1 of 1 Prot SJob: Ashton- StariightBrisson wrightsofte Project Summary Date: 4/14/2017 Entire House By: Energy Air, Inc Plan: 1981 S 5401 Energy Air, Ct, Orlando, Fl. 32810 Phone: 407-886-3729 Email: GRenner@wergyaircom Web, www.energyair.com For: Lot 184 1981 TR, Ashton Woods Homes Sanford, FL 32773 Notes: Design Information j Weather: Orlando Executive AP, FL, US Winter Design Conditions Summer Design Conditions Outside db 44 OF Outside db 93 OF Inside db 70 OF Inside db 75 OF Design TD 26 OF Design TD 18 OF Daily range L Relative humidity 50 Moisture difference 44 gr/lb Heating Summary Sensible Cooling Equipment Load Sizing Structure 17497 Btuh Structure 16968 Btuh Ducts 1538 Btuh Ducts 2048 Btuh Central vent (65 cfm) 1830 Btuh Central vent (65 cfm) 1248 Btuh Humidification 0 Btuh Blower 0 Btuh Piping 0 Btuh Equipment load 20865 Btuh Use manufacturer's data y Rate/ swing multiplier 1.00 Infiltration Equipment sensible load 20265 Btuh Method Simplified Latent Cooling Equipment Load Sizing Construction quality Semi -tight Fireplaces 0 Structure 2278 Btuh Ducts 197 Btuh Heating Cooling Central vent (65 cfm) 1917 Btuh Area ( ft2) 1981981 Equipment latent load 4391 Btuh Volume (ft3) 18498 18498 Air changes/ hour 0.26 0.14 Equipment total load 24656 Btuh Equiv. AVF ( cfm) 80 43 Req. total capacity at 0.75 SHR 2.3 ton Heating Equipment Summary Cooling Equipment Summary Make Carrier Make Carrier Trade CARRIER AIR CONDITIONING Trade CARRIER AIR CONDITIONING Model CH14NBO300000A Cond CH14NBO300000A AHRI ref 7835429 Coil FB4CNP030L AHRI ref 7835429 Efficiency 8. 2 HSPF Efficiency 11.7 EER, 14 SEER Heating input Sensible cooling 21450 Btuh Heating output 28600 Btuh @ 47°F Latent cooling 7150 Btuh Temperature rise 29 OF Total cooling 28600 Btuh Actual air flow 899 cfm Actual air flow 899 cfm Air flow factor 0.047 cfm/Btuh Air flow factor 0.047 cfm/Btuh Static pressure 0.50 in H2O Static pressure 0.50 in H2O Space thermostat Load sensible heat ratio 0.82 Capacity balance point = 37 OF Backup: Input = 6 kW, Output = 19028 Btuh, 100 AFUE Bold/italic values have been manually overridden Calculations approved by ACCA to meet all requirements of Manual J 8th Ed. Wrl htsoft• 9 RightUniversal 2017 17.0.08 RSU17013 2017-Apr- 2415:5849 Suite® page 1 ACC % ...t SpeciricMyndham Preserve\Lot 184 1981 TR rup Calc = W8 Front Door faces: W Manual S ComplianceReport Job: Ashton- StaltightBrisson wrightsoft• Date: 4/14/2017 Entire House By: Energy Air, Inc Plan: 1981 S 5401 Energy Air, Ct, Orlando, FL 32810 Phone: 407-886-3729 Email GRenner@enerpyaircom Web: www.energyair.com Project• • For: Lot 184 1981 TR, Ashton Woods Homes Sanford, FL 32773 Cooling Equipment Design Conditions Outdoor design DB: 92.6°F Outdoor design WB: 75.9°F Indoor design OB: 75.0OF Indoor RH: 50% Sensible gain: 20265 Btuh Latent gain: 4391 Btuh Total gain: 24656 Btuh Estimated airflow: 899 cfm Manufacture's Performance Data atActual Design Conditions Equipment type: Split ASHP Manufacturer: Carrier Model: CH14NB0300000A+FB4CNP030L Actual airflow: 899 cfm Sensible capacity: 20916 Btuh 103% of load Latent capacity: 5203 Btuh 118% of load Total capacity: 26119 Btuh 106% of load SHR: 80% Heating Equipment Design Outdoor design DB: 44.2OF Heat loss: 20865 Btuh Indoor design DB: 70.0OF Manufacturer's Performance Data atActual Design Conditions Equipment type: Split ASHP Manufacturer: Carrier Model: CH14NB0300000A+FB4CNP030L Actual airflow: 899 cfm Output capacity: 28600 Btuh 137% of load Supplemental heat required: 0 Btuh Backup equipment type: Elec strip Manufacturer: Model: Actual airflow: 899 cfm Output capacity: 5.6 kW 91 % of load Temp. rise: 50 OF Meets are all requirements of ACCA Manual S. Entering coil DB: 76.3°F Entering coil WB: 63.7°F Entering coil DB: 68.1 OF Capacity balance: 37 OF Economic balance:-99 OF 2017-Apr-24 15 58 49 wrightsoft• Right -Suite® Universal 2017 17.0.08 RSU17013 Page 1 ACCA ...t Specific\Wyndham Preserve\Lot 184 1981 TR.rup Celc = MJ8 Front Door feces: W Duct System Summary Job: Ashton- StarlightBtisson wrightsofte Date: 4/1412017 Entire House By: Energy Air, Inc Plan: 1981 S 5401 Energy Air, Ct, Orlando, FL 32810 Phone. 407-886-3729 Email: GRenner(8energyair.com Web: www energyair.com For: Lot 184 1981 TR, Ashton Woods Homes Sanford, FL 32773 Heating Cooling External static pressure 0. 50 in H2O 0.50 in H2O Pressure losses 0.22 in H2O 0.22 in H2O Available static pressure 0. 28 in H2O 0.28 in H2O Supply / return available pressure 0.140 / 0.140 in H2O 0.140 / 0.140 in H2O Lowest friction rate 0. 165 in/l00ft 0.165 in/l00ft Actual air flow 899 cfm 899 cfm Total effective length (TEL) 170 ft Name Design Btuh) Htg cfm) Clg cfm) Design FIR Diam in) H x W in) Duct Mail Actual Ln ( ft) Ftg. Egv Ln (ft) Trunk be 2 C 140 3 7 0.194 4.0 Ox 0 VIFx 24.7 120.0 st3 bed2 h 1195 56 44 0.181 5.0 Ox 0 VIFx 29.4 125.0 st2 bed4 c 2553 ill 121 0.181 7.0 Ox 0 VIFx 29.4 125.0 st3 br3-A h 1188 56 39 0.177 5.0 Ox 0 VIFx 33.1 125.0 st3 toyer h 1292 61 51 0.332 5.0 Ox 0 VIFx 9.3 75.0 kit-din-Fam C 2691 94 127 0.198 7.0 OX 0 VIFx 21.5 120.0 stl kit-din-Fem-A c 2690 94 127 0.193 7.0 Ox0 VIFx 25.3 120.0 stl kit-din-Fam-B C 2690 94 127 0.189 7.0 OX 0 VIFx 27.9 120.0 stl laun c 834 15 39 0.329 4.0 Ox 0 VIFx 10.0 75.0 mbe h 743 35 21 0.177 4.0 Ox0 VIFx 33.2 125.0 st2 m br h 3013 142 123 0.171 7.0 Ox0 VIFx 33.5 130.0 st2 m VAC h 1413 67 32 0.165 5.0 OX 0 VIFx 40.0 130.0 st2 Nne2-A c 48 1 2 0.181 4.0 Ox 0 VIFx 29.8 125.0 st2 v^c3-A h 533 25 12 0.174 4.0 OX 0 VIFx 35.7 125.0 st3 WC -A h 955 45 26 0.175 4.0 OX 0 VIFx 40.3 120.0 st3 Trunk Htg Clg Design Veloc Diam H x W Duct Name Type cfm) cfm) FIR fpm) in) in) Material Trunk stl Peak AVF 281 381 0.189 699 10.0 0 x 0 VinlFlx st2 Peak AVF 302 223 0.165 553 10.0 0 x 0 VinlFlx st3 Peak AVF 241 204 0.174 545 9.0 0 x 0 VinlFlx Bold/italic values have been manually overridden 2017-Apr-24 15: 58:49 wrightsoft' Right -Suite® Universal 2017 17.0.08 RSU17013 ACCA ..t S ecitic\ Page t p Wyndham Preserve\Lot 184 1981 TR.rup Calc = MJ8 Front Door faces: W Return Branch Detail Table Name Grill Size (in) Htg cfm) Clg cfm) TEL ft) Design FIR Veloc fpm) Diam in) H x W in) Stud/Joist Opening (in) Duct Mad Trunk rbl Ox0 899 899 0 0 0 0 Ox 0 VIFx 2017-Apr-24 15:58:49 wrightSOft• Right -Suite® Universal 2017 17.0.08 RSU17013 Page 2 ACC% ...t SpecifidWyndham Preserve\Lot 184 1981 TR.Np Calc - MA Front Ooor faces: W Job M Ashton- Starlight Brisson Perforrned for: Lot 184 1981 TR, Sanford, FL 32773 Level 1 Energy Air, Inc 5401 EnergyAir, Ct Orlando, FL 32810 Phone: 407-886-3729 www.energyair.com GRenner@energyair.com Qq Scale: 1/8" = 1'0" Page 1 RightSuite® Universal 2017 17.0.08 RSU17013 2017-Apr-24 15:58:56 ham Preserve\Lot 184 1981 TR.rup 1-1/2" VTR 1-1/2" VTR VTR A Jl 2„ 1! AUTO VENT KS LAV 2" LAV 2" WC 3" WC m to3" 381 soto 309 O 2" -oSH 39* TUB is v N v cod a i Off? ao PLAN 198 PLUMBING RISER DIAGRAM WYNDHAM PRESERVE - LOT 184 W a PLOT PLAN o e i 'v> c N BUIIAING LAYOUT NOTE: C N II Contractor and owner ore to verify all 4) setbacks, building dimensions, and layout shown hereon prior to any construction, and C a wimmediatelyadviseGeoPointSurveying, Inc. of any deviation from information shown hereon. WYNDHAM PRESERVE BP 1 7 - Zy%8 a w+ 0 m Failure to do so will be at user's sole risk. LOT 184 v t C Propose&NIN ^ bATI.JW[-7_ m.? o Ok to construct single family home with setbacks and impervious arep. a T o I POINT OF shown on plan. ' a iyy• q z 0 N COMMENCEMENT I Iq8( OP61,'4 elev.- T NORTHWEST CORNER OF THE I LOT ]83 LOT 216 NORTHEAST 1/4 OF PCP I SECTION 17-20-31 CCR #55989 13, ' i N89'4303E 115.00' 2 s I i. ' WESTERLY LINE OF a) a n 0 125.3 ' 60.0 29.7' THE NORTHEAST 1/4 v I OF SEC 17-20-31 BASIS OF BEARING) o w p N, 0 I I 9 PROPOSED o o a c I 1 STORY RESIDENCE a a' a A a o , i I PROPOSED 4029 NIGHT HERON DRIVE N a ,. , Z 3 E ICONC WALK 11.3 I LOT 184 p 0 a0 a y Q MODEL I COVERED 8.0 25.3 PORCH 1981 OPHELIA AREA = p LOT 215 3 i.o W 9 3 ELEVATION - T 6,900 S.F. ± w I _ ~ vrn >it I GARAGE -RIGHT c a) I b a PROPOSED ; c FFE= 28.0 Nt° N Q O O " O DRIVEWAY v I Q I to Q I Q QZiriQ50.0 29.7' POINT OF i. ^ A/C r N89'40'51 "E BEG N;NING I '` rj PAD f` 520.62 zs9 115. 00' S89'43'OJ V PCP I LOT 185 I LOT 214 Building Setbacks Setbacks: Per construction plans for WYNDHAM PRESERVE% City of Sanford, Seminole County, Florida. Front = 25' Rear = 20' Side = 7.5' LEGAL DESCRIPTION DESCRIPTION: A parcel of land lying in Section 17, Township 20 South, Range 31 East, Seminole County, Florida, and being more particularly described as follows: COMMENCE at the Northwest corner of the Northeast 1/4 of said Section 17, run thence along the West line of the Northeast 1/4 of said Section 17, S.00°19'09"E., a distance of 1459.07 feet; thence N.89040'51"E., a distance of520.62 feet to the POINT OF BEGINNING; thence N.00°16'57"W., a distance of 60.00 feet; thence N.89043'03"E., a distance of 115.00 feet; thence S.00016'57"E., a distance of 60.00 feet; thence S.89°43'03"W., a distance of 115.00 feet; to to the POINT OF BEGINNING. Containing 6,900 Square feet, more or less. rLB-roof ed rent LBGFJM-ADUSSD-Access/Drainage/Utilities/SidewalkLB -Licensed Business revBFP-Bockflow Preventer Si ht Distance Easement9 S -Survey PRM -Permanent Ref. Monument R -Reported PCP -Permanent Control Point D -Description FP&L -Florida Power do Light P -Plat FFE -Finish Floor Elevation D. . -Deed Book Water Meter O.R.-Official Records Book 04-Water Valve P.B. -Plot Book V-Fire Hydrant Pg.—Page RC® —Reclaimed Water Meter Elev.—Elevation RCD4—Reclaimed Water Valve Conc. —Concrete Cable Box BP —Brick Paver m—Telephone Box SW—Sidewolk EI —Electric Box FFE—Finished Floor Elevation O-Utility Pole CI —Curb Inlet Guy Pole GTI—Grote Top Inlet Light Pole P.U.E.—Public Utility Easement Guy Anehor RCP —Reinforced Conc. Pipe OU--Overhead Utilities PVC —Polyvinyl Chloride O —Storm Sewer Manhole NCS —No Comer Set (Falls in Water) G —Sanitary Sewer Manhole SF —Square Feet EHHo —Electric Hondhole D.U.E.—Drainage/Utility Easement COO —Clean Out FMGD—MAG NAIL do DISK XVD4—Irrigation Control Valve P.K.—Parker Kolon Nail I' —Sign SIR —Set 1 /2' Iron Rod LB7768 wD4—Gate Water Valve SPKD —Set P.K. & Disk LB7768 Gas Meter FIR —Found 1/2' Iron Rod LB7768 I- —Existing Grade FIP—Found 1/2' Iron Pipe LB7768 Cl —Blow—off Valve FPKD—Found P.K. Nail & Disk LB7768 --—Drainage now Direction FCM —Found 4'x4' Concrete Proposed Design Grade Monument PRM L87778 —As—Built/Existing GradQQ Note: Some items in above leaen may not be ODDlicable) Description I Date I Dwn.ICk'd I P.C.IOrder No. PAD SURVEYOR'S NOTES: 1. Current title information on the subject property had not been fumished to GeoPoint Surveying, Inc. at the time of this plot plan. 2. Roods, walks, and other similar items shown hereon were taken from engineering plans and are subject to survey. 3. Elevations shown hereon ore in feet and are referenced to the NATIONAL GEODETIC VERTICAL DATUM OF 1929 (NGVD29). 4. Proposed grades do finished floor elevations shown hereon are from the construction plan for "WYNDHAM PRESERVE', City of Sanford Seminole County, Florida. 5. This Plot Plan is subject to matters shown on the construction plans for "WYNDHAM PRESERVE', City of Sanford Seminole County, Florida. 6. Proposed information shown based on proposed/ supplied plan and/or instructions per client (not field verified) PLOT PLAN ONLY NOT A SURVEY) For Permitting ONLY) Jal es D. Leviner 5FLORIDAPROFESSIONALSURVEYORdoMAPPERNO . ............LS691 NOT VAUD WITHOUT THE SIGNATURE AND THE ORIGINAL DIIIIENSION NOTE: Proposed building dimensions shown hereon are of the exterior. LOT AREA CALCULATIONS LOT = 6,900 SQ.FT. LIVING AREA= 1,981 SQ.FT. GARAGE = 402 SQ.FT. PORCH = 78 SQ.FT. DRIVEWAY = 405 SQ.FT. AG: -Jo LANAI = 181 SQ.FT. WALKWAY = 45 SQ.FT. IMPERVIOUS= 44.0 X dj'/o SOD = 3,808 SQ.F I. OFF LOT AREA CALCULATIONS R/W = 1,500 SQ.FT. APRON = 114 SQ.FT. SIDEWALK = 300 SQ.FT. SOD = 246 SQ.FT. TOTAL AREA AREA 8,400 SQ.FT. DRIVEWAY = 519 SQ.FT. SIDEWALK = 345 SQ.FT. SOD = 4,054 SQ.FT. PREPARED FOR: ASHTON WOODS FLOOD ZONE: The property shown hereon is on the Federal Emergency Management Agency's Flood Insurance Rate Mop Panel Number 12127C-0765H. in Flood Zone I" DESCRIPTION: PROPOSED LOT 184, according to the plat of "WYNDHAM PRESERVE", City of Sanford, Seminole County, Florida 555 Winderley Place, Suite 109 Maitland, FL 32751 Phone: (321) 270-0440 Fax: (813) 248-2266 Licensed Business No. LB 7768 1 GeoPoint Surveying, Inc. Drawn: JE I Checked: JDL I P.C.: Data File:BriaimfAd-Plat Date:04/18/17 Dwg:Brh=fAdt LdI54 Order No.: ^ SEC. 17 - TWN. 20 S. - RNG. 31 E.1 Field Bk: RECORD COPY PAL.Mr=RfW ELECTRIC Ashton Woods Homes Winter Haven, Lake Wales, Seminole 1981 Starlight LOAD CALCULATION May 26, 2017 1. HVAC LOADS (NEC 2011 - 220.82(C)(31- (411 ZONE COMPRESSOR SIZE CONNECTED LOAD 1 3.00 TON 5.40 KVA 2 TON 3 TON 4 TON 5 TON ZONE AIR HANDLER BLOWER MOTOR CONNECTED LOAD 1 7.00 KVA 0.67 7.67 KVA 2 KVA 3 KVA 4 KVA 5 KVA TOTAL CONNECTED LOAD FOR HVAC SYSTEMS 13.07 KVA TOTAL LOAD FOR COMPRESOR @ 100% 5.40 KVA TOTAL LOAD FOR AIR HANDLER Q 65% 4.99 KVA TOTAL HVAC DEMAND LOAD 10.39 KVA If. GENERAL LOADS (NEC 2011 - 220.82(Bl(I)- (4)1 LIGHTING 1981 Sq Ft @ 3VA/Sq. Ft 5.94 KVA QTY VALUE TOTAL KVA 2 SMALL APPLIANCE CIRCUITS 1.50 300 KVA I LAUNDRY CIRCUIT 1.50 1.50 KVA I DRYER CIRCUIT 5.00 5.00 KVA 0 STACK WASHER/DRYER 5.00 1 WATER HEATER (1) 4.50 4.50 KVA 0 WATER HEATER (2) 4.50 1 DISHWASHER gU1L01,yC 1.20 1.20 KVA I DISPOSAL(1) 0.80 0.80 KVA 0 DISPOSAL(2) SA vFo 080 0 noRANGE/OVEN(1) 7.20 1 RANGE/OVEN (2) 0, ART1A 12.00 12.00 KVA COOKTOP CIRCUIT 7.20 SUMMER KITCHEN/JENAIR GAS 1.50 I MICROWAVE CIRCUIT R 2.50 2.50 KVA 0 JACUZZI TUB CIRCUIT 7 2 4 r g 4.80 0 40 AMP CAR CHARGER 9.60 30AW POOL CIRCUIT 720 60AMP POOL CIRCUIT 1440 0 80AMP POOL CIRCUIT 1920 CONNECTED LOAD (GENERAL LOADS) 36.44 KVA I ST 10 KVA (GENERAL LOADS) Q 100% 10.00 KVA REMAINDER (GENERAL LOADS) @ 40% 10.58 KVA SUBTOTAL (GENERAL LOADS) (NEC 2011 - 220.82(B)1 20.58 Q KVA HVAC LOADS 10.39 KVA GENERAL LOADS 20.58 KVA TOTAL DEMAND LOAD (NEC 2011 - 220.82(All 30.96 KVA MINIMUM SERVICE SIZE 129.01 AMPS RECOMMENDED SERVICE SIZE I50 AMPS Typical 150 Amp Electrical Diagram 150-Amp Main 120V/240V RECORD COPY Typical 150 Amp Interior Panel evlL01ti6 SANFORD FAgR oil _2LI8 2/0 SER Aluminum Service Cable Or 2" Conduit & (3) 2/0 XHHW AL & (1) 1/0 XHHW AL 250.94 Intersystem Bonding Bridge Power Company Secondary Conduit & Wire q- 4 Bare Copper Per NEC 250.66 B Ground Clamp I 1-2 .............. Concrete Encased Electrode Lumber design values are in accordance with ANSI/TPI 1 section 6.3 These truss designs rely on lumber values established by others. RECORD COPY RE: 1111656 - MiTek USA, Inc. Site Information: 66T904 Parke East Blvd. Customer Info: Starlight Project Name: Lot 184 Wyndham Preserve Model: 1981a p iieliA Taa115 Lot/Block: 184 Subdivision: Wyndham Preserve Address: N/A City: Sanford State: FL Name Address and License # of Structural Engineer of Record, If there is one, for the building. Name: License #: Address: City: State: General Truss Engineering Criteria & Design Loads (Individual Truss Design Drawings Show Special Loading Conditions): Design Code: FBC2014/TP12007 Design Program: MiTek 20/20 7.6 Wind Code: ASCE 7-10 Wind Speed: 140 mph Roof Load: 37.0 psf Floor Load: N/A psf This package includes 24 individual, Truss Design Drawings and 0 Additional Drawings. With my seal affixed to this sheet, I hereby certify that I am the Truss Design Engineer and this index sheet conforms to 61G15-31.003, section 5 of the Florida Board of Professional Engineers Rules. No. I Seal# I Truss Name I Date I No. I Seal# I Truss Name Date16/411T113628821A016/14/17 118 1 T11362899 1 CJ5A A 117 12 1 T113628831 A02 1 6/14/17 119 I T11362900 1 EJ7 1 6/14/17 13 1 T11362884 1 A03 1 6/14/17 120 I T11362901 1 EJ7B 1 6/14/17 I 14 1 T11362885 1 A04 1 6/14/17 121 1 T11362902 1 H 1 1 6/14/17 15 1 T11362886 1 A05 1 6/14/17 122 I T113629031 HJ7 1 6/14/17 I 6 1 T11362887 1 A06 6/ 14/17 123 1 T11362904 1 V3 6/14/17 17 1 T11362888 1 A07 6/ 14/17 124 1 T1 1362905 1 V5 1 6/14/17 1 18 1 T11362889 1 A08 1 6/ 14/17 I 1 1 1 1 19 1 T11362890 1 A09 1 6/ 14/ 17 110 1 T11362891 1 A010 1 6/14/17 Ill I T11362892 1 A011 1 6/14/17 112 I T113628931 AO12 1 6/14/17 113 1 T113628941 A013 1 6/14/17 114 1 T113628951 CJ1 1 6/14/17 115 1 T1 1362896 1 CJ3 1.6/14/ 17 116 1 T11362897 1 CJ3A 1 6/14/17 117 1 T11362898 1 CJ5 1 6/14/17 The truss drawing(s) referenced above have been prepared by MiTek USA, Inc. under my direct supervision based on the parameters provided by Builders FirstSource (Groveland, FL). Truss Design Engineer's Name: Albani, Thomas My license renewal date for the state of Florida is February 28, 2019. IMPORTANT NOTE: The seal on these truss component designs is a certification that the engineer named is licensed in the jurisdiction(s) identified and that the designs comply with ANSI/rPI 1. These designs are based upon parameters shown (e.g., loads, supports, dimensions, shapes and design codes), which were given to MiTek. Any project specific information included is for MiTek's customers file reference purpose only, and was not taken into account in the preparation of these designs. MiTek has not independently verified the applicability of the design parameters or the designs for any particular building. Before use, the building designer should verify applicability of design parameters and properly incorporate these designs into the overall building design per ANSI/rPI 1, Chapter 2. 4ptlnrNc SANFORD I NRTM 1 V 11- 44 0 F9380 A E OF 9/M %% 1` 1 Thomas A. Albanl PE No.39380 MRek USA, Inc. FL Cart 8634 6904 Parke East Blvd. Tampa fl 33610 Date: June 14, 2017 Albani, Thomas 1 of 1 ofuss Truss Type city ply T11362862 11116S6 I.-ol Hip Girder 1 1 Job Reference(optional) 10:4xiZSyO5prlperCOHMLIOg1zP836 3hCJuaVx4RUvWrrJ,KgpwtOw8Mxi5hvd2bIt25z6MW5 1, -0 0 3-9.14 7-0-0 12.1. 5 17.2.11 1 27.5.5 32.6-t 1 37.8-0 40.10.2 , 44.8-0 4b•8-0 0 3.9-14 3.2.2 5-1-5 5.1.5 5. .5 S. 5 1.5 5.1.5 3.2.2 3.9.14 -0 Scale = 1:81.6 Sx6 = 5.00 f 12 5x8 2x4 II U8 = 3x8 MT20HS= 4 33 34 5 35 36 6 37 7 8 38 3x6 = 3x6 = 2x4 II 5x8 = 39 9 40 10 11 41 42 43 12 15 r7 0 26 25 44 45 24 46 47 23 22 48 21 49 50 51 52 20 19 53 54 18 55 56 17 16 3x6 = 2x4 II 30 = 5x8 = 3x6 = 1.Sx8 STP= US = Sx8 = 3x4 = 2x4 II 3x6 = 2x4 11 6x8 = 3x6 = LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Well Ud TCLL 20.0 Plate Grip DOL 1.25 TC 0.85 Vert(LL) 0.15 17-18 >999 240 TCDL 7.0 Lumber DOL 1.25 BC 0.74 Vert(TL) -0.27 17-18 >999 180 BCLL 0.0 ' Rep Stress Incr NO W B 0.81 Horz(TL) 0.06 14 n/a We BCDL 10.0 Code FBC2014/TPI2007 (Matrix-M) LUMBER- BRACING - TOP CHORD 2x4 SP No.2 'Except' TOP CHORD 4.7,7.10: 2x4 SP No.1 BOT CHORD BOT CHORD 2x4 SP No.2 WEBS WEBS 2x4 SP No.3 'Except' 8-20: 2x4 SP No.2 REACTIONS. (Ib/size) 2=1053/0.8-0, 21=3967/0.8.0, 14=1180/0-8-0 Max Horz2=-78(LC 28) Max Up11112=-542(LC 8), 21=-1877(LC 4), 14=-608(LC 9) Max Grav2=1061(LC 19), 21=3967(LC 1). 14=1187(LC 20) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2-3=-2025/1020, 3-4=-1873/977. 4.33=-1389/790, 33-34=-1389/790, 5.34=-13891790. 5-35=-1389/790. 35-36=-1389r790, 6-36=-1389/790, 6-37=-1203/2662, 7-37=-1203/2662, 7-8=-1203/2662. 8.38=-486/383, 38-39=-486/383, 9.39=-486/383, 9-40=-1883/1051. 10-40=-188311051. 10-41 =- 1883/1051. 11-41— 1883/1051, 11-42=-1883(1051, 42.43= 1883/1051. 12-43=-1883/1051, 12-13=-2184/1139, 13.14=•2306/1168 BOT CHORD 2-26=-939/1826, 25.26=-939/1826, 25-44=-844/1737, 44-45=-844/1737, 24-45=-844/1737, 24-46= 284/287, 46.47_ 284/287, 23-47= 284/287, 22-23=-284/287, 22-48= 284/287, 48-49=-284/287, 21.49=-284/287, 21.50=-2138/1027, 50-51=-2138/1027, 51.52=-2138/1027, 20-52— 2138/1027, 19-20=-205/486, 19-53=-205/486, 53.54=-205/486, 18.54— 205/486, 18-55=-915/2025, 55-56=-915/2025, 17-56=-915/2025, 16-17=-996/2082, 14-16=-996/2082 WEBS 4-25=-121/552, 4-24=-419/200, 5.24= 529/460, 6-24=-888/1897, 6-22=0/308, 6-21— 2865/1409, 8.21=-2166/1235, 8-20=-1382/2989, 9-20— 1288/807, 9-18=-772/1630, 11-18=-532/461, 12.17=-1161553 PLATES GRIP MT20 244/190 MT20HS 187/143 Weight: 228lb FT =0% Structural wood sheathing directly applied or 3-7-11 oc puriins. Rigid telling directly applied or 3-10.0 oc bracing. 1 Row at mldpt 6.21 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7-10; VuIt=140mph (3-second gust) Vasd=108mph; TCDL=4.2pst; BCDL=5.Opst; h=15ft: Cat. II; Exp C; Encl.. GCpi=0.18: MW FRS (envelope) automatic zone; cantilever left and right exposed; end vertical left and right exposed; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) All plates are MT20 plates unless otherwise Indicated. 5) This truss has been designed for a 10.0 psi bottom chord live load nonconcurrent with any other live loads. 6) ' This truss has been designed for a live load of 20.0psi on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0.0 wide will fit between the bottom chord and any other members. 7) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 100 lb uplift at joint(s) except Qt=lb) 2=542, 21=1877, 14=608. 8) -Semi-rigid pitchbreaks including heels' Member end fixity model was used In the analysis and design of this truss. Continued on oaae 2 Q WARNING - Verffy design parameters and READ NOTES ON THIS AND INCLUDED MTEK REFERANCE PAGE Mg-7473 rov. I&W,2015 BEFORE USE. Design valid lot use only wpm Mllok0 connectors. lhh design a based ordy upon parameters shown. andis tot an trWMdial building component. not a truss system. Below use. the txDalng deslonor roust velty the oWicaUlty of dosdgn parameters and pxoperly lncogxxato IhB design Into the overall txAalng design. Crating Indicated Is to buckling of Individual truss web and/or, chord members only. Additional lernporary and permanent bracing WOW rx0ventIs always teoluked for stability and to prevenl collcrAe with possible personal YVuay and properly damage. For goneta guidance tegaalng the labricallon, storage, delivery, etecllon and lacing of misses and teas system; soeANSI/lP1I Quality Criteria, OSS-89 and SCSI Building Component 6904 Parke East Blvd. Safety Information available from truss Rate Institute. 218 N. lee Skeet. Suite 312. Alexandria. VA 22314. Tampa, FL 33610 Job I puss ruse I ype oty Ply, T11362882 1111656 A01 Hip Girder 1 1 Job Reference (optional) Burtdefs R(St Source, Gtovelend, FL 34735 r wv a npr r a zv i o mn ei, mavamea, irG. as sun i 4 i 4 Q4 ye c ID,4xrZSyOSpnperCOHML 1 Og 1 iP836-3hCJtiaVx4RUvW rrJKgpwiDwBMxi5hvd2bl t25z6MW 5 NOTES 9) Hanger(s) or other connection device(s) shall be provided sufficient to support concentrated load(s) 173 lb down and 214 lb up at 7.0-0, 87 lb down and 122 lb up at 9-0-12, 87 Ib down and 122 Ib up at 11-0.12, 871b down and 122 Ib up at 13-0-12, 87 Ib down and 122 Ib up at 15.0.12. 87 lb down and 122 lb up at 17-0-12, 87 Ib down and 122 Ib up at 19-0-12, 87 lb down and 122 lb up at 21-0.12, 87 lb down and 110 lb up at 22.4-0, 87 lb down and 122 lb up at 23-7-4, 87 lb down and 122 lb up at 25-74. 87 lb down and 122 lb up at 27.7-4, 87 lb down and 122 lb up at 29-7-4, 87 lb down and 122 lb up at 31.7-4, 87 lb down and 122 lb up at 33-7.4, and 87 lb down and 122 lb up at 35-7-4. and 173 Ib down and 214 Ib up at 37-8.0 on top chord, and 309 lbdown and 142 lb up at 7-0.0, 65 lb down at 9.0.12, 65 Ib down at 11.0-12, 65 Ib down at 13-0-12, 65 lb down at 15- 0-12, 65 lb down at 17.0.12, 65 lb down at 19.0.12, 65 lb down at 21.0-12, 65 lb down at 22.4-0, 65 Ib down at 23.7-4, 65 Ib down at 25-7-4, 651b down at 27.7-4, 65 Ib down at 29-7.4, 65 lb down at 31-7-4, 651b down at 33-7-4, and 65 Ib down at 35-7.4, and 309 Ib down and 142 Ib up at 37-7-4 on bottom chord. The design/selection of such connection device(s) is the responsibility of others. 10) In the LOAD CASE(S) section, loads applied to the face of the truss are noted as front (F) or back (8). LOAD CASE(S) Standard 1) Dead + Roof Live (balanced): Lumber Increase=l 25, Plate Increase=1.25 Uniform Loads (pit) Vert: 1-4— 54, 4-12=-54, 12.15=-54, 27-30=-20 Concentrated Loads (lb) Vert: 4-126(8) 7=-87(8) 12=-126(B) 25=-309(8) 6-87(8) 22-41(8) 8=-87(B) 20=-41(8) 9=-87(B) 17=-309(8) 33-87(B) 34= 87(B) 35=-87(B) 36=-87(B) 37=-87(B) 38=- 87(B) 39=-87(B) 40=-87(8) 41=-87(B) 42=-87(B) 43-87(B) 44= 41(B) 45= 41(8) 46=41(B) 47=-41(B) 48=-41(B) 49=-41(B) 50=-41(B) 51= 41(B) 52=-41(S) 53= 41(B) 54=41(B) 55=41(B) 56= 41(B) Q WARNING - Verily deslyn penmeten and READ NOTES ON THIS AND INCLUDED MI/EK REFERANCE PAGE Mf -7473 rev. 1OM3201S BEFORE USE Design valid la use only Win Wlek® Cdnreclots. hilts design Is taxed only upon prameters shown. and Is (of an Individual building component. 1101 a truss system. Before use. the txdk&Q designer must verily It* al3IAlcab0lty of design parameters and Ixoperly Incorporate M design Into the overall design. Bracing Indicated Is to I=Iding of Individual Inns web and/or chord members only. Additional temporary and permanent txoclng MiTek' buildingrxevenlIs always tequlrod tot staAlly and to pxevenl collapse with possible personal troey and properly dawnage. For gereral guidance regarding the 6904 Parke East Blvd fabricatkxL storage, delivery, erection and rxaclng of Irtmes and inns syslems seeANSI/TPI I Quality Criteria, OSS-89 and SCSI Wilding Component Tampa. FL 33610 Safety InformationavailablefromtrussPlateInstitute. 218 N. Lee Street, Suite 312, Alexandria. VA 22314 Job uss Truss Type ty Ply Ttt382883 1111658 1,.'0'2 Hip 1 1 Job Reference Zonal ouuwer s nrst source. toovemna, rL.. saran r" s npr iv evromues muusums, mc. woo nun- 14:a3:VZev1t rove 10:4x1ZSyO5prtperCOHML 1 Og 1 zP836•urZazlfGXwOedRl?gbnD9zT3Nn57VSmW RXUCGIz6MW? 1- 4.9.14 9-0-0 15-8-14 22.4-0 28.11.2 35 e-0 39-10.2 44 8-0 8 0 4-9 14 4-2.2 6.8-14 6-7.2 8.14 4.2.2 4•&14 -0 Scale = 1:81.6 UsSx8 = 2x4 11 Sx8 = Sx8 = 5.00 12 6x8 = 4 5 6 7 a 9 19 18 17 16 15 14 13 1.Sx8 STP= Sx8 010 MT20HS = Sx8 2x4 11 US 1.Sx8 STP= 4x6 = 2x4 II 4x10 MT20HS = 4x6 = LOADING (psi) TCLL 20.0 TCDL 7.0 BCLL 0.0 ' SCOL 10.0 SPACING- 2-0-0 Plate Grip DOL 1.25 Lumber DOL 1.25 Rep Stress Incr YES Code FBC2014/fP12007 CSI. TC 0.36 BC 0.29 WB 0.53 Matrix-M) DEFL. In Vert(LL) 0.46 Vert(fL) -0.82 HOrz(fL) 0.18 loc) Udell Ud 16 >999 240 16 >653 180 11 We rVa PLATES GRIP MT20 244/190 MT20HS 187/143 Weight: 278 lb FT = 0% LUMBER- BRACING - TOP CHORD 20 SP No.2 'Except' TOP CHORD Structural wood sheathing directly applied or 2-8-15 oc puffins. 4-7,7.9. 2x6 SP M 26 BOT CHORD Rigid ceiling directly applied or 7-0-13 oc bracing. BOT CHORD 2x6 SP M 26 WEBS 1 Row at midpt 5.19. 8.13 WEBS 20 SP No.3 REACTIONS. (lb/size) 2=1707/0.8.0, 11=1707/0.8.0 Max Horz 2=96(LC 14) Max Upl1112=-71 I (LC 6), 11=-711(LC 7) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2-3=-3846/1649, 3-4=-3564/1532, 4.5=-3295/1459, 5-6=-5117/2355, 6.7=-5117/2355, 7.8=-5117/2355, 8-9=-3295/1459, 9-10=-3564/1531, 10.11=-3846/1649 BOT CHORD 2.19=-1475/3532, 18.19=-2019/4673, 17.18_ 2019/4673, 16-17=-2019/4673, 15-16=-2008/4673, 14-15=-2008/4673, 13-14=-2008/4673, 11-13=-1446/3532 WEBS 3-19=-307/300, 4.19=-393/1099, 5-19— 1659/817, 5-16=-364/576, 6.16=-342/286, 8-16=-365/576, 8-13=-1659/817, 9-13=-393/1099, 10-13=-307/300 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7-10, Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=5.Opsf: h=15tt; Cat. 11; Exp C; Encl., GCpl=0.18; MW FRS (envelope) automatic zone and C-C Interior(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces & MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) All plates are MT20 plates unless otherwise Indicated. 5) This truss has been designed for a 10.0 psf bottom chord live load nonconcunent with any other live loads. 6) ' This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2.0.0 wide will fit between the bottom chord and any other members. 7) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 711 lb uplift at joint 2 and 711 lb uplift at joint 11. 8) 'Semi -rigid pitchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. 0 WARNING . Vatly doatyn Pamnietaa and REAO NOTES ON THIS ANO NfCLUOEO MITEK REFERANCE PAGE M07473 rov. tatIMIS BEFORE USE Design valkl for use only wpm Mllek® connectors. this design is based only upon paramelers shown, and Is tot an Individual building component. nlol o Russ system. Below wo. the building designer must vedfy the ap>{xkabllly of design pauatnotets and popery Incorporate this design Into the overall building design. ®acing Indicated is to pevenl b ucidIng of IntdMlduDi Inns web and/ot chard members only. Addillonm temporary and petmanenl Ixacing M iTek' is always feyufted tot stability and to peevent collapse with possible petsonal Injury and pop erly damage. For general guidance regarding the fabrication. storaoo, delivery. erection and txocktg of tnussos and Ittuss systems. seeANSI/TP1I Quality Criteria, 038.89 and SCSI Building Component 6204 Parke East Blvd Safety information ovalloble from Truss Rate Institute. 218 N. toe Street. Sulle 312, Alexardda. VA 22314. Tampa. FL 33610 Jobpuss Truss Type Qfy pry Tt1362B84 1 t 11656 A03 Hip t 1 Job Reference(optional) vuuver rasp ovurce. a»avawnv, rc .a.oo 5.0011 3x4 i 3 1 12 o 19 1.5xe STP= 2x4 II 4x6 = 7-7-4 5r® = 20 11 4 5 18 17 16 4x6 = 5x8 = 5x8 = 1D:4taZSyOSpnperCOHMl1 Og 1 zP836-M 17yA5guHEJVEbtB011SiA06vBRKErt4iEloBz6MW _ 6-0.12 33 8-0 38 10 2 44.8-0 46 8 7.5-8 7.7 4 5.2.2 5-9-14 -0 Scale = 1:81.6 3x6 = Us = 5x6 = 246 7 8 30 9 v 10 yy_ J 11 t8 15 14 13 12 2x4 II Sx8 = 5x8 = 2x4 II 1 Us STP= 06 = 338-0 3&10.2 44 7.7-4 { 5.2.2 5.8 14 LOADING (psf) SPACING- 2.0.0 CST. DEFL. in (loc) Well Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.88 Vert(LL) 0.41 15-16 999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.29 Vert(TL) 0.77 15-16 697 180 BCLL 0.0 ' Rep Stress Incr YES WS 0.79 Horz(TL) 0.15 10 n/a rVa BCDL 10.0 Code FBC2014/rP12007 Matrix-M) Weight: 261 lb FT = 0% LUMBER- BRACING - TOP CHORD 2x4 SP No.2 'Except' TOP CHORD Structural wood sheathing directly applied. 4-6: 20 SP M 31. 6-8: 2x4 SP No.1 BOT CHORD Rigid ceiling directly applied or 7-10.0 oc bracing. BOT CHORD 2x6 SP M 26 WEBS 1 Row at nlidpt 7.16. 7.13 WEBS 2x4 SP Nd.3 REACTIONS. (Ib/size) 2=1707/0-8-0, 10=1707/0-8-0 Max Horz 2=- 1 18(LC 15) Max Uplifts=-704(1-C 10). 10=-704(LC 11) FORCES. (Ib) - Max. Comp./Max. Ten - All forces 250 (lb) or less except when shown. TOP CHORD 2-3=-3847/1524, 3-4= 3354/1418, 4.5= 4000/1807, 5-24=-4000/1807, 6.24=-4000/1807, 6.7=40d0/1807, 7-8=-3067/1349, 8-9=-3345/1413, 9.10= 3861/1524 BOT CHORD 2-19=-1426/3521. 18.19=-1426/3521, 17.1e= 1168/3056, 16-17=-1168/3056, 15-16=-j631/4013, 14-15=-1631/4013. 13-14=-1631/4013, 12-13=-1315/3523, 10.12- 1315/3523 WEBS 3-18=-524/343, 4.18=-89/443, 4-16=-557/1212, 5-16=-431/365, 7-16=-244/253, 7-15=0/ 5, 7-13= 1217/564, 8.13=-306/947, 9-13=-535/349 NOTES 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7-10; VUII=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=5.Opsf; h=1511; Cat. II; Exp C; Encl.. GCpi=0.18: MW FRS (envelope) automatic zone and C-C Intedor(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and tortes 8 MWFRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 5) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6.0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 6) Provide mechanical co neclion (by others) of truss to bearing plate capable of withstanding 704 lb uplift at joint 2 and 704 lb uplift at joint 10. 7) 'Semi -rigid pitchbreak , including heels' Member end fixity model was used in the analysis and design of this truss. Q WARNING . Vadfy dosrgI poremefere and READ NOTES ON THIS AND iNGLUDED MrrEK REFERANCE PAGE M11.7473 rev. I&W/2015 BEFORE USE. Design Valk) la use only wllh tA110M connectors. Mdesign 8 based only upon parametets shown, and Is la an Indh4d al buildinging component. not a buss system Before use, building design. Bracing hi tho txdldhng designer must verity It* applicalAlly of design parameters and ploporly trlcorporale this design Into the ovorall Glad Is to prevent bucahng of Individual truss web andl/a chord memhets only. AdditionalTemporary and permanent bracing M iTek' is always required la sk"Ity fabrlcalkxn. storage• dellv4ry, ad to prevent collapse wtlh possible personal "and property danage. Fa general guidance regarding the erection and brachng of Iru uses ads fnra sysfenns seeANSI/IPI f Quality Criteria. DSB-119 and BCSI Bued rig Component 6904 Parke East Blvd. Safety Information avail o horn Truss Rate Institute, 218 N. tee Street. Suite 312. Alexandria, VA 22314. Tanga, FL 33610 I Job I russ russ ype ty Ply T11362685 1111656 A04jI Hip 2 11 Job Reference (optional) 3x8 = 13.0-0 19.3-4 6.2.2 6 3.4 5x8 = 20 II 12 4 5 30 3 19 to 77 16 2x4 II 3x4 = 3x8 MT20HS = 3x8 = ID:4xi2SyO5pnperCOHML 1 Og 1 zP836-gDhLORgW 2XRMsISNrl0phE0YHKadCzNspurzlJez6MVz 31-0-0 37.10-2 44 8 0 6.3.4 6-2.2 6.9.14 1 Scale = 1:81.6 3x8 = 3x6 = Sx6 = 26 6 7 a j3X4 m 1.54 STP = 10 11 15 14 13 12 20 II 3x8MT20HS=3x8= 20 II 3x8 Plate Offsets (X,Y)-- 12.0-4-2 0.1.81 (4:0.5-12 0-2-81 (8:0-3-0 0-2-41 (10:0.4-2.0-1-81 LOADING (psf) SPACING- 2.0-0 CSI. DEFL. in (loc) Well Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.84 V@ri(LL) 0.43 15-16 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.96 Veri(TL) -0.86 15-16 >625 180 MT20HS 187/143 BCLL 0.0 ' Rep Stress Incr YES WB 0.49 Horz(fL) 0.27 10 n/a rVa BCDL 10.0 Code FBC2014/TPI2007 Matrix-M) Weight: 233 lb FT = 0% LUMBER- BRACING - TOP CHORD 20 SP No.2 TOP CHORD Structural wood sheathing directly applied. BOT CHORD 20 SP N8.2 BOT CHORD Rigid ceiling directly applied or 2-2-0 oc bracing. WEBS 20 SP N8 3 WEBS 1 Row at midpt 6-13 REACTIONS. (Ib/size) 2=1707/0.8.0, 10=1707/0-8-0 Max Horz 2= 1 37(LC 14) Max Uplift2=-704(LC 10), 10— 704(LC 11) FORCES. (lb) - Max. Col pJMax. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2.3=-3543/1375, 3.4= 3025/1241, 4.5=-3271/1446, 5-26=-3271/1446, 6-26=-3271/1446, 6.7=.2751/1191, 7-8— 2751/1191, 8-9— 3025/1241, 9.10= 3542/1378 BOT CHORD 2-19=-1294/3206, 18-19=-1294/3206, 17-18=-978/2739, 16-17=-978/2739, 15-16=-11233/3271, 14-15=-1233/3271, 13.14= 1233/3271, 12-13=-1159/3205, 10.12=-11159/3205 WEBS 3-18=-531/360, 4-18=-93/417, 4.16=-367/828, 5-16=-355/297, 6-13=-817/364, 8-13= 255/823, 9.13=-531/362 NOTES- 1) Unbalanced roof live k 2) Wind: ASCE 7-10; Vul MW FRS (envelope) at for members and force 3) Provide adequate dram 4) All plates are MT20 pli 5) This truss has been de 6) - This truss has been t fit between the bottom 7) Provide mechanical ct joint 10. 8)'Semi-rigid pitchbreak ids have been considered for this design. 140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=S.Opsf; h=15ft: Cat. II; Exp C; Encl., GCpi=0.18: omatic zone and C-C Interior(1) zone: cantilever left and right exposed; end vertical left and right exposed;C-C MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1 60 age to prevent water ponding. as unless otherwise Indicated. Igned for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. asigned for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6.0 tall by 2-0-0 wide will hord and any other members. inection (by others) of truss to bearing plate capable of withstanding 704 lb uplift at Joint 2 and 704 lb uplift at Including heels' Member end fixity model was used in the analysis and design of this truss. Q WARNING - Vedry de4/pri penmetere and READ NOTES ON THIS AND INCLUDED MREK REFERANCE PAGE MO.7473 rev. 1411113,2015 BEFORE USE. Design valid for use only wQm Wlek® correctors. inls deslgn 6 based only upon parameters shown. and h lot an Ind11Adltol building component, not a truss syslem. Before the. the building designer must verity the cg4XIcaMlly of design pcaarnetem and propony Incogetote this design Into the overall txdding design. Brocing OdIcaled is to buCid ng of Individual Iris web anWa chord members only. Additional temporary and petmanenl tracing MiTek' prevent Is always t4w4 lred too skt4lly and to prevent colkpsa with Possible Personal k*.ffy and ptoPody damage. For general gukknce tegaiding the 6904 Parke East Blvd. labricallon, storage, deltv4ty. erection and bracing or Intsses and In= systems. soeANSI/rPI I Gualty, Cdtedo. OSB-89 and SCSI Building Component Tanpa. FL 33610SafetyIMatmatlonavallatAofromtrussRateInslltule. 218 N. Leo Street. Suite 312. Alexandria VA 22314. Job I russ russ I ype ry T11362886 1111656 A05 Wp 2 1 Job Reference Zonal Buddsfs First Source, Grweland, FL 34736 7.640 s Apr 19 2016 MTek Industries, Inc Wed Jun 14 13 53 05 2017 Page 1 ID:4xiZSyO5pnperCOHML 1 Og 1 zP836-JOEibnh6prZCUu 1 aLjKwnb5RA_z_tly7Vlsr4z6MVy 1-0 7.9.14 15-0.0 22.4.0 29-&0 35-10.2 44-a-0 •S-0 7.9.14 7.2.2 7.4-0 7.4-0 7.2-2 7.9.14 0-0 5.00 f 12 Sx8 = 2x4 11 Us = 19 ra 17 io eo 15 ° r 14 12 3x8 = 2x4 II 3x8 MT20HS = 3x4 = 3x8 MT20HS = 3x8 = 30 = US MT20HS = 2x4 11 3x8 = Scale = 1:83.2 LOADING (psf) SPACING- 2.0-0 CSI. DEFL. in loc) I/dell Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.90 Vert(LL) 0.36 15 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.92 Vert(TL) -0.75 14-15 >718 180 MT20HS 187/143 BCLL 0.0 ' Rep Stress Incr YES WB 0.82 Horz(TL) 0.26 10 rVa IVA BCDL 10.0 Code FBC2014/TPI2007 Matrix-M) Weight: 226 lb FT = 0% LUMBER- BRACING - TOP CHORD 2x4 SP No.2 'Except' TOP CHORD Structural wood sheathing directly applied. 4-5,7-8: 2x4 SP No 1 BOT CHORD Rigid ceiling directly applied or 2-2-0 oc bracing. BOT CHORD 2x4 SP No 2 WEBS 20 SP No.3 REACTIONS. (lb(size) 2=1707/0-8-0, 10=1707/0.8-0 Max Horz2=157(LC 10) Max Upllft2=-702(LC 10), 10=-702(LC 11) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2.3=-3506/1343, 3-4=-2861/1099, 4-5=-2782/1121, 5.6=-2910/1247, 6-7=-2910/1247, 7.8=-2782/1121, 8-9=-2861/1100, 9.10=-3506/1345 BOT CHORD 2-19=-1272/3166,18.19=-1272/3166,17.18=-1272/3166,16.17=-880/2576, 16-26=-880/2576, 15-26=-880/2576, 15-27=-821/2576, 14.27=-821/2576, 13.14=-1117/3166, 12-13=-1117/3166, 10-12=-1117/3166 WEBS 3-19=0/275, 3-17=-665/433, 5-17=-109/492. 5-15=-309/601, 6-15=-448/380, 7-15=-309/601, 7.14— 109/492, 9-14_ 665/435, 9-12=0/275 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7.10; Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf, BCDL=5.Opsf; h=15ft; Cat. 11; Exp C; Encl., GCpi=0.18; MW FRS (envelope) automatic zone and C-C Intedor(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces & MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) All plates are MT20 plates unless otherwise Indicated. 5) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent With any other live loads. 6) ' This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6.0 tall by 2-0-0 wide will fit between the bottom chord and any other members, With BCDL = 10.Opsf. 7) Provide mechanical connection (by others) o1 truss to bearing plate capable of Withstanding 702 lb uplift at joint 2 and 702 lb uplift at joint 10. 8)'Semi-rigid pitchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. 0 WARNING • Vedly daafgn patemeters and READ NOTES ON THIS AND INCLUDED MITEK REFERANCE PAGE MIF7473 rev. 1@D31201S BEFORE USE. Design valid roe use only wlm Milek® connectors TW design Is based only upon uaramelers shown. and Is for an Wivid pal bolding component. not a truss syslem. Bolero use. the txddhg designer must verity the appllccdAlly of design potarnefers and Ixorotly Incogweafe this design Into the overall design. Bracing Indicated is to txaatrng of Individual truss web and/ot chord rnembets only. Additional temporary and permanent tracing M iTek' txBdIng ixevent Is always recphed for slablllly and to prevent collapse w11h pos*Ae petsonal"and Ixopedy damage. Fa general g11cknce tegardkng the k"Icallm storage. delivery. erection and braclrng of Inures and Inrss systems swANSI/IPI I Quality Criteria, OSS-89 and SCSI Building Component 6904 Parke East Blvd. Safety information avdable from Russ Plate institute. 218 N. Lee Street. Sidle 312. Atexarndda. VA 22314. Tampa, FL 33610 Job I russ ruse I ype ty Ply T11362867 1111656 A06 Hip 2 11 Job Reference (optional) Builder's First Source. GrovNend. FL. 34736 7 640 s Apr 19 2016 MTek Industries. Inc. Wed Jun 14 13 53 06 2017 Page 1 I D:4xi2SyO5prperCOHML 1 Og 1 zP836-nco5p7rma9h362cmvRr9KpeiyOlZRFz5LOSPOW z6MVx 61.3 116.10 17.0-0 22.4-0 27.8-0 33-16 386-13 4422 45.8.0 6 1.3 5-S 6 5.5.8 5 4-0 5 4-0 5 56 5 54i 6 1.3 1 -0-0 5.00 FI2 Sx6 = 3x8 = Sx6 = zu 1a to ar 17 Co 16 10 14 3x4 = 3K8 = US MT20HS = 3x6 = 2K4 II 3x8 = 3x4 = 3x8 MT20HS = 3x8 = Scale = 1:83.2 LOADING (psf) SPACING- 2.0-0 CSI. DEFL. In loc) I/defl L/d PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.51 Vert(LL) 0.33 17 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.96 Vert(TL) -0.77 14-16 >697 160 MT20HS 187/143 BCLL 0.0 ' Rep Stress Incr YES W B 0.64 Horz(TL) 0.25 12 n/a Na BCDL 10.0 Code FBC2014/TP12007 Matrix-M) Weight: 244 lb FT = 04S LUMBER- BRACING - TOP CHORD 2x4 SP No.2 TOP CHORD Structural wood sheathing directly applied or 2.8.8 oc pur ins. BOT CHORD 2x4 SP No.2 BOT CHORD Rigid ceiling directly applied or 2-2-0 oc bracing. WEBS 2x4 SP No.3 WEBS 1 Row at midpt 7.18, 7-16 REACTIONS. (lb/size) 2=1707/0-8-0, 12=1707/0.8.0 Max Horz 2=-176(LC 11) MaxUplift2=-698(LC 10), 12=-698(LC 11) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown TOP CHORD 2.3=-3557/1416, 3.4=-3334/1296, 4-5=-3282/1308, 5.6= 2656/1047, 6-7=-2409/1017, 7-8=-2409/1017, 8-9=-2658/1047, 9.10=-3282/1309, 10-11=-3334/1297, 11.12=-3557/1418 BOT CHORD 2-20=-1376/3223,19-20=-1104/2846.18-19=-1104/2848,16-27=-784/2548, 17-27=-784/2548. 17-28=-784/2548, 16.28=-784/2548, 15-16= 929/2848, 14.15=-929/2848,12.14=•1204/3223 WEBS 3.20=-265/290, 5-20=-115/422, 5-18=-605/423, 6.18=-241/741, 7-18=-403/240, 7-16=-403/239,8-16=-240/741,9.16=•605/423,9-14=-116/422,11-14- 265/291 NOTES- 1) Unbalanced root live loads have been considered for this design. 2) Wind: ASCE 7-10; Vu11=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=5.Opsf; h=15ft; Cat. 11; Exp C; Encl., GCpi=0.18; MW FRS (envelope) automatic zone and C-C Interlor(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces 6 MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) All plates are MT20 plates unless otherwise indicated. 5) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 6) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0.0 Wide Will fit between the bottom chord and any other members, With BCDL = 10.Opsf. 7) Provide mechanical connection (by others) of truss to bearing plate capable of Withstanding 698 lb uplift at joint 2 and 698 lb uplift at joint 12. 8) `Semi -rigid pitchbreaks including heels' Member end lixily model was used in the analysis and design of this truss A WARNING . Vedly design paremoters and READ NOTES ON THIS AND INCLUDED MR'EK REFERANCE PAGE Mg-7473 mv. MIXI 0r6 BEFORE USE Design valid for the ordy wilh MI lek®ConneClerS. lids design Is based only upon parameters shown, and k la an Individ Kl bxRding component. not a trim syslern. Before use. the building designer must verity the oppticablity of design Ixxamelets and Ixopeny IhoaKpotote this design Into the overall rxifding design. Brachg Indicated Is to lAevent bscakng of IrWlvldual Inm web and/or chord members only. Additional temporary and permanent Mating MOW 6 always regAed la sklblity cmd to rxevens coliapse wtlh possmW perwral rN/y arvJ rxopertydarnoge Foi genetal gthJmce regarding the kixk: atkxL storage, delivery, erection and Lxcr&V of Misses and miss systems seeANSI/IPII Quality Cdterh, OSS-89 arrd SCSI Building Component 6904 Parke East Blvd. Salety Information avaliable horn truss Rate institute. 218 N. too Street. Stile 312. Aloleandda. VA 22314. Tampa, FL 33610 Job russ Truss Type tY T11362868 1111656 A07I Hip 2 1 Job Reference(optional) o.. Budder'e final Source. Groveland. FL. 34736 i.o»v. Ape ,. 20,6,.,,,.,, ,,,..,..-3 •.........U.. ... --.. . w . ID:4x12SyO5pnperCOHML1Og1zP836-foMTOTjPLSp iCAyS8NOsOAogofDAfrfaoCzwyz6MVw 1 6- 3 12.10.10 19-0-0 2".0 31.9$ 37.10.13 44-0.0 45-8.0 0 0 8-a3 6.1.8 6_ 1.6 ".0 6 1 6.1 .66-9-3 -0-0 Scale = 1:83.2 5x8 = Sx6 = 5.00 12 6 27 7 20 19 10 17 16 14 13 3x8 = 2x4 11 3x4 = 3x6 MT20HS = 3x4 = 3x8 = 3x8 MT20HS = 3x4 = 2x4 11 3x8 LOADING (psf) SPACING- 2.0-0 CSI. DEFL. In loc) I/defl Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.83 Ven(LL) 0.32 17 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.94 Vert(rL) -0.70 16-17 >767 180 MT20HS 187/143 BCLL 0.0 ' Rep Stress Incr YES WB 0.43 Horz(TL) 0.26 11 n/a n/a BCDL 10.0 Code FBC2014/rP12007 Matrix-M) Weight: 244 lb FT = 0% LUMBER- BRACING - TOP CHORD 20 SP No.2 TOP CHORD Structural wood sheathing directly applied or 2.2-0 oc puriins. BOT CHORD 20 SP No.2 BOT CHORD Rigid ceiling directly applied or 2.2-0 oc bracing. WEBS 2x4 SP No.3 WEBS 1 Row at midpi 5.17, 6-16, 8.16 REACTIONS. (lb/size) 2=1707/0.8.0, 11=1707/0-8-0 Max Horz 2= 1 96(LC 14) Max Uplift2=-695(LC 10), 11=-695(LC 11) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2.3=-3542/1345, 3.4- 3057/1159, 4.5=•2998/1176, 5.6=-2476/963, 6-27=-2233/945, 7-27=-2233/945, 7-8=-2477/964, 8-9=-2998/1178, 9.10=-3056/1160, 10-11=-3543/1349 BOT CHORD 2-20=-1323/3204, 19-20- 1323/3204, 18-19=-1033/2767, 17.18=-1033/2767, 17-28=-693/2232, 16.28=-693/2232, 15-16=-839/2767, 14.15=-839/2767, 13-14- 1131/3205, 11-13=-1131/3205 WEBS 3.19=-498/320, 5-19=-77/405, 5-17=-722/455, 6-17=-233/609, 7.16=-181/596, 8-16=-721/456, 8.14=•78/405, 10.14=•499/323 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7-10; Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL^S.Opsf; h=15ft; Cat. II; Exp C; Encl., GCpi=0.18; MW FRS (envelope) automatic zone and C-C Interior(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces 8 MWFRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) All plates are MT20 plates unless otherwise Indicated. 5) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 6) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in ail areas where a rectangle 3.6-0 tall by 2.0.0 wide will fit between the bottom chord and any other members, with BCDL = I0.Opsl. 7) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 695 lb uplift at joint 2 and 695 lb uplift at joint 11. 8) 'Semi -rigid pitchbreaks Including heels' Member end fixity model was used in the analysis and design of this truss. WARNING - Verify design parameters and READ NOTES ON THIS AND INCLUDED MffEK REFERANCE PAGE NO.7473 rev. 14&A]/2015 BEFORE USE Design v„d for use orgy vA01 MlleW connectors. R* design is Lined orgy upon parameters mown, and Is for an IndtvkAt, LxAdtrlg component, rat a truss system. Sofao use. Its IxLding designer must verify the aIVIcdll,ly of design rxpamolois and properlyly Irlcorpa0to IM design Into the over,, only. Additional temporary and permo ent txactrlg M iTek' txAdlrlg design. Rrocing indicated Is to Ixevant lxsckling of Individual truss web and/or chord memt"s is always reyrhed for statAlty and to rxevenl collapse vAlh ross£Ae personal InWy and poperfy damage. For gererd guidance wgadN the labricatkxx storage• delivery• eteclkxl aril txoctng of Intssas and truss systems, soeANSI/rPI I Quality Criteria, DSO-69 and SCSI Su9ding Component 6904 Perks East 81wd. Safety Information ava9aAo from trig Rate Institute. 218 N. Lee Street. Suite 312. Alexandria, VA 22314. Ton pa. FL 33610 Job fuss russ ype ry Ply T11362689 1111656 A09 Hip 2 t1 Job Reference (optional) Buddets First Source. Groveland. FL 34736 - 7 540 s Apr 19 2016 rok 1 ek industries. tor:. wed dun 14 13 53 ve 2017 rape I ID:4xi2SyO5pnperCOHML 1 Og 1 zP836-I?wrEpj 16mxnLM190sudPEj 1cCJv9uOpsxwSPz6MVv 1-0• 7.5.3 14.2.10 21-0-0 23.8-0 305.6 37.2.13 W'o 8 0 7.5.3 6.9-6 6.9.6 2 8 0 &9 8 6•ti 6 7.5.3 -0 g Scale - 1:83.2 5x8 = Sx6 = 6 27 7 20 19 luzu 17 16 ro 1D 14 13 _ 3x8 = 20 II 3x8 MT20HS = 30 = 3x8 = 3x4 = 20 11 3x8 LOADING (psf) SPACING- 2-0-0 TCLL 20.0 Plate Grip DOL 1.25 TCDL 7.0 Lumber DOL 1.25 BCLL 0.0 ' Rep Stress Incr YES BCDL 10.0 Code FBC2014/TPI2007 LUMBER - TOP CHORD 20 SP No.2 BOT CHORD 20 SP No.2 WEBS 2x4 SP No.3 REACTIONS. (lb/size) 2=1707/0-8.0, 11=1707/0.8.0 Max Harz2=215(LC 14) Max Upli112=-692(LC 10), 11=-692(LC 11) 30 = 3x8 MT20HS = CSI. OEFL. in (loc) Well Ud PLATES GRIP TC 0.63 Vert(LL) 0.3317-19 >999 240 MT20 244/190 BC 0.92 Vert(rL) 0.7317-19 >737 180 MT20HS 187/143 WB 0.61 HOfz(TL) 0.26 11 We rVa Matrix-M) Weight: 253 lb FT = 0% BRACING - TOP CHORD Structural wood sheathing directly applied or 2-6-B oc puffins. BOT CHORD Rigid ceiling directly applied or 2-2-0 oc bracing. WEBS 1 Row atnlidpt 5-17.6-16, 8.16 FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2.3=-3513/1318, 3.4=-2951/1106, 4-5=-2824/1120, 5.6=•2292/887, 6-27=-2053/874, 7-27=-2053/874, 7.8=-2294/888, 8-9=-2823/1121, 9.10=-2950/1107, 10-11=-3514/1321 BOT CHORD 2-20=-1310/3172, 19-20=-1310/3172, 18-19=-978/2664, 18-28=-978/2664, 17.28— 978/2664, 16-17=-596/2050, 16-29=-763/2663, 15-29=-763/2663, 14-15=-763/2663, 13-14=-1098/3173, 11-13=-1098/3173 WEBS 3-19=-576/365, 5-19— 85/466, 5-17=-824/510, 6.17= 284/617, 7-16= 242/620, 8-16=-821/510, 8.14=-85/464, 10-14=-577/368, 10-13=0/250 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7-10; VUIt=140mph (3-second gust) Vasd=108mph; TCDL=4.2pst; BCDL=5.Opsf; h=15ft: Cat. II; Exp C; Encl., GCp1=0.le; MW FRS (envelope) automatic zone and C-C Interior(1) zone; cantilever left and right exposed : end vertical left and right exposed;C-C for members and forces & MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) All plates are MT20 plates unless otherwise indicated. 5) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 6) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members, with BCDL = 10.Opsf. 7) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 692 lb uplift at joint 2 and 692 lb uplift at joint 11. 8)'Semi-rigid pitchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. WARNNG - Vel1y design panmofers and READ NOTES ON THIS AND WCLUOEO MIFEK REFERANCE PAOE AIIF7473 mv. 1=312015 BEFORE USE Design valid for use orgy Ndtin Wlek® connectors. Ilnis design Is based only upon parameters shown. and 1s for an Individual building component, nor a truss system. Boforo use. the bull ing designer roust verily the applicability of design parameters and pxopedy Incorixxote this design Into the over,,. b ulding design. Bracing I n icaled Is to buckling of Nxilvldual hues web and/or chord members only. Additional temporary and permanent tracing MOWprevent S always regaled fa stability and to prevent collapse Wirt possible persorxi Wray and poperty dcIrnage. For general guidance teg,rding the 6904 Parka East Blvd. fabricotbix storage, delivery, erection and Ixod ng or trusses and Miss systems, seeANSI/Mi I Quality Criteria, OSa-89 and SCSI Bulldfng Component Tampa, FL 33610SafetyInformationavalloblefromtrussRateInstitute, 218 N. Lee Sheet. Sullo 312. AtoxarvJda, VA 22314. Job russ russ Type tY ply Tt1362e90 11116S81 1:09 Comnnon 7 1 Job Reference (optional) Buldefs First Source, Groveland. FL 34736 r 640 s Apr re mho cur es meusrnes, i— Wev Jun i• i a ao ve cvi i 10:4xt2SyO5pntperC0HML 1 Og 1 zP836-BOUER9kft44ez W KLatPsxRGA8bK5earY26ft3_rz6MVu 0 7.10.9 15.1.4 22•4.0 29.6-12 36.9.7 44-6-0 4b 8 O 7.10.9 7.2.12 7.2.12 7.2.12 7.2.12 7.10.9 US = Sx6 = 5.00 F12 19 w 17 ie w 15 14 , v 12 20 11 3x8 MT20HS = 3x4 = US MT20HS = 3xe = 30 = 3x8 MT20HS= 2x4 II Scale = 1:80.1 3x8 = LOADING (psf) SPACING- 2.0.0 CSI. DEFL. In loc) Well Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25' TC 0.71 Vert(LL) 0.33 17 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.91 Vert(TL) -0.72 15-17 >744 180 MT20HS ' 187/143 BCLL 0.0 ' Rep Stress Incr YES WB 0.76 Horz(TL) 0.26 10 n/a rVa BCDL 10.0 Code FBC2014lrP12007 Matrix-M) Weight: 233 lb FT = 046 LUMBER- BRACING - TOP CHORD 2x4 SP No.2 TOP CHORD Structural wood sheathing directly applied or 2-2-0 oc purlins. BOT CHORD 20 SP No.2 BOT CHORD Rigid ceiling directly applied or 5-1.15 oc bracing. WEBS 20 SP No.3 WEBS 1 Row at midpt 7-15. 5-15 REACTIONS. (Ib/size) 2=1707/0.8-0, 10=1707/0.8.0 Max Horz 2=-228(LC 11) Max Uplift2=-689(LC 10), 10_ 689(LC 11) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2-3=-3492/1298, 3.4=-2874/1061, 4-5=-2803/1082, 5.6=-2189/861, 6-7=-2189/861, 7.8=-2803/1083, 8-9=-2874/1062, 9-10=-3492/1300 BOT CHORD 2.19=-1298/3150, 18.19=-1298/3150, 17-18=-1298/3150, 16-17=-940/2587, 16-26= 940/2587, 15-26— 940/2587, 15-27=-712/2587, 14-27=-712/2587, 13.14=•1073/3150, 12-13=-1073/3150, 10-12— 1073/3150 WEBS 6.15=-419/1267, 7-15=-865/542, 7.14=-95/484, 9-14=-632/397, 9-12=0/275, 5.15=-865/542, 5.17=-94/484, 3-17=-632/395, 3-19=0/275 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7-10; Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=5.Opsf: h=1511; Cat. II; Exp C; Encl., GCpI=0.18; MW FRS (envelope) automatic zone and C-C Interior(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces & MW FRS for reactions shown; Lumber DOL=1 60 plate grip DOL=1.60 3) All plates are MT20 plates unless otherwise indicated. 4) This truss has been designed for a 10.0 psi bottom chord live load nonconcurrent with any other live loads. 5) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members, with BCDL = I O.Opst. 6) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 689 lb uplift at joint 2 and 689 lb uplift at joint 10 7) 'Semi -rigid pitchbreaks Including heels' Member end fixity model was used in the analysis and design of this truss WARNING . Vedly dedyn Paraerarers and READ NOTES ON THIS AND INCLUDED MIIEK REFERANCE PAGE MIF7473 rev. IdQ' MIS BEFORE USE Design valid lot use only Win Mllek® connectors. Rls design Is based only upon parameters shown, and is for an Individual building component. not a truss system. Bofao use. the building designer roust verily the applk:a lily of design parameters and properly frncor"ate Bnk cioslgn Into the, overall building design. Bracing Indicated Is to revenl tucking of Individual puss web and/or chard members only. Adclillo nad tempowry and rMmanenl bracing MOW S always regl6ed for slcfiBlty crud to prevent collapse with possible personal Injury and property damage. for general guidance regarding the fabrication. storage, delivery, erection and bracing of tnrsses and Inrss systems. socANSI/M I Quality Cdledo, OSS-89 and SCSI Building Component 6904 Parke East Blvd safety INomwBon avalk"o from truss Rate InstlMe. 218 N. lee Street. Suite 312, Alexandriaa, VA 22314. Tempo, FL 33610 o fuss Truss Type ryPly T11362891 1111656 1:010 Root Special 1 1 Jab Reference (optional) Buddefs First Source, Groveand, FL. 34736 7,640 s Apr to zo16 rain ea maustnes, Mc. woo jun 14 13 bTb7 2u1I rage n I DAxr2SyO5pnperCOHML 1 Og 1 zP836-YUhv 2b7i02LWgOl t2B2Svm7RmOfg7NnHFmRaYz6MW 4 It- - 12. 'o 14.4-0 20.9.15 2 -2.1 33.6.0 38.1%2 44.8-0 4 •8 0-0 67.14 612 t$-0 65.15 6.4-3 65.1s 52.2 5.9-14 Sx8 II 5.00 12 6x8 = 2x4 II 5x8 = 5x8 = 6x8 = Scale - 1:84.6 20 19 1II17 16 lb 14 13 1. 5x8 STP= 4x6 = 5x8 = 5x8 = 2x4 11 5x8 = 2x4 11 1 Sxe STP = 4x6 = ex10 = 5x8 = 4x6 — 7. 614 14.4-0 20-9-15 27.2.1 33-0-0 38-10-2 44-8-0 7. 5.14 61a2 6•S•1s 6-4-3 6s•15 5.2.2 5-9.14 Plate Offsets (XY)-- f5:0.1-12.0-4-41. 19:0-4-0.0-2-21. 119:0-3-8.0-4-01 LOADING ( psf) SPACING- 2.0.0 CSI. DEFL. In (loc) I/deft Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.76 Vert(LL) 0.39 16-17 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.31 Vert(TL) -0.73 16-17 >735 180 BCLL 0.0 ' Rep Stress Incr YES W B 0.86 Horz(TL) 0.15 11 n/a n/a BCDL 10.0 Code FBC2014/fP12007 Matrix-M) Weight: 283 lb FT = 0% LUMBER - TOP CHORD 2x4 SP No.2 'Except' 5. 7,7.9: 2x6 SP M 26 BOT CHORD 2x6 SP M 26 WEBS 2x4 SP No.3 BRACING - TOP CHORD Structural wood sheathing directly applied or 2-2.0 oc pudins. BOT CHORD Rigid ceiling directly applied or 7-11.5 oc bracing. WEBS 1 Row atm(dpt 8.14 REACTIONS. ( lb(size) 2=1707/0-8-0.11=1707/0.8.0 Max Horz2=134(LC 10) Max Upllft2=-585(LC 7), 11=-791(LC 11) FORCES. ( lb) - Max. Comp./Max Ten - All forces 250 (lb) or less except when shown. TOP CHORD 2.3=•3798/1374, 3-4=-3708/1406, 4-5=-3894/1672, 5.6=-4154/1875, 6-7=-4151/1872, 7- 8=-4151/1872, 8-9=-3074/1481, 9.10=-3348/1542, 10-11=-3852/1750 BOT CHORD 2-20=-1161/3461, 19.20=-972/2876, 18-19=-1250/3548, 17-18=-1250/3548, 16- 17=-1593/3972, 15.16=-1593/3972, 14-15=-1593/3972, 13.14=-1517/3526, 11. 13— 1517/3526 WEBS 3-20=-325/332, 4-20=-383/703, 4-19_ 1017/2245, 5-19=-1973/1017, 5-17— 457/849, 6- 17_ 433/343, 8-16=0/252, 8-14=-1101/515, 9-14=-359/1001, 10-14— 536/344 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7.10; VU11=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=5.Opsf; h=1511; Cat. 11; Exp C, Encl., GCpi=0.18; MW FRS (envelope) automatic zone and C-C Interior(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces & MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) This truss has been designed for a 10 0 psf bottom chord live load nonconcurrent with any other live loads. 5) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3.6.0 tall by 2-0-0 wide will lit between the bottom chord and any other members. 6) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 100lb uplift at joint(s) except Qt=lb) 2=585, 11= 791. 7) ' Semi -rigid pitchbreaks including heels' Member end fixity model was used In the analysis and design o1 this truss. art WARNING . Verify dasfgn porantetara and READ NOTES ON THIS AND INCLUDEO MR'EK REFERANCE PAGE MO-7473 rev. f4 tWI5 BEFORE USE Design va,kl lot use only w,m W Iek® connectors. nYs Uesign b based only upon paamelers shown. and b lot an ItntlMdtrd buldng component. not a buss system. before uso, the t"di ng designer must verity the oppllcalAlly of design parameters axl properly hlcorpotute this doslgn Into the over,, building design. Brochg kncilcolod Is to prevent bucldUlg of individual truss wet) and/a chord members only. Acl,ltorw, tompotay and permanent NOON WOW Is always mcpdted tot statAlly and to prevent collapse wllh possHslo personal "and property damage. for general gtldance regadng the fort rlcatkln stoot^ delivery, etactlon and txaci ng of lnnses art Inns systems. seeANSI/tP1I Quality Criteria, 0$8-89 and BC51 Building Component 6904 Parke East Blvd. safety information av,laile corn Irus Pluto Ins11Me. 218 N. Lee Street. Suffe 312, Alexancift VA 22314. Tampa, FL 33610 Job Truss fuss lype oty Ply Tt1362892 1111656 A011 Root Special t t Job Reference (optional) Budder's First Soutce, Gtoveland. FL. 34736 7.640 8 Apr 19 2016 Mt1ek IndustrNs. Inc. wed Jun 14 13,52.56 2017 rage 1 ID:4xiZSyOSpriperCOHML1OgIzP836-04J370cfrhhCBq ERIiH?71LVAINZcwwWvW_6_z6MW3 140 S9•t4 11.0-0 V.-OF4.4-0 16 4-0 1 22.9.5 29.2.11 358.0 39.10.2 M•8•o i a S9.14 S2.2 3.4.0 2•PO 6S5 6S5 6-SS 4.2.2 I.9.14 •0• 5.00 12 3x6 = 5x8 = Sx6 = 5xl2 = 3x6 = Sx8 = 23 22 21 20 19 18 17 16 15 14 2x4 II 3x8 = 1 5x8 STP = 3x6 = 2x4 II 1.5x8 STP= 3x6 = 3x6 = Scale = 1:84.8 LOADING (psf) SPACING- 2.0.0 CSI. DEFL. In (loc) I/defl Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.54 Vert(LL) -0.11 14-29 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.60 Vert(rL) -0.28 14-29 >842 180 BCLL 0.0 ' Rep Stress Incr YES WB 0.71 Horz(TL) 0.03 12 n/a rVa BCDL 10.0 Code FBC2014/rP12007 Matrix-M) Weight: 238 lb FT = 0% LUMBER- BRACING - TOP CHORD 2x4 SP No.2 TOP CHORD Structural wood sheathing directly applied or 5-7-15 oc puffins. BOT CHORD 20 SP No.2 BOT CHORD Rigid ceiling directly applied or 6.0-0 oc bracing. WEBS 2x4 SP No.3 REACTIONS. All bearings 0-8.0. lb) - Max Horz2=118(LC 10) Max Uplift All uplift 100 lb or less at joint(s) except 2=-276(LC 10), 18=-336(LC 7), 17=-636(LC 11), 12=-333(LC 11) Max Grav All reactions 250 lb or less at jolnt(s) except 2=606(LC 21), 1 e=969(LC 1), 17=1246(LC 22), 12=671(LC 22) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2.3=-899/355, 3-4=-396/188, 6-7=-158/545, 7.8=•231/659, 8-9= 231/659, 9.10=-274/233, 10-11=-744/395, 11.12=-1037/585 BOT CHORD 2-23=-348f784, 22-23=-348f784, 21-22=-49/319, 20-21= 283/193, 19-20— 283/193, 18-19=-286/192, 17.18=-473/275, 14-15=-186/655, 12.14=-454/923 WEBS 3.22— 522/333, 4-22=-93/336, 4-21=-496/226, 6-21=-196/636, 6-18=-783/383, 7-17_ 451/357, 9-17— 1084/591, 9.15=-88/383, 10-15=-477/217, 10-14=-44/341, 11 - 1 4=-304/295 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7- 10; Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCOL=S.Opsf; h=15ft; Cat. II; Exp C, Encl., GCpi=0.18; MW FRS (envelope) automatic zone and C-C Interlor(1) zone; cantilever left and right exposed: end vertical left and right exposed;C-C for members and forces 8 MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding 4) All plates are 3x4 MT20 unless otherwise indicated 5) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 6) ' This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2.0-0 wide will fit between the bottom chord and any other members. 7) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 276 lb uplift at joint 2, 336 lb uplift at joint 18 636lb uplift at joint 17 and 333lb uplift at joint 12. 8) 'Semi -rigid pitchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. Q WARNING - Veft design Parameters and READ NOTES ON THIS AND INCLUDED NITEK REFERANCE PAGE N&7473 rsv. id01UMI6 BEFORE USE Design valid for use ordy with Mllek®conneclors Ihh design is bawd only upon pararnotors shown. and Is lot an Wtv"Kil binding component. not a truss syslem. 8oforo use, the txdldkV deslgnet roust verify the arxxicablilty of design patarnolers and rxoperly hcotroralo this design Into the overall txtildkng design. bracing Indicated Is to budding of IrxlNklual Irum web and/or chord members only. Addlllonal leml»rary and petrncmnl txacklo M iTe k' rxovent Is always tecp/rod lot siablllly and to rxevenl colictim with possible personal "and rxoperly damage For general guidance segarding the 6904 Park& East Blvdfabrication, slotage, delivery, etectklnn and bracing of husses and tnrss systems, swANSI/rPl1 Quality Criteria, DS849 and SCSI Building Component Tampa, FL 33610SafetyInformationavalic"o born teas Plato t nstlkde. 218 N. Lee Street. Sulle 312. Alexandria. VA 22314. Job I russ truss type oty ply T113s26113 1111656 A012 Roof Special Gader 1 1 Job Reference(optional) ID:4xrtSyO5pnperCOHML10g1zP836 ySRgY4d07JxwN78cYAk14YOdlzlwlUvOzD158sz6MW 1 1 PO 4.9.14 Y•PO 12.8.0 164.0 , 18.4.0 , 232.0 2&00 32.100 37-&0 40 t02 44.8.0 46.8.0 4- •14 4.2.2 3f 3fi-0 2-PO 4.1P0 I.10a 4-t0.0 4.10.0 ' 3.2.2 ' 3.9.14 1.04 Sze _ 5.00 12 4 3 i.SxS STP— v 12 20 11 Sx8 = S 8 502 = 3x6 = 3x8 = Sx6 = A 7 6 36 9 37 3810 39 1140 41 12 Scale - 1:84.8 13 1.S91 STP = IIq 29 28 27 26 25 23 24 22 21 42 43 20 1944 18 45 46 17 16 3x6 = 2x4 11 3x8 = 1 5x8 STP = 1.Sx8 STP = 3x6 = 2x4 11 3x8 2x4 11 3x6 = 3x6 = 20 II 6x8 = 1e•,o 4.9.14 9.00 12•e•0 L6-4:2 7.4 21410 *90 2B•2.11 32•lo-0 31•e-0 40.10.2 44-e-0 49•t4 4.2.2 3•e•0 3•e-0 -0 3.4-0 3J-0 4.2•tt 3.7•s 4.100 3.2.2 3.9•t4 Plate Offsets MY)f4.0-5-12 0.2.81 (6.0-5-12 0-2-81 f12:0.3-00.2.81 (6.0-5-12 0-2-81f12:0.3.0 04-4104-41(4.0-5-12 LOADING (psi) SPACING- 2.0.0 CSI. DEFL. in (loc) I/defl Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.78 Vert(LL) 0.09 17 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.59 Vert(rL) -0.18 17-18 >999 180 BCLL 0.0 ' Rep Stress Incr NO W B 0.80 Horz(TL) 0.05 14 n/a rVa BCDL 10.0 Code FBC2014/TP12007 Matrix-M) Weight: 242 lb FT = 046 LUMBER- BRACING - TOP CHORD 2x4 SP No.2 TOP CHORD Structural wood sheathing directly applied or 4.0-9 oc puffins. BOT CHORD 2x4 SP No.2 BOT CHORD Rigid ceiling directly applied or 5-5-3 oc bracing. WEBS 2x4 SP No.3 REACTIONS. All bearings 0-8.0. lb) - Max Horz 2=98(LC 8) Max Uplill All uplift 100 lb or less at joint(s) except 2=-303(LC 27), 21=-1186(LC 9). 14=-541(LC 9), 24=-376(LC 24) Max Grav All reactions 250 Ib or less at joint(s) except 2=659(LC 1). 21=2451(LC 20), 14=1024(LC 20), 24=535(LC 18) FORCES. (lb) - Max. CompJMax. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2-3=-1083/452, 3.4=-704/371, 4-5=-432/353, 5.6=-432/353, 7-8=-342/879, 8-36=-707/1633, 36-37=-707/1633, 9.37=-707/1633, 9-38=-310/285, 10-38=-310/285, 10.39_ 310P285, 11-39=-310/285, 11-40=-1644/938, 40.41=-1644/938, 12-41=-1644/938, 12-13=-1786/976, 13.14=-1949/1027 BOT CHORD 2-29=-430/960, 28-29=-430/960, 27.28=-221/615, 24-25= 425/257, 23-24=-425/257, 22.23_ 436/260, 21-22=-1125/570, 19-20=-617/1350, 19.44= 617/1350, 18-44=-617/1350, 18-45=-617/1350, 45.46=-617/1350, 17-46=-617/1350, 16-17=-868/1758, 14-16=-868/1758 WEBS 3-28=-392/262, 4.28= 74/280, 4-27=-269/155, 6-27=-284/690, 6-25=-638/287, 7-25=-267/670, 7-23— 336/302, 7.22=-649/324, 8-22— 206/562, 8.21=-982/550, 9.21_ 2099/1099, 9-20= 399/1092, 11-20=-1355/701, 11.18=0/308, 11-17=-172/360, 12-17=-46/353 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7.10; Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2pst; BCDL=5.Opsf, h=15f1; Cat. II; Exp C; Encl., GCpi=0.18; MWFRS (envelope) automatic zone; cantilever tell and right exposed: end vertical left and right exposed, Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) All plates are 30 MT20 unless otherwise Indicated. 5) This truss has been designed for a 10.0 psi bottom chord live load nonconcurrent with any other live loads. 6) ' This truss has been designed for a live load of 20.0psf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 7) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 303 lb uplift at joint 2, 1186 lb upliil at joint 21, 541 lb uplift at joint 14 and 376lb uplift at joint 24. 8) 'Semi -rigid pilchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. Continued on Daae 2 Q WARNWG . VMIfy dodpn pnemenero and READ NOTES ON THIS AND INCLUDED MREK REFERANCE PAGE MO.7472 rov. 1402,2015 BEFORE USE. Design valkl for use only wllh MllekO connector]. Ihls design is lased only upon paanelers shown, and Is la on hdA4dnal building component. not a toss system. Before use. the txlldlng deslgnor must verify the arlpllcaMlty, aofdesignpameters and rxopetly Incorpoiate this; design Into Ow overall mAding design. Bracing Indicated is to bucidino of Individual trim web and/or chord memo ets only. Additional temporary and potrrlalent IxacUtg MiTek' ixevent Is always recpLed lot stabWty and to rxevenl eo(IcVw wllh possUe porsond V#." and rxoperly damage. For general guidance regae9ng the 6904 Parke East Blvd. fobticallon , sloiage, delivery, erection and bracing or tmtmes and Inns systems seeANSI/nn I Quality Criteria, DSB-/9 and SCSI Wilding Component Tampa. FL 33610SafetyInformationovdlablefromRussPlatehulltute. 218 N. Lee Street. Suite 312. Alexandria VA 22314. Job Truss russ ype ry Ply T1t362893 1111666 A012 Root Special Gager 1 t Job Reference (optional) eweaere rust source, tsroverana, rt- sn rao ID:4xi2SyQ5pnperCOHML 1 Og 1 zP836-ySRgY4d0 JxwN78cYAkl4YOdlzLwl LNDzD?5Bsz6MW 1 NOTES- 9) Hanger(s) or other connection device(s) shall be provided sufficient to support concentrated load(s) 128 lb down and 123 lb up at 25.7-4, 127 lb down and 122 lb up at 27-7-4, 127 lb down and 122 lb up at 29-7-4, 127 lb down and 122 lb up at 31.7-4, 127 lb down and 122 lb up at 33-7-4, and 127 lb down and 122 lb up at 35.7.4, and 223 lb down and 213 lb up at 37-8-0 on top chord, and 66 lb down at 25-7-4, 65 lb down at 27-7-4, 65 lb down at 29-7-4, 65 lb down at 31.7-4, 65 lb down at 33-7.4, and 65 lb down at 35-7-4, and 266 lb down and 144 lb up at 37-8-0 on bottom chord. The design/selection of such connection device(s) is the responsibility of others. 10) In the LOAD CASE(S) section, loads applied to the (ace of the truss are noted as front (F) or back (B) LOAD CASE(S) Standard 1) Dead + Roof Live (balanced): Lumber Increase=1.25, Plate Increase=1.25 Uniform Loads (pit) Vert: 1-4=-54, 4-6=-54, 6-7=-54, 7-12=-54, 12.15= 54, 30-33— 20 Concentrated Loads (Ib) Vert: 12=-1 26(F) 17= 266(F) 19=41(F) 36=-88(F)37=-87(F)38=-87(F)39=-87(F) 40=-87(F)41=-87(F)42=-42(F)43— 41(F)44= 41(F) 45=-41 (F) 46=-41 (F) Q WARNING • Vertly dealgn Parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERANCE PAGE MIF7473 rev. IOMIW t6 BEFORE USE Design valid for use orgy with Mliek® Connectors. fhb design Is based only upon parameters shown. and Is for an indlOduai txddtng component, not a truss system. Before use, the building designer must verify the applicability of design Wiarnoteis and properly Incorporate this design Into the overall ding design Biacing Indicated Is to buckling of Individual truss web and/or chord members only. Additional lempaary and permanent txocing MOWprevent is always required fa stability and to prevent collapse wllh possible personal Inpay and property damage. For general guidance regarding the 6904 Parke East Blvd. krixk:allon. storage, delivery, erection and txacing of trusses and truss systems, seeANSI/rPI I Quality Criteria, OSB•69 and SCSI Building Component Tampa, FL 33610SafelyInformationovallabletantrussPlateInstitute. 218 N. Lee Street. Sulte 312. Alexandria, VA 22314. Job fruss Truss Type y T11362894 1111656 A013 Hip Girder 1 1 Job Reference(optional) Buddefs First Source. Groveland. FL 34736 7.640 s Apr 19 2016 M1Tek Industries. Inc. Wed Jun 14 13 53 012017 Page 1 10.4xizSyO6pnperC0HMLIOgIzP836-0e?Cm0eemc3n?Hlp6uG dhNsSNh8mw6MCilejJz6MW0 1-0 0 3.8.14 7 0 0 10-&15 14 8.1 18-4-0 21.6.2 254-0 1-0-0 MIN 3 2-2 3.9.15 3 8.3 3.9.15 3.2-2 3 9.14 5.00 1112 5X — 20 II 3x8 = 4x6 = 4 23 6 24 6 25 7 Scale = 1.46.2 TP= 9 Ig 10 1.7 IJ IC 11 IV 30 = 2x4 II 30 = 30 = 3x8 = 2x4 II 1.Sx8 STP= 2x4 II 30 = 6x8 = LOADING (psl) TCLL 20.0 TCDL 7.0 BCLL 0.0 ' BCDL 10.0 SPACING- 2-0-0 Plate Grip DOL 1.25 Lumber DOL 1.25 Rep Stress Incr NO Code FBC2014lrP12007 CSI. TC 0.50 BC 0.59 WB 0.87 Matrix-M) DEFL. In (loc) Weft L/d Vert(LL) 0.09 15 >999 240 Ven(TL) -0.15 13-15 >999 180 Horz(TL) 0.05 11 n/a rVa PLATES GRIP MT20 244/190 Weight: 128 lb FT = 0% LUMBER- BRACING - TOP CHORD 2x4 SP No.2 TOP CHORD Structural wood sheathing directly applied or 4-1-0 oc pudins. BOT CHORD 2x4 SP No.2 BOT CHORD Rigid ceiling directly applied or 6-0.0 oc bracing. WEBS 2x4 SP No.3 REACTIONS. (lb/size) 9=-180/0.8.0, 2=1021/0-8.0, 11=2597/0-8-0 Max Horz 2=88(LC 8) Max Uplilt9=-303(LC 19), 2=-507(LC 8). 11=-1192(LC 5) Max Grav9=204(LC 12), 2=1031(LC 19), 11=2597(LC 1) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. TOP CHORD 2-3=-1977/947, 3-4=-1792/893, 4.23_ 14481742, 5-23=-1448/742, 5-24=-1448/742, 6-24=-1448l742, 6.25= 434/1064, 7-25=-434/1064, 7.8=-473/1143, 8.9= 426/908 BOT CHORD 2-16=-883/1783, 15-16=-883/1783, 14-15=-773/1658, 13-14=-773/1658, 13-26=-237/564, 12-26=-237/564, 12-27=-237/564, 11-27=-237/564, 10-11=-824/415, 9-10=-824/415 WEBS 4.15— 144/509, 4.13= 280/154, 5-13=-394/342, 6.13=-569/1152, 6-12=0/275, 6-11=-2029/964, 7-11=-763/454, 8-11=-349/220 NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7-10: VUlt=140mph (3-second gust) Vasd=108mph; TCDL=4.2psh BCDL=S.Opsf; h=15ft; Cat. 11; Exp C; Encl., GCpi=O 18; MW FRS (envelope) automatic zone; cantilever left and right exposed; end vertical left and right exposed; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) This truss has been designed for a 10.0 psf bottom chord live load nonconcurient With any other live loads. 5) ' This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3.6.0 tall by 2-0-0 Wide Will fit between the bottom chord and any other members. 6) Provide mechanical connection (by others) of truss to bearing plate capable of Withstanding 303lb uplift at joint 9, 507 lb uplift at joint 2 and 1192 lb uplift at joint 11. 7) 'Semi -rigid pitchbreaks including heels' Member end fixity model was used In the analysis and design of this truss. 8) Hanger(s) or other connection device(s) shall be provided sufficient to support concentrated load(s) 173 lb down and 214 lb up at 7-0.0. 87 lb down and 122 lb up at 9.0-12, 87 lb down and 122 lb up at 11-0-12, 87 lb down and 110 Ib up at 12-8-0, 87 lb down and 122 lb up at 14.3.4, and 87 lb down and 122 lb up at 16-3-4, and 173 lb down and 214 lb up at 18-4-0 on top chord, and 309 lb down and 142 lb up at 7-0-0, 65 lb down at 9-0-12, 65 lb down at 11-0-12, 65 lb down at 12-8-0, 65 lb down at 14-3.4, and 65 lb down at 16-3.4, and 309 lb down and 142 lb up at 18-3.4 on bottom chord. The design/selection of such connection device(s) is the responsibility of others 9) In the LOAD CASE(S) section, loads applied to the face of the truss are noted as front (F) or back (B). LOAD CASE(S) Standard Continued on Daae 2 A WARNING • Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERANCE PAGE M11•7473 rev. 1000M16 BEFORE USE. Oeslgn valid lot use only vAth MilokO connectots. D'As design Is based orgy upon patamolers shown, and Is la an kxOVK W lxNcling component, not tAotrusssystem. Before use, the bding dosklnor must verity the cop AlcaAlty of design patanotors awl propedy hlcogorale this design Into the overall btAding design. Bracing IrK k:atod Is to povont buckling of aldlviuual tram web and/or chord members only. Addillonal temporary and permanent tracing MiTek' Is always roclub ed for stab9tiy and to prevent collapw with p>r581te persork9 "and popery danaUe For general gJdalce tegardirtp Ow foUlcotbn. storage, do". erecllon tint woch o of Inmes and tare systems, seeAN51/TPI I Cuatity, Criteria, OSB-89 and SCSI lulWing component 6904 Parke East Blvd. Safety Information available from fnas Plole Wit lute, 218 N. Lee Street. Suite 312. Alexond t VA 22314. Tampa. FL 33610 Job Truss Trussype ty ply r,1362etr4 1111656 A013 Hip Girder 1 1 Job Reference Gonad Busders First source. utovetana. FL U4 /36 1w. , o , . _. __.. . -v-- 10:4,aZSy05prlperC0HML10g1 zP836.0e?CmOeemc3n?Hjp6L6 dlwsSNh8mw6MCtlelJz6MW0 LOAD CASE(S) Standard 1) Dead + Roof Live (balanced): Lumber Increase=1.25, Plate Increase=1.25 Uniform Loads (pit) Vert: 1.4-54, 4-7=-54, 7.9=-54, 17-20=-20 Concentrated Loads (Ib) Vert: 4=-126(F) 7=-126(F) 14— 41(F) 15-309(F) 13=41(F) 5=-87(F) 12=-41(F) 6=-87(F) 11=-309(F) 23=-87(F) 24-87(F) 25-87(F) 26=41(F) 27= 41(F) Q WARNING - Verify daslyn panwwten and READ NOTES ON THIS AND INCLUDED NITEK REFERANCE PAGE NO.7473 rev. Id0Y1015 BEFORE USE Design vctlld for use only Win IAIek® connectors. Mils design Is lased only upon parameters shown. and Is for an Individual building component. not a Ituss systarn. Before use. the building designer must verify the g4AIcablilty of design palotnoters and rxopetly IncorMae DLLs design Into the overall building design. Bracing Indicated Is to rxoveni buckling of Individual truss web and/or chard members only. Additional temporary and permanent bracing MOW is always tw4ulted lot stability and to prevent collarm wllh po55ble personal Injury and poporly danage For funeral guidance regarding the fobdcotkrl storage, delivery, erection and tracing of trusses and truss systems, seeANSUM I Quality Criteria. OSB-69 and SCSI Building Compartant 6904 Parke East Blvd. Safety INarmation ovalk"a from Truss Rate Insiltute, 218 N. Leo Street. Suite 312. AloxandrIa. VA 22314. Tarnpa, FL 33610 Job runs ruse ype ry ply T1t362995 1111656 CJ1 Jack -Open 10 1 Job Reference floral tsusaers rrrst source, uroverona, r-t_ cvvx w' ' • r. ID:4xi2SyO5pnperCOHML 1 Og 1 zP836-BBUER9kft44ezWKLa2PsxRGK?bY7e1tY26h3_rz6MVu 1-0.0 1.0.0 1-0-0 1-0.0 2x4 = LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In loc) I/dell Ud TCLL 20.0 Plate Grip DOL 1.25 TC 0.08 Vert(LL) 0.00 5 999 240 TCOL 7.0 Lumber DOL 1.25 BC 0.01 Vert(TL) 0.00 5 999 180 BCLL 0.0 ' Rep Stress incr YES WB 0.00 Horz(rL) 0.00 2 n/a n/a BCDL 10.0 Code FBC2014rrPI2007 Matrix-M) LUMBER - TOP CHORD 2x4 SP No.2 BOT CHORD 2x4 SP No.2 REACTIONS. (Ib/size) 3=10/Mechanical, 2=113/0-8-0, 4=4/Mechanical Max Horz 2=42(LC 10) Max Uplift3=-9(LC 10), 2=-74(LC 6) Max Grav3=10(LC 1), 2=113(LC 1), 4=12(LC 3) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown Scale = 1.6.6 PLATES GRIP MT20 244/190 Weight: 5 lb FT = 0% BRACING - TOP CHORD Structural wood sheathing directly applied or 1-0-0 oc pudins. BOT CHORD Rigid ceiling directly applied or 10-0.0 oc bracing. NOTES- 1) Wind: ASCE 7-10; VUI1=140mph (3-second gust) Vasd=108mph; TCDL=4.2psh BCDL=5.Opsf; h=15ft; Cat. 11; Exp C; Encl., GCpi=O 18; MWFRS (envelope) gable end zone and C-C Interior(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces & MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 2) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 3) ' This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 4) Refer to girder(s) for truss to truss connections. 5) Provide mechanical connection (by others) of truss to beating plate capable of withstanding 9 lb uplift at joint 3 and 74 lb uplift at joint 2. 6)'Seml-rigid pitchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. A WARNING - Vedly dedgn pamnatara and READ NOTES ON THIS AND INCLUDED NHEK REF£RANCE PAGE MQ7a73 rev. I&DIMIS BEFORE USE Design valkl lot use oNy with W lek®conneclors. lilt design Is based only upon parametersshown. and Is lot an individual txNding component. not o tius system Before use, Ira txAldlrtg designer must verify the cg4AIccbGlly of design parameters and property hcdxpxrato it* design Into the over,, txBdkg design. Bracing Indicated Is to prevent b ickli ng of individual truss web aril/or Chad members only. Additional temporary and pxxmaant txocing WOW Is always recµhed kw statAlty and to prevent c,ldpw vAlh possIrAe persora tnpay and properly darnage. For general gtAdunce regadI g the fabrication, slotoge, deltvety. erection and txoclg of musses and Inns systems, sooANSI/rPI I Quality Criteria, OSS-89 and SCSI Butlding Component 6904 Pork& East Blvd. Safely INormallon ovallabte from truss Rate tns9krle. 216 N. Lee Street. Suite 312. Alexandria VA 22314. Tampa. FL 33610 Job russ-SS ype ryPly T11362888 1111656 CJ3 1,-a,ck-0pan 9 1 Job Reference (optional) Builder's First Source, Grovelond, FL. 34736 1.o4u s npr w ZV to mr r es mamirms, me wea dun - I.i.as: iv 261 r rage r 10:4xr2SyOSpnperCOHML 1 Og 1 zP836•fN2ceVIHeNCVagvx8Gw5UfoVl?uhNCyhGmOdxHz6MVt 1-0-0 _ 3-0.0 1.0.0 3-0.0 20 = LOADING(psf) SPACING- 2-0-0 CSI. TCLL 20.0 Plate Grip OOL 1.25 TC 0.08 TCDL 7.0 Lumber DOL 1.25 BC 0.05 BCLL 0.0 ' Rep Stress Incr YES WB 0.00 BCDL 10.0 Code FBC2014/TP12007 Matrix-M) LUMBER - TOP CHORD 2x4 SP No.2 BOT CHORD 2x4 SP No.2 REACTIONS. (lb(size) 3=59/Mechanical, 2=184/0-8-0, 4=29/Mechanical Max Harz 2=86(LC 10) Max Uplift3= 56(LC 10), 2=-89(LC 10) Max Grav3=59(LC 1), 2=184(LC 1). 4=45(LC 3) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. Scale = 1:10.9 DEFL. in (loc) Well Ud PLATES GRIP V@n(LL) -0.00 7 >999 240 MT20 244/190 Ven(rL) -0.01 4-7 >999 180 Horz(rL) 0.00 2 n/a n/a Weight: 11 lb FT = 0% BRACING - TOP CHORD Structural wood sheathing directly applied or 3.0.0 oc puriins. BOT CHORD Rigid ceiling directly applied or 10.0.0 oc bracing. NOTES- 1) Wind: ASCE 7.10; Vult=140mph (3-second gust) Vasd=108mph, TCDL=4.2psf; BCOL=5 Opsf, h=15ft; Cat. II; Exp C; Encl , GCpi=0.18; MW FRS (envelope) gable end zone and C-C Intedor(1) zone; cantilever left and right exposed', end vertical left and right exposed;C-C for members and forces 8 MWFRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 2) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 3) ' This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2.0.0 wide will fit between the bottom chord and any other members. 4) Refer to girder(s) for truss to truss connections. 5) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 56 lb uplift at joint 3 and 89 lb uplift at joint 2. 6) 'Semi -rigid pltchbreaks Including heels' Member end fixity model was used in the analysis and design of this truss. Q WARNING . Verlty design peremotere end READ NOTES ON THIS AND INCLUDED AIITEK REFERANCE PAGE YD7473 rev. 1dO MIS BEFORE USE. Design vdkt for use only vAth Mllek® connectors. lhts design S based only trpon pararnelon shown. and Is lot an IndlAdtwl building comil"MI. not a truss solern. Before use. the tx/ldtrlg dosignee must vedfy Me applicability of design Pamr raeteandproprAy incorrwtalo this design Into Iho overdl txdding design. Bracing Indicated Is to txsclatng of IndlvkW Muss web and/or chord members only. Addlllorna l temporary and Permanent brocfr>0 M iTek' Prevent Isatwao tequired lot slab6lty and to rxevenl collapse wllh PossUe personal lnpay and Progeny do rnaye For general grldanco regadhng tine 6204 Parke East Blvd. tallrlcallori. storage, delivery- erection and tracing of Musses and Iniss systems. seeANSI/rPl I Quality Criteria, OSS-89 and SCSI Building Component Taupe, FL 33610 Safery InformationavailablefromtrussPlatoInstitute. 218 N Lee Street. Sidle 312. Afoxandrla. VA 22314. Job rLISS runs ype yPly T11362897 1111656 C.J3A Jeek•Open 1 1 Job Reference (optional) tsumars rirsr source, uroverana. e-L. s4rsb Z a npr r r "ra mu oR mauamsa. - ea aun .4 i a:w: w cv u 10:4xiZSyO5pnperCOHML 1 Og 1 zP836-fN2ceVIHeNCVagvX8GwSUfoVS1tKNCyt6mOdXHz6MV1 1.0.5 3.0.0 1.0.5 1-11.11 Scale = 1:10.9 3x8 II 1.5x8STP= 105 1.OS 3-0.0 1.11.11 LOADING(pst) SPACING- 2.0-0 CSI. DEFL. In loc) I/detl Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.10 Vert(LL) -0.00 4-5 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.08 Vert(fL) -0.01 4.5 >999 180 BCLL 0.0 ' Rep Stress Incr YES WB 0.00 Horz(rL) 0.00 3 n/a rVa BCDL 10.0 Code FBC2014/TPI2007 Matrix-M) Weight: 10 lb FT = 0% LUMBER- BRACING - TOP CHORD 2x4 SP No.2 TOP CHORD Structural wood sheathing directly applied or 3-0-0 oc pudins, except BOT CHORD 2x4 SP No.2 end verticals. WEBS 2x4 SP No.3 BOT CHORD Rigid ceiling directly applied or 10-0.0 oc bracing. REACTIONS. (lb/size) 5=103/0.8-0, 3=70/Mechanical, 4=33/Mechanical Max Horz 5=42(LC 7) Max Uplift5=-38(LC 10), 3=-66(LC 10) Max Grav5=103(LC 1), 3=70(LC 1). 4=52(LC 3) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. NOTES- 1) Wind: ASCE 7.10, VUlt=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=S.Opsf; h=1511; Cat. II; Exp C; Encl., GCpi=0.18, MW FRS (envelope) gable end zone and C-C Interior(1) zone; cantilever left and fight exposed; end vertical left and right exposed;C-C for members and forces 8 MWFRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 2) Provide adequate drainage to prevent water ponding. 3) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 4) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 5) Refer to girder(s) for truss to truss connections. 6) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 38 lb uplift at joint 5 and 66 lb uplift at joint 3. 7) 'Semi -rigid pitchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. Q WARNINO - VeAry dedgn panmofere and READ NOTES ON THIS AND INCLUDED U17EK REFERANCE PAGE M117473 rev. 144KMIS BEFORE USE Design valid for use only with Mllek® conneclors. D* design Is based only upon paramelers shown, and Is for an Individual lxAdbV component. not a inns system. Before use. the btAWtg designer must verity the applkablify, of design parameters and rxopoty Incorporate this design Into the overall building design. eachg Indicated Is to proven= Ixtcaing of Individual truss web and/or chord members only. Addfllonal tempotary and permanent bating M iTek' is always tec"ted la stability and to rxevenl collapse with possible personal"and properly darnage. for general gukknce iegaiding iho fabricallon, storage. delivery- erection and bracing of tnrsses and Inns systems. seeANSI/IPI I Quality Criteria, OSB-89 and SCSI Building Component 6904 Parke East Blvd Safety Informalbn available from Ituss Plate institute. 218 N. Lee Street, Stile 312, Alexandria. VA 22314. Tampa, FL 33610 o ruse truss type oty ply T n 362698 11111656 CJ5 Jack -Open 9 t Job Reference(optional) tsueaere 1.1re1 loutce, uroverano. PL.:Y1 rue W. ^ - mW x. ID:41dZSyO5pnperC0HMLIOg1zP636-7ac sgmvPWMCgUkh_RKIsLeIPC66fCrVOAA3kz6MVs 1-0-0 5-0-0 1-0-0 5-0-0 2x4 = LOADING (psi) SPACING- 2-0-0 CSI. DEFL. in loc) I/dell Ud TCLL 20.0 Plate Grip DOL 1.25 TC 0.22 Vert(LL) 0.02 4-7 999 240 TCDL 7.0 Lumber DOL 1.25 BC 0.17 Ven(TL) 0.04 4-7 999 180 BCLL 0.0 ' Rep Stress Incr YES WB 0.00 Horz(TL) 0.00 2 n/a rtla BCDL 10.0 Code FBC2014/TP12007 Matrix-M) LUMBER - TOP CHORD 2x4 SP No.2 SOT CHORD 20 SP No 2 REACTIONS. (Ib/slze) 3=100/Mechanical, 2=274/0-8-0, 4=45/Mechanical Max Horz 2=131(LC 10) Max Uplift3=-98(LC 10), 2=-125(LC 10) Max Grav3=100(LC 1), 2=274(LC 1), 4=75(LC 3) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. Scale = 1:IS. 1 2 C4 7N PLATES GRIP MT20 244/190 Weight: 17lb Ff=O% BRACING - TOP CHORD Structural wood sheathing directly applied or 5-0-0 oc purllns. BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. NOTES- 1) Wind: ASCE 7-10; Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2ps1; BCDL=5.0psl; h=151t; Cat. II; Exp C; Encl., GCpI=O 18; MW FRS (envelope) gable end zone and C-C Interior(1) zone; cantilever left and right exposed ; end vertical left and right exposed;C-C for members and forces 6 MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 2) This truss has been designed for a 10.0 psi bottom chord live load nonconcurrent with any other live loads. 3) ' This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 4) Refer to girder(s) for truss to truss connections. 5) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 98 lb uplift at joint 3 and 125 lb uplift at joint 2. 6)'Semi-rigid pitchbreaks Including heels" Member end fixity model was used in the analysis and design of this truss. O WARNING - Vedly design penmorent end READ NOTES ON THIS AND INCLUDED AMEK REFERANCE PAGE N1F7473 rev. IaG2,20IS BEFORE USE. Design vcIld tot use only with Mllek® connectors. 1Ns design 6 based orgy upon paromeleis shown, and Is for an Individual building component, not a mils system. Bototo use. Ina IxlkOng doslgnet must verily the oppllcalAity of design paomelors and rxopmly Incorporate this design Into the over,, building design. Bracing Indicated Is to rxevenl lxscldlng or IndMduai tnlss wob and/ot chord mernbets orgy. Additional temporary and permanent lxocIng MOW is always royu ked fa statAlly and to rxevent collapse with possible personal "and rxopanly damage. For general gukaaae tegatdfing the 6904 Parke East Blvd. fatxlcatlon, stotage. delNety, otoctton and txocing of trusses and In1ss systems. seeANSI/iPI I Quality Criteria, DSO-69 and SCSI Building Component Tampa, FL 33610SolelyInformationavailableIantrussRoleInstitute. 216 N. Lee Street. Suite 312. Alexandria VA 22314. Job I puss Truss Type oty ply T11362899 1111656 CJSA Jack -Open 1 1 Job Reference(optional) 8uddees First Source, Gtovsland, FL. 34736 7.640 s Apt 19 2016 MTak Industries, Ine Wed Jun 14 13 53:11 2017 Page 1 10:4xt2SyO5pnperCOHML1Off 1zP636-lac sgmvPhKMCgUkh_RKIsLdOP8p6fCrVOAA3kz6MVs 3- 0.5 54-0 3. 0-5 1.11-t t 5. 00 r 3x4 II n Scale: 3/4'=1' 3. 0-5 11.11-11 LOADING ( psf) SPACING- 2.0-0 CSI. DEFL. in loc) Well Ud PLATES GRIP TCLL 20.0 Plate Grip OOL 1.25 TC 0.30 Vert(LL) -0.03 4-5 >999 240 MT20 2"/190 TCDL 7.0 Lumber DOL 1.25 BC 0.25 Vert(rL) -0.07 4-5 >826 180 BCLL 0.0 ' Rep Stress Incr YES WB 0.00 Horz(TL) 0.04 3 n/a rVa BCOL 10.0 Code FSC2014/TPI2007 Matrix-M) Weight: 17 lb FT = 0% LUMBER- BRACING - TOP CHORD 20 SP No.2 TOP CHORD Structural wood sheathing directly applied or 5-0-0 oc purlins, except BOT CHORD 2x4 SP No.2 end verticals. WEBS 2x4 SP No.3 BOT CHORD Rigid ceiling directly applied or 10.0.0 oc bracing. REACTIONS. ( lb/size) 5=177/0.8.0, 3=122/Mechanlcal, 4=55/Mechanical Max Horz 5=66(LC 7) Max Uplift5=-74(LC 10), 3=-107(LC 10) Max Grav5=177(LC 1), 3=122(LC 1), 4=90(LC 3) FORCES. ( lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. NOTES- 1) Wind: ASCE 7.10; Vult=140mph (3-second gust) Vasd=108mph, TCDL=4.2psf; BCDL=5.Opsh h=15ft; Cat. II; Exp C; Encl., GCpl=0.18; MWFRS ( envelope) gable end zone and C-C Interior(1) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces & MWFRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 2) Provide adequate drainage to prevent water ponding. 3) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 4) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide Will fit between the bottom chord and any other members. 5) Refer to girder(s) for truss to truss connections. 6) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 74 lb uplift at joint 5 and 107 lb uplift at joint 3. 7) " Semi -rigid pitchbreaks including heels' Member end fixity model was used In the analysis and design of this truss. Q WARNING - VM/y doe/gn panarrioters end READ NOTES ON THIS AND INCLUDED N/TEK REFERANCE PAGE MO-7472 tvv. 10002MI6 BEFORE USE Design vcW for use only wtm MIlek® connectors. ft design Is based only upon paromelers shown. and Is for an individual b ul ling component. not o truss system. Before Lao. the buildng deskjnor must vodfy the applk;obllly, of design patarnoters and ptopatly Incogptate this design Into the overall txltdng design. Bracing Indcoted Is to prevent buckling of kwlvidual fnm web and/a chord members only. Addllonal Iempotary and lxrmanenl txacing WOW Is adwc" teq*ed for skrAlly and to prevent collapse wtih posQule personal Injury and properly damage. For general guklcnce tegadIng the falxkaalkxn, storage, dellvery, erection aril l tocing of fnnSes and Inns systems. seoANSUTPI I Quality Crlferla, DSB-89 and BCSI Building Component 6904 Parke East Blvd. Safety Information awsto"o from truss Ptalo Irnslllule, 218 N. Lee Sheet. Sulle 312. Alexanci t. VA 22314. Tarrpe, FL 33610 Job puss russ type ry pry T1t362900 1111656 EJ7 Jack -Open 23 t Job Reference(optional) Builder's First Source. Groveland, FL 34736 7.640 a Apt 19 2016 Mtl ek Industries, inc, Wed Jun 14 13 63 12 Z01 r rage 1 10:4xrZSy05priperCOHML 1 Og 1 zP836•bm9M3AmXA?SDgz3wFhyZZ4ulEpVSr6S_k4vkbAz6MVr 1.0-0 _ 7-0-0 140 7-0-0 1 3x4 = LOADING (psi) SPACING- 2-0.0 CSI. TCLL 20.0 Plate Grip DOL 1.25 TC 0.46 TCDL 7.0 Lumber DOL 1.25 BC 0 36 BCLL 0.0 ' Rep Stress Incr YES WB 0.00 BCOL 10.0 Code FBC2014/rP12007 Matrix-M) LUMBER - TOP CHORD 2x4 SP No.2 BOT CHORD 2x4 SP No.2 REACTIONS. (Ib/size) 3= 14 1 /Mechanical, 2=366/0.8.0, 4=6 1 /Mechanical Max Horz2=170(LC 10) Max Uplift3— 123(LC 10), 2=-164(LC 10) Max Grav3=141(LC 1), 2=366(LC 1), 4=105(LC 3) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. Scale = 1:19.6 DEFL. In (loc) 1/defl Ud PLATES GRIP Vert(LL) -0.06 4-7 >999 240 MT20 244/190 Vert(TL) -0.16 4-7 >537 180 Horz(TL) 0.01 2 n/a rVa Weight: 23 lb FT = 040 BRACING - TOP CHORD Structural wood sheathing directly applied or 5-9-2 oc puffins. BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. NOTES- 1) Wind: ASCE 7.10; Vu11=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=5 Opsf, h=15ft; Cat. II; Exp C; Encl.. GCpl=0.18; MW FRS (envelope) gable end zone and C-C Interlor(1) zone; cantilever left and right exposed; end vertical left and right exposed:C-C for members and forces & MW FRS for reactions shown, Lumber OOL=1.60 plate grip DOL=1.60 2) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 3) ' This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3.6.0 tall by 2-0.0 wide will tit between the bottom chord and any other members. 4) Refer to girder(s) for truss to truss connections. 5) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 123 lb uplift at joint 3 and 164 lb uplift at joint 2. 6)'Semi-rigid pitchbreaks Including heels' Member end fixity model was used In the analysis and design of this truss. A WARNWO • VsAry design perameterr and READ NOTES ON THIS AND WCLUDED NITEK REFERANCE PAGE NQ7473 rev. MUMS BEFORE USE. Design valid lot use only vAth MIIek®conneclors II1ls design is based only upon paraineters shown. and Is for an Individual buldirlg comporlonl. not a truss syslorn. Before use. the building designer must verity the ap(xkabllly of dosign rwrarnetets and popedy tncapOiate this doslgn Into the overall design. ifracirlg Indicated Is to tackling of IndNklufi airs web aril/or chord members only. Additional temporary and permalonl bracing Mffek' building prevent It always teguired la stability and to rxevent collapse with possible p etsonal Infury and properly darnage. For general guidance regarding the labrlcatim storage, delivery, orocllon and bracing of trusses and Inrsc syslerns. soeANSI/rPt I Quality Criteria, DSB-69 and BC51 Building Component 6904 Parke East Blvd. salary In .Non avallotxo from truss Plate Insifklte, 218 N. Lee Sltoel. Sullo 312, Alexandria. VA 22314. Tampa. FL 33610 O fLISS fU55 ype ty Ply T11362901 1111656 EJ78 Jeck•Open 1 1 Jab Reference Donal Bumers First Source. Urovelane, FL. 34735 r.c+u • Apt iv zuib mrex uWusures. atc, urea run iq rnaa rz zvrr '.St. r 10:4xiZSyO5pnperCOHML 1 Og 1 zP836-bmgM3AmxA?SDgz3wft1yZZ4u19pVNr6S__k4vkbAz6MVr 74M 7-0-0 30 = 7-0-0 7-0-0 Scale - 1:19.6 Plate Olfsets (XY)-- 1:0-0-10.Edael LOADING (psf) SPACING- 2.0.0 CST. DEFL. in loc) Well Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.47 Vert(LL) 0.06 3-6 999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.36 Ven(rL) 0.16 3-6 525 180 BCLL 0.0 ' Rep Stress Incr YES WB 0.00 HOf2(TL) 0.01 1 n/a We BCDL 10.0 Code FBC2014/TP12007 Matrix-M) Weight: 22 lb FT = 0% LUMBER - TOP CHORD 2x4 SP No.2 BOT CHORD 2x4 SP No.2 REACTIONS. (Ib/size) 1=310/0.8-0, 2=142/Mechanical, 3=62/Mechanical Max Horz 1=151(LC 10) Max Upliftl=-125(LC 10), 2=-124(LC 10) Max Grav l=310(LC 1), 2=142(LC 1), 3=106(LC 3) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (lb) or less except when shown. BRACING - TOP CHORD Structural wood sheathing directly applied or 5-8-6 oc purlins. BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. NOTES- 1) Wind: ASCE 7-10; Vult=140mph (3-second gust) Vasd=108mph, TCDL=4.2pst; BCDL=5.Opst; h=15ft; Cat 11; Exp C; Encl., GCpi=0.18; MW FRS (envelope) gable end zone and C-C Interior(1) zone; cantilever left and right exposed; end vertical left and right exposed,C-C for members and forces & MWFRS for reactions shown; Lumber DOL=1.60 plate gnp DOL=1.60 2) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads 3) - This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 4) Refer to girder(s) for truss to truss connections. 5) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 125 lb uplift at joint 1 and 124 lb uplift at Joint 2. 6) 'Semi -rigid pitchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. WARNING - Verify dedon parameters and REAO NOTES ON THIS AND INCLUOEO MITEK REFERANCE PAGE M11,7473 mv. I&V3,2015 BEFORE USE Design valid for use only wllh Mllek® conneclors. It1k design Is based only upon parameters shown. and B too at Indivick" bolding component, not a Truss system. Below use. the btMcIng do9gnos must voilty, It* agrn t1lca1AlIyofdesignpmaetelsand propody Incorpoiale this design Into Ilse overall Ixddirlg design. Bracing Indicated Is to Ixickling of lrtdlviduai truss web and/ot choid mernbets only. Additional temporary, and permanent txacUtg MOW IxovontIs always requited fa stablilly and to prevent collapse wilh poss"o rxsrsonal "arid property damage. fa gerwtd gtidarlee tegcutllrng dne 6904 Parke East Blvd. Idxicatkxistorage, delivery, oreclion and blacing of Innses and Miss systems, seeANSI/TPI I Quality Cdtena, DSB-89 and SCSI Building component Tempo. FL 33610 SafetyIMormadonavailablenomIrussPlateinstitute. 218 N. Lao Sltoot. $into 312. Alexanclda. VA 22314. Job Truss fuss type oty Ply T11362902 1111656 H 1 1. Rool Special Gudar I 1 Job Reference(optional) tsuaaers FIKt source. utovaana. IL. 11 /3a / wY D i%pf Itl N 10 DNI OR ,YYYDIIYfD, nq, a a., r W. I D.4xizSyOSpnperCOHML 109 1 zP836.4yjkHW nAxia4R7e6pPTp6HOwbOntaMB7ykfH7cz6MVq 140, a a•14 7 0-0 1a9-t5 _ 1a 6 1 18 4-0 20 4-0 25.4-0 1-0-0 3.9.14 3-2.2 3•&15 3.8.3 3-9.15 2.0-0 5-0-0 ' Sx8 = 2x4 II 3x8 = 4x6 = Scale = 1:47.0 s.00ll2 4 21 5 22 6 23 7 _ 3x6 = 3x4 = 20 II 30 = 30 = 3x8 = 20 11 1.Sx8STP= 3x4= 6x8 3 9.14 7 0 0 1a9•ts 14b-1 _ 111 0 11 1-0 20.4,0 25 4-0 r 'LA.7d I 3-9.9 3.615 3.a.3ad 2-0.0 5-0-0 1.Sx8 STP = 2x4 11 NI Plate Offsets (),Y)-- f4:0.5.12.0-2-81 LOADING (psl) SPACING- 2.0.0 CSI. DEFL. in (loc) Well Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.49 Vert(LL) 0.08 16 >999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.60 Vert(TL) -0.15 14-16 >999 180 BCLL 0.0 ' Rep Stress Incr NO WB 0.86 Horz(TL) 0.05 12 We Na BCDL 10.0 Code FBC2014/TPI2007 Matrix-M) Weight: 137 lb FT = 0% LUMBER- BRACING - TOP CHORD 2x4 SP No.2 TOP CHORD BOT CHORD 20 SP No.2 WEBS 2x4 SP No.3 BOT CHORD REACTIONS. (Ib/slze) 10=-175/0-8-0, 2=1029/0.8.0, 12=2568/0-8-0 Max Horz2=132(LC 7) Max Uplift I0=-293(LC 19), 2=-492(LC 8), 12=-1223(LC 5) Max Grav 10=193(LC 6), 2=1038(LC 19), 12=2568(LC 1) FORCES. (lb) - Max. Comp./Max. Ten. - All forces 250 (Ib) or less except when shown TOP CHORD 2.3=•1993/911, 3-4=-1809/863, 4.21=-1476/747, 5-21=-1476/747, 5-22=-1476/747, 6-22=-1476/747, 6-23=-462/1004, 7-23=-462/1004, 7-8=-495/1068, 8-9=-378/796, 9-1 0=- 148/332 BOT CHORD 2.17=•859/1798, 16-17=-859/1798, 15.16=•804/1673, 14-15=-804/1673, 14.24= 307/603, 13-24=-307/603, 13-25=-307/603, 12.25=-307/603, 11-12=-826/421 WEBS 4-16=-141/509, 4.14=•262/167, 5-14— 394/342, 6-14=-532/1134, 6-13=0/279, 6.12=-2012/963, 7.12=-708/443, 8-12=-294/146, 8-11= 134/438. 9.11— 882/422 Structural wood sheathing directly applied or 4.0-12 oc puffins, except end verticals. Rigid ceiling directly applied or 6-0-0 oc bracing. NOTES- 1) Unbalanced roof live loads have been considered for this design. 2) Wind: ASCE 7-10: Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf: BCDL=5.Opsf; h=15ft; Cat. II; Exp C; Encl., GCpi=0.18; MW FRS (envelope) automatic zone; cantilever left and right exposed; end vertical left and right exposed; Lumber DOL=1.60 plate grip DOL=1.60 3) Provide adequate drainage to prevent water ponding. 4) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 5) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6.0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 6) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 293 lb uplift at joint 10, 492 lb uplift at joint 2 and 1223 lb uplift at joint 12. 7)'Seml-rigld pitchbreaks Including heels' Member end fixity model was used in the analysis and design of this truss. 8) Hanger(s) or other connection device(s) shall be provided sufficient to support concentrated load(s) 173 lb down and 213 lb up at 7-0-0, 87 lb down and 122 lb up at 9-0-12, 87 lb down and 122 lb up at 11-0.12, 87lb down and 122 lb up at 12-8-0, 87 lb down and 122 lb up at 14-3-4, and 87 lb down and 122 lb up at 16-3-4, and 173 lb down and 213 lb up at 18.4-0 on top chord, and 307 lb down and 137 lb up at 7-0-0, 65 lb down at 9-0-12. 65 lb down at 11-0-12, 65 lb down at 12-8.0, 65lb down at 14-3-4, and 65 lb down at 16-3-4, and 307 lb down and 137 lb up at 18-3-4 on bottom chord. The design/selection of such connection device(s) is the responsibility of others. 9) In the LOAD CASE(S) section, loads applied to the face of the truss are noted as front (F) or back (B). LOAD CASE(S) Standard Continued on Daae 2 A WARNING • Verily dasryn paromofors end READ NOTES ON THIS AND INCLUDED M?EK REFERANCE PAGE Ma-7473 rev. tOMMIS BEFORE USE Design valid for the only wllh MllekO connectors. this design Is based only upon paamelers shown, and Is for an IndllAUal LxRding component, not a Irus system. Before use. the bulltAng designer must verify the appllcabilly of design parameters and properly Incorporate this design Into Ile overall building design. Racing Indicated Is to twcWlng of hdlvkdual Irus web and/or chord members only. Additional temporary and permanent bracing MOWprevent Is always teWltc-d for stab911y and to prevent collapse wllh possible personal frytay and properly dunnage. For general gtldanc:o tegarding Ito 6904 Parke East Blvd. a rk:allon. storage, delivery, election and bxacing of buses and puss systems. seeANSI/fPI I Quality Criteria, DSO-89 and SCSI 6ullding Component Tampa, FL 33610SafetyIntotmadonavadlablefromIrisPlatoInstitute, 218 N. Lee Street. Suite 312. Alexanchla. VA 22314. Job TfuSS truss type ty T17362902 1111656 H l Roof Special Girder 1 1 Job Reference (optional) Builder's First Source. Groveland. FL 34736 06 Apr 19 Zu to Mt t axlneiretaee. 111C WOO Jun 141J:OJ' 1 JZVIr r09eZ 10:4xi2Sy05pnperCOHML 109 1 zP836.4yjkHW nAxia4R7e6pPTp6HOwbOntaMB7ykfH7cz6MVq LOAD CASE(S) Standard 1) Dead + Roof Live (balanced)- Lumber Increase=1.25, Plate Increase=1.25 Uniform Loads (plf) Vert: 1-4=-54, 4-7=-54, 7-8=-54, 8-9=-54, 10.18=-20 Concentrated Loads (lb) Vert: 4=-126(F) 7-126(F) 15— 41(F) 16=307(F) 14-41(F) 5=-87(F) 13=-41(F) 6=-87(F) 12-307(F) 21=-87(F) 22— 87(F) 23=-87(F) 24— 41(F) 25=-41(F) WARNING - Verify desgn pam mfers and READ NOTES ON THIS ANO INCLUOEO MfrEK REFERANCE PAGE 11411-74M rev. 14024015 BEFORE USE. Design valid lot use only Win Mllek® conneclors. MS design Is based only upon paameters shown. and Is for an IndlAdual b tddh7g component, not a truss syslern. Before use, the "ding deslgnet must verify the a"Alcablifty of design parameters aril ptoporly lncog)aoto this design Into the overall b uldhg design. Btactng Indicalod Is to pxevent buclrling of Individual hiss web and/ot chord mernbets only. Additional lemporary and permanent blactng M iTek' is always recKlred bt sk"Hilly and to prevent collapse vAlh possiblo petsonal Iryray and ptoperly darnago. For general guidance regarding the 6904 Parks East Blvd. IabxlcalbrL stotage, delivery. erection and btacing of tanses and tnta systems seeANSI/TPI I Quality Criteria, OSS49 and SCSI Building Component Tampa. FL 33610SafeHInfamafronavailablefromhussRateInstitute. 218 N. boo Sheol. Stdlo 312, Alexandria VA 22314. Job Trws fU55 Type ty T11362903 1111656 HJ7 Diagonal Hip Girder 5 t Job Reference o tioflal Buddefa First Source. UrOVeland, K. 34736 owv s np, i • "i o M •- • ,vvaum . - .. v . 8 4 xa . I D:4xr2Sy05pntperCOHML 1 Og 1 zP936-Y9H7Usooxix3HDIN6?2eVz7lcAOJyOHBOOgg2z6MVp at-5-0 5.2.9 9.10.1 t•516.2.9 4.7-8 Scale - 1:21.1 20 = 5. 2.9 4-7-6 LOADING( psf) SPACING- 2.0-0 CSI. DEFL. in loc) Vdefl Ud PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.33 Ven(LL) 0.03 6.7 999 240 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.43- Ven(TL) 0.09 6-7 999 180 BCLL 0.0 ' Rep Stress Incr NO WB 0.29 Horz(fL) 0.01 5 rVa n/a BCDL 10.0 Code FBC2014/TPI2007 Matrix-M) Weight: 41 lb FT = 0% LUMBER - TOP CHORD 20 SP No.2 BOT CHORD 2x4 SP No.2 WEBS 2x4 SP No.3 REACTIONS. ( lb/size) 4=115/Mechanical, 2=481/0-10-15, 5=295/Mechanlcal Max Horz2=180(LC 4) Max Uplift4=-94(LC 4), 2-267(LC 4), 5=-116(LC 8) BRACING - TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purilns. BOT CHORD Rigid ceiling directly applied or 9.4.1 oc bracing. FORCES. ( lb) - Max. Comp /Max. Ten. - All forces 250 (lb) or less except when shown TOP CHORD 2.11=•779/300, 11-12=-752/303, 3-12=-720/309 BOT CHORD 2.15=-399/721, 15.16=-399/721, 7.16-399/721, 7-17=-399/721, 6.17=-399/721 WEBS 3-7=0/253,3-6=-768/425 NOTES- 1) Wind: ASCE 7-10; Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2psh BCDL=5.Opsh h=15ft; Cat. II; Exp C; Encl. GCpf=0.18; MW FRS (envelope) gable end zone; cantilever left and right exposed; end vertical left and right exposed; Lumber DOL=1.60 plate grip DOL= 1.60 2) This truss has been designed for a 10.0 psf bottom chord live load nonconcutrent with any other live loads. 3) ' This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will lit between the bottom chord and any other members. 4) Refer to girder(s) for truss to truss connections. 5) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 94 lb uplift at joint 4, 267 lb uplift at joint 2 and 116 Ib uplift at joint 5. 6) ' Semi -rigid pitchbreaks including heels' Member end fixity model was used in the analysis and design of this truss. 7) Hanger(s) or other connection device(s) shall be provided sufficient to support concentrated load(s) 14 lb down and 14 lb up at 1-4-15, 14 lb down and 14 lb up at 1-4-15, 27 lb down and 54 lb up at 4.2-15, 27 lb down and 54 lb up at 4.2.15, and 44 lb down and 103 lb up at 7-0-14, and 44 lb down and 103 lb up at 7-0-14 on top chord, and 8 lb down and 1 lb up at 1.4.15, 8111 down and i lb up at 1-4-15, 9 lb down and 0Ib up at 4-2-15. 9 lb down and 0 lb up at 4-2-15, and 24 lb down at 7-0-14, and 24 lb down at 7.0.14 on bottom chord. The design/selection of such connection device(s) is the responsibility of others. 8) In the LOAD CASE(S) section, loads applied to the face of the truss are noted as front (F) or back (8). LOAD CASE(S) Standard 1) Dead t Roof Live (balanced): Lumber Increase=1.25, Plate Increase=1.25 Unflonn Loads (pit) Vert: 1-4-54, 5-8=-20 Concentrated Loads (lb) Vert: 13=-48(F=-24, B=-24) 15=3(F=1, 8=1) 16=-12(F=-6, B=-6) 17=-34(F=-17, B=-17) A WARNING - Veft design panmetere end READ NOTES ON THIS AND INCLUDED MITEK REFERANCE PAGE I11111-747J rev. faaG WIS BEFORE USE Design vdld for tise only Win Mlfek® conneclots. ihls design It baked only upon pcoomelers shown. and Is lot an indlvldwil building component. not o truss system. Before use. the building designer must verity file appilcoblilty, of design pmarneters and properly trtcorpotate it& cW4n Into the overoll building design. Brocing Inli algid fs to prevent buckling of Indivatral Russ web and/or chord members only. Adclllkxxb temporary and permanent txadng MiTek' Is always iegWred for stability and to prevent collapse with possible personal "and property damcige. For general guidance regarding the fatxkcotkxL storage, delivery, eieclton and I.xackg of Inrsses and Irtlss systems. seoAN51/rPI I Quality Criteffa, 0511-89 and BCSI titillating Component 6904 Parke East Blvd. Safety Infonnadon ovallable from rrtrs Rate InsilMo, 218 N. Lee Street, Sullo 312. Alexandria. VA 22314. Tanga, FL 33610 Fuss Trust Type ry T11362904 1111666 V3 Valley 1 1 1 Job Reference(optional) Builders First Source, Groveland. FL 34736 7.64o a Apr t v Lute Mrrex inausines. me Wed Jun 141303'142017 Fogel ID:4xiZSy05pnperCOHML 1 Og 1 zPS36-Y9H7Usooicix3HDIN6?2eVzBlcGYJOxHBOOgg2z6MVp 3.2.8 3.2.8 2x4 !:;, 20 11 LOADING (psi) SPACING- 2-0-0 CSI. DEFL. in (loc) I/defl Ud TCLL 20.0 . Plate Grip DOL 1.25 TC 0.08 Vert(LL) n/a n/a 999 TCDL 7.0 Lumber DOL 1.25 BC 0.06 Vert(TL) n/a - n/a 999 BCLL 0.0 ' Rep Stress Incr YES WB 0.00 Horz(TL) 0.00 3 We We BCDL 10.0 Code FBC2014/TPI2007 Matrix) LUMBER- BRACING - TOP CHORD 20 SP No.2 TOP CHORD BOT CHORD 2x4 SP No.2 WEBS 2x4 SP No.3 BOT CHORD REACTIONS. (lb/size) 1=85/3.1.14, 3=85/3-1-14 Max Horz 1=57(LC 7) Max Uplift s=-36(LC 10), 3=-47(LC 10) FORCES. (lb) - Max Comp./Max. Ten. - All forces 250 (lb) or less except when shown. Scale = 1:9.6 PLATES GRIP MT20 244/190 Weight: 10 lb FT = 0% Structural wood sheathing directly applied or 3-2-8 oc puffins, except end verticals. Rigid ceiling directly applied or 10-0-0 oc bracing. NOTES- 1) Wind: ASCE 7-10; Vult=140mph (3-second gust) Vasd=108mph; TCDL=4.2psf; BCDL=5.Opsf; h=15111; Cat. II; Exp C; Encl.. GCpi=0.18, MW FRS (envelope) gable end zone and C-C Intedor(1) zone; cantilever left and right exposed; end vertical left and tight exposed;C-C for members and forces & MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 2) Gable requires continuous bottom chord bearing. 3) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 4) ' This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0.0 wide will fit between the bottom chord and any other members. 5) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 36lb uplift at joint 1 and 47 lb uplift at joint 3. 6)'Seml-ngid pitchbreaks including heels' Member end fixity model was used In the analysis and design of this truss. A WARNING- Vadfy design parameters and READ NOTES ON TNIS AND INCLUDED MI EK REF£RANCE PAGE 1118-7473 rsv. I&W4016 BEFORE USE Design valid rot use only with Mllek®connoctors. 1Ms alesIgn IS based only upon parameters shown. and Is to an I ndivldtral buldfrng component, not a truss system Before use. the txAdfrng designer must vodfy, the appilcatAlty, of design poarnoters and ptoporly IncorlMrato this design Into the overall bt9dng design. Bracing Indicated Is to bwklkng of IndMdual 1piss• web and/or chord members only. Add ilkxgl temporary and permanent txackng WOWprevent Is always required to sktbll0y and to prevent collapse With posslxe personal hMy and rxoperly damage. For general gtddlance tegardng Me 6904 Parke East Blvd. tatxiaatkxL storage, delivery, erec lion and txatcfrng of Inrses and Inrss systems seeANSI/1PI I Quality Cdterla, OSB-89 and BCSt Building Component Tampa, FL 33610SafetyInformationavailablefromtrussPlateinstitute. 218 N. Lee Streot. Sullo 312. Alexandria. VA 22314. Job runs truss type ty T11362905 1111656 v5 Valley t I 1 Job Reference o Gonal Buldees Fins Source. Gtoveland. FL. 34736 r wu s Apr is mro anraeR mausrrres. mc. Wed jun r• i 3. AQ cv r. ID:4xiZSyOSpnperCOHML I Og I zP836-OLrViCpOTwgohRoVwgW HB1W J40YA2T800280CVz6MVo 5.2.8 5 2.8 Scale = 1:13.9 q0 LOAOING(psf) SPACING- 2-0-0 CSI. OEFL. in loc) Well L/d PLATES GRIP TCLL 20.0 Plate Grip DOL 1.25 TC 0.30 Ven(LL) n/a rVa 999 MT20 244/190 TCDL 7.0 Lumber DOL 1.25 BC 0.23 Vert(rL) n/a n/a 999 BCLL 0.0 ' Rep Stress Incr YES W B 0.00 Horz(rL) 0.00 3 n/a n/a BCDL 10.0 Code FBC2014/rP12007 Matrix) Weight: 17 lb FT = 0% LUMBER- BRACING - TOP CHORD 2x4 SP No.2 TOP CHORD Structural wood sheathing directly applied or 5-2-8 oc pudins, except BOT CHORD 2x4 SP No.2 end verticals. WEBS 2x4 SP No.3 BOT CHORD Rigid telling directly applied or 10-0-0 oc bracing. REACTIONS. (lb/size) 1=159/5-1.14, 3=159/5.1-14 Max Horz 1=105(LC 7) Max Uplift l_ 67(LC 10), 3=-88(LC 10) FORCES. (Ib) - Max. CompJMax. Ten. - All forces 250 (lb) or less except when shown. NOTES- 1) Wind: ASCE 7-10: VUlt=140mph (3-second gust) Vasd=108mph; TCDL=4.2pst; BCDL=5.Opsf; h=1511; Cat. II; Exp C; Encl., GCpi=0.18. MW FRS (envelope) gable end zone and C-C Interior(l) zone; cantilever left and right exposed; end vertical left and right exposed;C-C for members and forces & MW FRS for reactions shown; Lumber DOL=1.60 plate grip DOL=1.60 2) Gable requires continuous bottom chord bearing. 3) This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 4) - This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 5) Provide mechanical connection (by others) of truss to bearing plate capable of withstanding 67 lb uplift at joint 1 and 88 lb uplift at joint 3. 6) 'Semi -rigid pitchbreaks Including heels' Member end fixity model was used in the analysis and design of this truss. Q WARNING - Vedly dedgn pararrWore and READ NOTES ON run AND INCLUDED MIREK REFERANCE PAGE Mll-7472 rev. I&W,2016 BEFORE USE DeslOn valkl to ttse only with fdllek® con neclors. This design is based only upon parameters shown. and Is for an Individual building component. not a truss system. Below use. the building designer must verity The applkabllty of design parornotors and ixop fly Incorpotato this design Into the overall building design. Bracing Inclicaled is to Ixevent buckling of UKRvkhtal truss web and/or chord members only. Additional temporary, and permanent bracing MiTek' Is always reyrJred for stability and to pxevenl collapse with possible personal lnfttry and properly dctmago. For general guklaoe regarding the faWcallon, storage. dolWy, erection and bracing of muses and Inns systems seeANSI/TPI I Quality Criteria. OSS-89 and BCS16ubding Component 6901 Parks East Blvd Safely Information available from Ines Plate Institute. 218 N. Lee Street. Sidle 312. Alexandria. VA 22314. Tampa. FL 33610 Symbols Numbering System 1 A General Safety Notes PLATE LOCATION AND ORIENTATION 14-1 3/4 Center plate on joint unless x, y offsets are indicated. Dimensions are in ft-in-sixteenths. Apply plates to both sides of truss and fully embed teeth. V/1 dr For 4 x 2 orientation, locate plates 0-Ad' from outside edge of truss. This symbol indicates the required direction of slots in connector plates. Plate location details available in MiTek 20/20 software or upon request. PLATE SIZE The first dimension is the plate 4 x 4 width measured perpendicular to slots. Second dimension is the length parallel to slots. LATERAL BRACING LOCATION Indicated by symbol shown and/or by text in the bracing section of the output. Use T or I bracing if indicated. BEARING Indicates location where bearings supports) occur. Icons vary but reaction section indicates joint number where bearings occur. Min size shown is for crushing only. Industry Standards: ANSI/TPI1: National Design Specification for Metal Plate Connected Wood Truss Construction. DSB-89: Design Standard for Bracing. SCSI: Building Component Safety Information, Guide to Good Practice for Handling, Installing & Bracing of Metal Plate Connected Wood Trusses. 6-4-8 dimensions shown in ft-in-sixteenths Drawings not to scale) 2 TOP CHORDS t7 c O U a- O 0 JOINTS ARE GENERALLY NUMBEREDAETTERED CLOCKWISE AROUND THE TRUSS STARTING AT THE JOINT FARTHEST TO THE LEFT. CHORDS AND WEBS ARE IDENTIFIED BY END JOINT NUMBERS/LETTERS. PRODUCT CODE APPROVALS ICC-ES Reports: ESR-1311, ESR-1352, ESR 1988 ER-3907, ESR-2362, ESR-1397, ESR-3282 Trusses are designed for wind loads in the plane of the truss unless otherwise shown. Lumber design values are in accordance with ANSI/TPI 1 section 6.3 These truss designs rely on lumber values established by others. 2012 MiTek® All Rights Reserved MiTek' 1v11Tek Engineering Reference Sheet: Mll-7473 rev. 10/03/2015 Failure to Follow Could Cause Property Damage or Personal Injury 1. Additional stability bracing for truss system, e.g. diagonal or X-brocing, is always required. See SCSI. 2. Truss bracing must be designed by on engineer. For wide truss spacing, individual lateral braces themselves may require bracing, or alternative Tor I bracing should be considered. 3. Never exceed the design boding shown and never stock materials on inadequately braced trusses. 4. Provide copies of this truss design to the building designer, erection supervisor, property owner and all other interested parties. 5. Cut members to bear tightly against each other. 6. Place plates on each face of truss at each joint and embed fully. Knots and wane at joint locotions ore regulated by ANSI/TPI 1. 7. Design assumes trusses will be suitably protected from the environment in accord with ANSI/TPI 1. 8. Unless otherwise noted, moisture content of lumber shall not exceed 19% at time of fobrication. 9. Unless expressly noted, this design is not applicable for use with fire retardant, preservative treated, or green lumber. 10. Comber is a non-structurol consideration and is the responsibility of truss fabricator. General practice Is to camber for dead load deflection. 11. Plate type. size, orientation and location dimensions indicated are minimum plating requirements. 12. Lumber used sholl be of the species and size, and in all respects, equal to or better than that specified. 13. Top chords must be sheathed or purlirs provided at spacing indicated on design. 14. Bottom chords require lateral bracing at 10 ft. spacing. or less, if no ceiling is installed, unless otherwise noted. 15. Connections not shown ore the responsibility of others. 16. Do not cut or after truss member or plate without prior approval of on engineer. 17. Install and load vertically unless indicated otherwise. 18. Use of green or treated lumber may pose unacceptable environmental, health or performance risks. Consult with project engineer before use. 19. Review all portions of this design (front, back, words and pictures) before use. Reviewing pictures alone Is not sufficient. 20. Design assumes manufacture in accordance with ANSI/TPI 1 Quality Criteria. i I i "`1~ R ttll ttlll t l, L'1•S1 f Bu"IdeFirst 1. Ch nt to renew overall placement plan including dimensions, root and cerlbag conditions, top chord size, overhang / cantilever lengths,heel heights, Dearing ti non -bearing wall bacons and heights. 2. Client to review entry and / or other conditions that require centering of peaks, overhangs or cantilevers to ensure proper truss design. 3. Client to review AHU conditions such as, hung from calling, recessed into ceiling or attic mounted. It is Ns ctient'a responsibility to inform suss plant of locations, sae, and weights. 4. Client to review special conditions; such as beam bads, dropped soffit bads and skyfite locations to ensure proper truss design / placement. 5. Ceiling drops and valleys not shown are to be field Iramed by client. S. Hip and comer jacks not at are to be cut in the field by others 7. Overhangs are 20 or 2x6, no blocking is applied. 6. Overhangs are considered wild, cut to fit in fold. S. Temporary or permanent bracing is not included in truss package lope[ ID. Erect trusses per SCSI-BI Summary Sheet. Prior to erecting trussesrefertosealedtrussengrneringsheetsforaddraonalimportantinfo. 11. It is the drent's responsibility to cooridinste delivery dates with truss ptant/sates. Truss delivery will be on the agreed upon date 12. Client to provide a marked baton for delivery. Location must be accessible, level and dear of materials and debits. In lieu of this. busses will be delivered in the best available location at our driver's discretion. No charges will be accepted it above oarons is not met. 13. All buss repairs must be coordinated with truss plant Do Not Cut Any Trusses before contacting buss plant with specifies of problem. 14. No back charges or crane charges of any kind will be accepted unless specifically approved in waiting by truss plant mana gement. 15. Note: One approved layout must be retuned to truss plant before fabrication / scheduling. 16. --- Upon signing you agree that you have reviewed this placement plan in its entiriy. Approved By: Approval Date: Requested Delivery Date: Root Lasting: 20.00 TOLL, 7.0 TCDL. 0.0 BCL.. 10.00 BCDL, DOL 115 Root loading: 40.00 TCLL, 10.00 TCDL, 0.0 BCLL, 6.0 BCDL, DOL 1.00 w T.C. Pitch : 5112 Nrnd Code MWFRS / ASCE 7-10 u B C Pddr : Flat Design Method FBC-2014 / TPI.2007 T.C. Size Vanes Wind Speed 140 mph / Exp. C Heal Mgt Vanes Mean Mgt 15' btin. Bearing Vanes Building CaL II Cantilever N/A Importance Factor 1.00 W Overhang V Enclosure Partially Enclosed O.H. Cut Plumb Enclosure Lanai Partially Enclosed Spacing 24' O.C. Enclosure Entry . Partially Enclosed HUS26 - Typ. Single Ply Root Truss HHUS46 - Typ. Floor Truss 26 GUS26J 9HHU44L (MTRAC4422 SUR46 Hangete as Nundec--red by Sltetson Sbon6 Tie "lees, noted otlienitw See Legend in Layout Truss Layout Client Starlight Project Wyndham Preserve Model: 1981 Ophelia T (RH) Lot / Subdivision / Street Address Lot 184/ Wyndham Preserve W Location Sanford, FI. Data 06/14/2017 I Seale NTS Plan Date: 02J012017 Drawn By Patrick Church Sheets 1 of 1 Job 9 111/6se r. RECORD COPY DCity of Sanford Building and Fire Prevention Product Approval Specification Form 2478 Permit # # 1 Project Location Address U As required by Florida Statute 553.842 and Florida Administrative Code 9N-3, please provide the information and product approval number(s) on the building components listed below if they are to be utilized on the construction project for which you are applying for a building permit. We recommend that you contact your local product supplier should you not know the product approval number for any of the applicable listed products. Be aware that windows, skylights, and exterior doors must be tested in accordance with the Florida Building Code, Section 1714.5. More information about Statewide Product Approval can be obtained at www.floridabuildinQ.or4. The following information must be available on the jobsite for inspections: 1. This entire product approval form 2. A copy of the manufacturer's installation details and requirements for each product. Category / Subcategory Manufacturer Product Description Florida Approval # include decimal 1. Exterior Doors Swinging Therma Tru Fiber Classic FL15000-112 Sliding MI Windows & Doors 420 FL15332-R2 Sectional Wayne Dalton 5120/6100/9100 #0230 FL9174.3-R11 Roll U Automatic Other 2. Windows Single Hung Silverline Bldg Prod. Corp. Series 2900/4900 Single Hung FL19715-R2 Horizontal Slider Casement Double Hun Fixed Awning Pass Through Projected Mullions Wind Breaker Dual Action Other June 2014 nam Category / Subcategory Manufacturer Product Description(including Florida Approval # decimal 3. Panel Walls Siding James Hardi Bldg Prod Inc HardiPlank Lap FL13192-R4 Soffits Aluminum Coils Mastic Endurance FL12194-R3 Storefronts Curtain Walls Wall Louver Glass block Membrane Greenhouse E.P.S Composite Panels Other 4. Roofing Products Asphalt Shingles CertainTeed Corp Roofing CertainTeed Asphalt Shingles FL5444-R10 Underla ments Tamko Asphalt saturated Organic Felt FL12328-R7 Roofing Fasteners Nonstructural Metal Roofing Wood Shakes and Shingles Roofing tiles Roofing Insulation Waterproofing Built up roofing System Modified Bitumen Single Ply Roof Systems Roofing slate Cements/ Adhesives / Coating Liquid Applied Roofing Systems Roof Tile adhesive Spray Applied Polyurethane Roofing E.P.S. Roof Panels Roof Vents Lomanco Aluminum Roof Louver FL3792-R8 Other June 2014 2 Category / Subcategory Manufacturer Product Description Florida Approval # include decimal S. Shutters Accordion Bahama Colonial Roll u Equipment Other 6. Skylights Skylights Other 7. Structural Components Wood Connectors / Anchors Truss Plates Engineered Lumber Railing Coolers/Freezers Concrete Admixtures Precast Lintels Cast -Crete USA Inc High Strength Concrete Lintels FL158-R8 Insulation Forms Plastics Deck / Roof Wall Prefab Sheds Other 8. New Exterior Envelope Products Applicant's Signature Applicant's Name Please Print) June 2014 3 4/28/2017 Florida Building Code Online A. 1a. .12 ,• .. Y1l :''•• v ar a. .6 Nr; .Va,. :1 •' --! r, ,., y°'• N4•w!I"%QY'- 70 5 - tf•, ,'' N:i'., a • 9 . X rr • :> , . -•r'" ti .tJr Bets Nome ( Log In user itegistratlon • Mot Topics ,-Submit Surcharge Astats a Face Publications FBC Staff I SCIS site Map Links Search Fbricta Product ApprovaldDpr4USER: Public User Product Approval Menu > Product or Application search > AnpliraUnn List > Application Detail FL a FL158-R8r `' f i Application Type Revision S' LI, Code Version 2014 Application Status Approved y ? 6 „ *Approved by DBPR. Approvals by OBPR shall be reviewed and ratified A*i t^tl•:' `; • 'i by the POC and/or the Commission if necessary. t r1 Comments Archived Product Manufacturer CAST-CRETE USA, Inc. Address/Phone/Email PO Box 24567 Tampa, FL 33623 813) 621-4641 Ext 128 cpa rrl no@castcrete.com Authorized Signature Craig Parrino cparrino@castcrete.com Technical Representative Craig Parrino Address/Phone/Email PO Box 24567 Tampa, FL 33623 cparrino@castcrete.com Quality Assurance Representative Craig Parrino Address/Phone/Email PO Box 24567' Tampa, FL 33623 cparrino@castcrete.com Category Structural Components Subcategory Products Introduced as a Result of New Technology Compliance Method Certification Mark or Listing Certification Agency Miami -Dade BCCO - CER Validated By Miami -Dade BCCO - VAL Referenced Standard and Year (of Standard) Standard Year ACI318 2011 ACI S30 2011 Equivalence of Product Standards Certified By Product Approval Method Method 1 Option A r-.'' "'li'q" Date Submitted 04/29/2016m:::Jia:rllst," tttps://www.8oridabuilding.org/pr/pr app dtl.aspx?param=wGEVXQwIDquegl%2bT71%2fF192gnRzHNulcciSpgl.XkU6ga/o3d 1/2 4/28/2017 Florida Building Cade Online Date Validated OS/06/2016 Date Pending FBC Approval Date Approved OS/06/2016 Sum mihaiyofProducts FL # Model, Number or Name Description 158.1 High Strength Concrete Lintels 4, 6, 8, and 12 Inch wide Ilntels Limits of Use Certification Agency Certificate Approved for use In HVHZ: Yes FL1S8 118 C CAC NOA 14-0903.03.odf Approved for use outside HVHZ: Yes FL158 R8 C CAC NOA 16-0126.03.odf Impact Resistant: N/A Quality Assurance Contract Expiration Date Design Pressure: N/A 05/21/2017 Other: Superimposed loads shall not exceed allowable safe Installation Instructions load FL158 R8 II NOA 14-0903.03.odf FL1S8 R8 It NOA 16-0126.03.odf Verified By: Miami -Dade BCCO - CER Created by Independent Third Party: Evaluation Reports Created by Independent Third Party: hd 'Nu3tt Contact Us :: 2601 Blair Stone Road. Tallahassee FL 32399 Phone: 850-487-1824 The State of Florida Is an AA/EEO employer. Copyright 2007-2013 State of Florida.:: Privacy Statement :: Acressiblllty Statement :: Refund Statement Under Florida law, email addresses are public records. If you do not want your e-mail address released In response to a public -records request, do not send electronic mail to this entity. Instead, contact the office by phone or by traditional mall. If you have any questions, please contact 8S0.487.1395. *Pursuant to Section 4SS.27S(t), Florida Statutes, effective October 1, 2012, licensees licensed under Chapter 455, F.S. must provide the Oepartrnent with an email address If they have one. The emalls provided may be used for official communication with the licensee. However email addresses are public record. If you do net wish to supply a personal address, please provide the Oepartment with an email address which an be made available to the public To determine If you are a licensee under Chapter ass, F.S., please dick he . Product Approval Accepts: 0.ac1 E Credit Card Safe ht(ps:IA~.Ooridabwlding.orgtpr/pr_app oll.aspx?param=wGEVXQwtDquegl%2bT71%2(F192gnRzHNu"5pgLXkU6g%3d 2R MIAM I -DADS MIAi1•II-DADE COUNTY PRODUCT CONTROL, SECTION DEPARTMENT OF REGULATORY AND ECONOMIC RESOURCES (RER) 11805 SW 26 Street, Room 208 BOARD AND CODE ADMIMSTRATION DIVISION Miami, Florida 33175-2474 T(786)315. 2590 F (786) 315-2599 NOTICE OF ACCEPTANCE ( NOA) w%v%v.miamidadaeov/ecoiwnry Cast -Crete USA, Inc. P.O. Box 24567 Tampa, Florida 33623 SCOPE: This NOA is being issued under the applicable rules and regulations governing the use of construction materials. The documentation submitted has been reviewed and accepted by Miami -Dade County RER- Product Control Section to be used in Miami Dade County and other areas where allowed by the Authority Having Jurisdiction AHJ). This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Section (Iti Miami Dade County) and/or the AHJ (in areas other than Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perform in the accepted manner, the manufacturer will incur the expense of such testing and the AHJ may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. RER reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Section that this product or material fails to meet the requiremetits of the applicable building code. This product is approved as described herein, and has been designed to comply with the High Velocity Hurricane Zone of the Florida Building Code. DESCRIPTION: ( Cast -Crete) 411, 6" & 12" High Strength Precast and Prestressed Concrete Lintels APPROVAL DOCUMENT: Drawing No. FD4612, titled "Precast and Prestressed Lintel Details", sheet l of 1, prepared by Craig Pan-ino, P.E., dated March 24, 2003 and Drawing No. LT4612, titled "Cast -Crete 4", 6" & 12" Lintel Safe Load Tables", sheets 1 through 3 of 3, prepared by Craig Parrino, P.E., dated March 24, 2003, last revision dated June 12, 2014, all signed and sealed by Craig Pan•ino, P.E., on August 19, 2014, all bearing the Miami -Dade County Product Control Revision stamp with the Notice of Acceptance number and the expiration date by the Miami -Dade County Product Control Section. MISSILE IMPACT RATING: Large and Small Missile Impact Resistant LABELING: Each lintel shall bear a permanent label with the manufacturer's name or logo and the Miami -Dade County logo. RENEWAL of this NOA shall be considered after a renewal application has been Bled and there has been no change in the applicable building code negatively affecting the pertorrnance of this product. TERMINATION of this NOA will occur after the expiration date or if there has been a revision or change in the materials, use, and/ or manufacture of the product or process. Misuse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause for termination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed -by the expiration date may be displayed in advertising literature.. If•any portion of the NOA is displayed, then it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall be provided to the user by the manufacturer or its distributors and shall be available for inspection. at the job site at the request of the Building Official. This NOA revises NOA # 13-0321.07 and consists of this page 1, evidence submitted pages )B-1, E-2 and E-3 as well as approval document mentioned above. The submitted documentation was reviewed by Helmy A. Makar, P.E., M.S. f_ / NOA No. 14-0903.03 MIAMI•DAOECOUNTY ''-_',`fI Expiration Date: 09/11/2018 Approval Date: l0/ 09/2014 Page 1 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 1. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #03-0605.04 A. DRAWINGS 1. Drawing No. FD4612, titled "Precast and Prestressed Lhitel Details", street I of 1, prepared by Craig Parrino, P. E.. dated Alarch 24, 2003 and Dr caving No. LT4612, titled Cast -Crete 4 ", 6" & 12 " Lintel Sgfe Load Tables'; streets I through 3 of 3, prepared 4v Craig Parrbro, P.E., dated March 24, 2003. last revision #1 dated April 28, 2003 both drawings signed and sealed b1, Craig Parrino, P. E. B. TESTS 1. Test report on flexural testing on 4 ", 6" & 12 " Precast Concrete Lbrtels Filled and Unfilled A,todeIs. total of (13) concrete lintel specimens, per ASThf E-529-94. prepen-ed by Applied Research Laboratories, Report No. 30404A, dated 04110103, signed and scaled by Christopher A. Ramon, AE. C. CALCULATIONS 1. Calculations.for Cast -Crete Lintels, dated 05129103, 207 pages, prepared by Craig Parriuo, P.E., signed and sealed 61; Craig Parrino, P.E. 2. Calculations for Cast -Crete Lintels, dated 05129103, 140 pages, prepared by Craig Parrino, P.A. signed and sealed by Craig Parrino, P.E. D. MATERIAL CERTIFICATION: 1. Quality System Alanual for Carr -Crete kfachine Alade Precast Lintels revised on Alt(j)1, 2002. 2. Cast -Crete Qualtq, .%,stem Manual for Prestressed Products dated 2002. 2. EVIDENCE SUBNffrTED UNDER PREVIOUS APPROVAL # 08-0320.09 A. DRAWINGS 1. Drmving 11ro. FD4612, titled "Precast and Prestressed Lintel Details", $heel I of 1, prepared by Craig Parrino, P.E., dated Alarch 24, 2003 and Drmving Aro. L714612, titled Cast -Crete 4", 6" & 12" Lintel Site Load Tables". sheets I through 3 of 3, prepared by Craig Parrino, P. E., dated March 24, 2003, Iasi revision dated A/m-ch 11, 2008. B. TESTS 1. None. C. CALCULATIONS 1. 1lrone. D. QUALITY ASSURANCE 1. B1, Aliami-Dade County Building Code Compliance Office. E. MATERIAL CERTIFICATIONS 1. None. 4HWiy A. Mal L C M.S. Product Control Unit Supervisor NOA No. 14-0903.03 Expiraliou Date: 09/11/2018 Approval Date: 10/09/2014 E-1 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 3. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL H 12-0209.12 A. DRAWINGS 1. Draining No. FD4612, titled "Precast and Prestressed Lintel Details'; sheet I of 1, prepared by Craig Parri ro, P.E., dated March 24, 2003 and Draining A n. LT4612, titled "Cast -Crete 4 ", 6" 8 12 " Lintel Sqfe Load Tables" sheets l through 3 q1'3, prepared by Craig Parrino, P.E., dated March 24, 2003, lost revision dated March ! 1, 2003, all signed and sealed by Craig Parrino, AE,'., on A4arch 22, 2012. B. TEST'S I. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By X iami-Dade Co ony Department of Permitting. Environment. and Reg latoq,4 fairs. E. MATERIAL CERTIFICATIONS 1. None. F. OTHER 1. Letter fi-o m Cast -Crete Corporation, clated February 03, 2012, signed and sealed by Craig Parrimo, P.E., certifying compliance Wilt the Florida Building Code, 2010 Edition. 4. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL # 13-0321.07 A. DRAWINGS 1. None. B. TEST'S 1. None. C. CALCULATIONS 1. A one. D. QUALITY ASSURANCE 1. By ATianrP-Dade Comely Department of Regulcuor)? and Economic Resources (RER). E. MATERIAL CERTIFICATIONS 1. Nolte. W—tiny A. Maim-, P.E., M.S. Product Control Unit Supervisor NOA No. 14-0903.03 Expiration Date: 09/11/2018 Approval Date: (0/09/2014 E - 2 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 5. NEW EVIDENCE SUBMITTED A. DRAWINGS 1. Drawing Alb. FD4612, tilled "Precast and Prestressed Lintel Details'; sheet 1 of 1, prepared by Craig Parrino, AE., dated kfarch 24, 2003 and Drawing No. 174612, titled "Cast -Crete 411, 6" & 12" Lintel Sqfe Load Tables'; sheets 1 through 3 of 3, prepared by Craig Parrino, AE., dieted March 24, 2003, last revision dated June 12, 2014, till signed mid sealed by Craig Parrino, P.E., on August 19, 2014. B. TESTS 1. None. C. CALCULATIONS 1. Calculations.for Cast -Crete Lintels, dated 0811912014, pages 14.201 Nu-ough l4.236. prepared by Craig Parrino, P.E., signed and sealed by Craig Parrino, P.E. D. QUALITY ASSURANCE 1. By Miand-Dade County Departuteut of Regulato j, mid Cconon is Resources (RER). E. MATERIAL CERTIFICATIONS 1. None. F. OTHER 1. Letter fi-om Cast -Crete USA, Inc., dated August 19, 2014. signed and sealed by Craig Parrino, P.E., certifying compliance with the Florldet Building Code, 2014 Edition. 9 d i Hel altar, P.E., hI.S. Product Control Unit Supervisor NOA No. 1 d-0903.03 Expiration Date: 09/11/2018 Approval Date: 10/09/2014 E-3 9 A=T R6TE HIGH STRENGTH PRECAST AND PRESTRESSED CONCRETE LINTELS i 4" SOLID LINTEL DATA TABLE W""X EQ'i[Es)®i ff tf; all, i my Ir:,,.aasRjFJlt?Faf,7tn r3aSat0lDl' rjf tF if lm.l / lei Qavttitu.!:it a 6" PRECAST U—LINTEL DATA TABLE ctr. lut a 29 FM0ru=3FZM vao f3C71aP=KUAFl 1SL'l iDcIAUFY-- avQamrimFFm,+n to"vmrasavao, ran. nmymrialt:lra RTn vn rsav r_T-nr rare iAL*El rya va o i7mrrr170 F21rury XV-'- r?-rTI ffTM F1Ml".7rZ'71F>rrrn i rw--= rra rra rns.rrararF,,,,r.7m r7 tlev M.Hv RI1 rta_.r rlgv rsurmumg ln trsav ftrT rxavtZr'7 0n©rF111 rrn®[Fran rrsgvQst:rtasaraso rLY!9 RiF7 raF7r rt m : n.l r¢rl; r n : Q o rr r a_rrz a.l nlmarll rrerM rsmb=]d o o 12" PRECAST II —LINTEL DATA TABLE 7S!•ft]1•t 1 f,la!LE}4' 1C•. m rrrr asla rz. , l ,. , ocs DE:1 1 r]t:7r va o JkLmvTvl(-iL%aMru r'.1LJGJ aru 93csrA6L'J l[I11L" ll1 i D®DC nth r Lmnryn r:.nrlF rta.:_tvm a o v©r}m y oo rasar st artrls_.rrCMiff c oe o srav rt,c rmc rArSSdSirervrrcnrlm„",rfomarnUffilr111J_l1TIL'Hr Fn" E)G'Sfa mc;arsavo rr u rts! ss. as¢ra r a oc10 ty a ue.tr raltnrma'+Q slur n_:r c-r ecsorflctR3L II'CSi0r1:1rF:.tlrcl. LUJWLr" Fr1 1ffr3art5oSL'L',•!'L1fajm TYPE "B' TYPE 'A' SIM I1N IN/W- WOmNIDIr 6 Aor1Wo'" M", Yrm'IY. n m MWM 01 Wom0r1 UM AO CUM 01 rtt006=6 a omlawto N11MOm ftno fN W aml Y,o, q. I.. Y) P nlw I uw m Maft f YO ,f om N11N . m10 re mnoutrorY(M YIYouYlf am at MILL men or town moon Y V l w fIY1M t. imtltr.. ffr M Mo vl f M Alm 10 A" Im tun Om u nm 4M.S m Wu No CLWILL - 1 cr M & M LLOOq r.. n ru M . nm, Inmts mtrrf . rxw tot moomm a /YWnM Ima mm,m f. 0o1I0e, mm QpU 0t Cn u7 OIm WN M t fM UN OW 0 mmlrc room mcm OM a o n a "m NON Nlu mix" m low FOOL PUODucr IAItvlsRn mnWc i. m: l.n.af 0. 4 A. 111 ca 2: 0 R IQ '\4 -: 6324 CR S79 NAIL V NIL PRECAST AND PRESTRESSED LINTEL DETAILS MS Mlrf MM-14 mm If JmIN A AO tw R118AitwooAlt: vivo MUM GAfo Mr6'm, r.L owmlc foull smim I or I j CENERAL NOTES 1) YaatmG / fe i ft 2p Gr..W - 3=pfnAOD )q/6 ed t tf tnmteq va 6 ds /SN C66 nY-mYBnun dN n br /tr Amua 096D 19 rd.rtr pr ASIY QA bipd Y r S 2) A6 mt. bd WN bored al MKymtnan 4 beta IlaMW bmlll4 E mml beWebad, fideed by V. 0 barring Wplltb Ya 9ra • 1/2 irlr 3) P-W. Id rmAr bed and bed Midi. A M cds moldhnRwuft440smddedrdatwbaftWpa"dINA>otci% u m21 (Ai) . I2N pkad'I1t26jN5) A7 Well Cad r rrsed 5D ee6N4ert • A kW Fdr =b st cd OnmWVIMIdldlerfakUm IS LAW 1• and27wt mrn.r W Redden am" ow. Serm 160"1 m •VPr•ld•• 5) S.. Mw L*b m tmw*4 7) a aM idrb to be katA r •/ 4' fwm** t bebmW ad 6' dbmaam .tors riauaW d."Ae+sb+ wl awyy oDt W rmbmbm fen a rgbrl. 10) RR - Nrl RAW 11) Men Ildd a d nbr to be bested a W bMM a W FdW CD kl TVPF QMGNAn0bc r - mum rm 41Ya d. uduu F WYftea 12 16- 2B/2T rna rami J L••wb10 ebwta rmb etrA d b ommP) nm100 rwaenmbanda } y` Y° Irl Ano N roao an r uam r sro• 1 6 ' AcTum —cm—a 12' NDNRNL M M It) 6UNR. m N V I,./4 I.q .Ntnm a W w. 1- 13) 1%. edWw who d Wds iala6ld it *near t tY soft ad 1Ned d GW^ a dame dwell b smedmtt .1h AM f.06 MM m^fi6 14) Uft.. bedd tia0r , to oi6ml F '9r u.RU .AA m D 4 belt tbmddMtMeSdLrWart6bd .iG lit a wCre ApOkd "IM bm } A W WCUWal bee S IA Set. ve," bed Salt b"L a w bed 15) far wldb A" haple ml dawn w w1e bed bem am l..et 1•ipbt *teen 16) rat Ltd WON ael llw%be eW bed ten fed be r! beeplb *Met 17) Sek bem m• 4grlgmd abaft Mello 16) Shc bob bad m rd•Joad Adpn oc" on AO 55D an AO 51A 19) AddWW Mind bd mpddy m te aMeMd 1 mN by pmiQrq eddkidrd aWarcad cement. dmemmy vt r (6 U) den IM 6dd La dxYb bder. SEE SAFE LATERAL LOAD TAM FOR LOAD RATM FOR EACH ADDI110NAL t "' Rcmmmemu ( ROU) FILL COME 1) j5 w" FOR B' wasti:::•+ 1, 2) j5 REEAR MR If MIELS GR40 or Gt60 SAFE LOADS FOR 4" SOLID LINTELS 4--4^ 4" GRAVITY TYPE LENGTH 4s8 Y-6' ( 421 PRECAST 1180 4'-0- ( 481 PRECAST 959 4'-8' ( 54) PRECAST 789 5'-10-( 70') PRECAST 460 V-6' ( 781 PRECAST 360 7'-6' ( 901 PRECAST 260 9'-4' ( 112 PREGST 156 10'-6-( 1261 PRECAST 116 12U8 4-- 4- CM UPLIFT LATERAL TYPE LENGTH 4S8 4S8 3'-6- ( 421 PRECAST 687 371 4'-0' ( 481 PRECAST 597 320 4'-6- ( 541 PRECAST 529 258 5'-10'( 701 PRECAST 407 148 8'-C ( 781 PRECAST 366 118 7'-6' ( 901 PRECAST 280 87 9'-4' ( 1121 PRECAST 187 55 10'-6-( 1261 PRECAST 152 43 12F8 121" 12 12F16 6U8 US 61`12 6F16l9il tip"` ref tits•,' N ;ice::'::.:. . 4• .... ., 1,.. 1,e•!!,? t 's e; ' is 4S8 G g • 12F28 12F24 12F20 PROWLT RIlvism) mtewnyllirq ciN lA: fWrlei 1:. ST p : Dwlehgl U,u T /_ % , (t,. CMG PAFaNQ In w ue c -3' 1 ? R I0 `#f4f .1 8424 CA 679 8 6F32 6F28 6F24 6F20 tttQ /OVAL EaG. R-SEFFNEFI R. UW e, rt abu or — CAST—CRETE 4"r 6" & 12" LINTEL SAFE LOAD TABLES I r' w \` FM lob DKU*-14 WAVM m JDIYY A5 " 5WL` lux O/ S b1L• SPAM arm on MW MUK t.L - REC. M 44756 DRA.—. "all 9Ru 1 a 1 RAL SAFE GRAVITY LOADS FOR 6" PRECAST U-UNTELS e^aAa- noFL.AgT ui si c SAFE UPLIFT LOADS FOR 6" PRECAST U-LINTELS 4-m-4,19" SAFE LOAD - POUNDS PER LINEAR FOOT TYPE LENGTH 600 91-1902-10OF10-19ET20-186F24-18 196F32-18 3'-6- (421 PRECAST 2332 2676 3892 5050 6143 7227 8297 9357 4'-0' (487 PRECAST 2025 2313 3892 5050 6148 7227 8297 9357 4'-6' (541 PRECAST 1654 1887 3B33 5050 6148 7227 8297 9357 V-10'(707 PRECAST 1067 1260 2198 3557 5734 7227 8297 8225 6'-6' (787 PRECAST 949 1078 1831 2M 4328 6737 8297 9357 r-6- (901 PRECAST 779 883 1459 21M 3151 4524 U54 9357 9'-4' (1121 PRECAST 584 660 1056 1523 2054 2795 3731 5017 10'-6'(1267 PRECAST SOJ 566 895 1270 1706 2236 2898 3)4) 1 V-4'(1361 PRECAST 457 513 805 1133 15D7 1952 2492 3163 12'-0'(1441 PRECAST 425 477 744 1042 1377 1769 2238 2808 13'-4'(1607 PRECAST 373 417 646 895 1170 1 1485 1952 2295 14'-0-(1687 PRECAST 351 392 605 935 1087 1373 1703 2087 17'-4'(2087 PRECAST NR 299 455 1 620 1 791 1 985 1198 1437 THE NUMBERS IN PARENTHESIS ARE PERCENT REDUCTIONS FOR GRADE 40 FEU) ADDED REBAR. SEE GENERAL NOTE NO. 4 SEE GENERAL NOTES - SHEET 1 OF 3 omy.4m 11 SAFE LOAD PLF LENGTH TYPE 6U8 61`8 RCMV 3'-6- (421 PRECAST 587 1055 596 4'-0' (487 PRECAST 487 787 445 4'-6' (541 PRECAST 416 609 344 5'-10' (707 PRECAST 300 350 198 6'-6- (787 PRECAST 263 496 157 7--6' (907 PRECAST 222 367 116 9'-4- (1127 PRECAST 173 352 74 IV-6'(1267 PRECAST 151 276 58 IV-4'(136) PRECAST 139 311 49 12'-0-(1441 PRECAST 131 277 44 13'-4'(1607 PRECAST 117 223 35 14'-0-(1681 PRECAST 111 202 32 17'-4'(2087 PRESTRESSED N.R. 130 21 SEE GENERAL NOTE 18 4 01M.4./fE SAFE LOAD - POUNDS PER LINEAR FOOT LENGTH TYPE US-11 6F12-11 61`16-11 6F20-11 U24-11 6F28-11 6F32-IT S-6' (421 PRECAST 1412 2074 2715 3356 3997 4638 5279 4'-0' (487 PRECAST 1225 1800 2357 2913 3470 4027 4583 4'-6- (541 PRECAST 1063 1592 2084 2577 3069 3562 4055 5'-10'(7D7 PRECAST 31 1222 160D 1979 2357 2736 3114 6'-B' (787 PRECAST 723 1097 1437 j 1777 2117 2457 1 2797 7'-6- (901 PRECAST 648 09 86309 1249 154401 184010 2135N 2431 9'-4' (1121 PRECAST 575 57100 980 1252 1492 1732 1972 10'-6'(1267 PRECAST 514 462M 787 w 1121 1336p 1551 1766 I1'-4'(1367 PRECAST 474 404 to 685 985 aj 1213 1442 1645 IX-O'(1447 PRECAST 454 36700 619 888 ID93 1299 1506 IY-4-(1607 PRECAST 402 308 516 736 906 1076 1247 14'-O'(1687 PRECAST 36B 285 475 677 832 989 1145 17'-4'(2DB7 PRECAST 253 Zoe lle 476 ON 585 693 803 n THE NUMBERS IN PARENTHESIS ARE PERCENT REDUCTIONS FOR GRADE 40 FIELD ADDED RFBAR. SEE GENERAL NOTE NO. 4 p \G PAi G.•'EN 44 A 1 AL atom% UUG PARRINO 6324 CA 579 FNERI.FL 33580 nE.=NO AA24 PRODUCriwv1sgpbrosplNftWi01Lc 1RuKA, BWIJ -8 Lod ¢ c6oz.o MICFIc 4 4 5, I0-21,4C.-mm., z I-CAST—CRETE 4", 6" & 12" LINTEL SAFE LOAD TABLES ru wa[ o12Yp a Dun a: mu0 aum swe rux ` w am 1/u/m ntttm rr tun rumor r.L -1m oo unr ouwie im Lunt swff : of 3 SAFE GRAVITY LOADS FOR 12" PRECAST U•LINTELS 4wap4m" SAFE LOAD - POUNDS PER LINEAR FOOT LENGTH TYPE 12US 1216-28 IVII-2112116-28IM-2612174-2619284612M-M Y-6- (421 PRECAST 3428 5000 5838 7619 9352 11060 12755 14438 4'-0' On PRECAST 2923 4232 5838 7619 9352 11060 12755 14433 4'-6' (541 PRECAST 2396 3464 5304 7619 052 11060 12755 14438 5'-10'(701 PRECAST 1612 2320 3218 5234 8487 11060 12755 1443% 6'-6' (781 PRECAST 1383 1996 2679 4196 8421 10032 12755 144 Y-6- (901 PRECAST 1138 1628 2131 3218 4076 6756 9793 1 9'-4- (1121 PRECAST 795 1216 1535 2230 3083 4167 5593 755 10'-6'(1261 PRECAST 614 1043 1295 1553 2516 3323 43M 5632 11'-4'(1361 PRECAST 518 945 1162 1649 2216 2893 3719 474 12'-O'(1441 PRECAST 456 878 1073 11513 1 20 00 2617 3333 420 IY-4'(1601 PRECAST 3% 767 926 1294 1709 2188 2743 3409 14'-O'(1681 PRECAST 321 720 965 1204 1554 2017 2451 3106 17'-4'(2081 PRECAST N.R. 451, 831 881 1141 1428 1750( 2) 19'-4- (2321 PRECAST NA 343 4 77 700, 925 1152 1360 1609 0) DE NIR M 01 PAR[NIMESTS ARE PUM, UDUCM FOR OM 40 IESD ADDED KRUL SU ODEAAL NOTE 1A 4 SAFE GRAVITY LOADS FOR 12" PRECAST wl2" RECESS DOOR U-LINTELS 4ows9 o"m SAFE LOAD - POUNDS PER LINEAR FOOT LENGTH TYPE 12M 1204012R110 T22FIh MWI IM22- IN26- 1t6>a 4'-4' (521 PRECAST 2538 2942 5468 11669 13679 15679 4'-6- (541 PRECAST 2319 2740 5468 11669 13679 1501) 5-8' 661 PRECAST 1347 1941 3555 11669 13679 15675'-10-(701 PREGLSI 1259 1758 3361 94 11669 13679 15676'-8' 601 PRECAST 924 143D 2633 10353r 12574 14804Y-6' 901 PRfCASt 703 1203 2157 7922 9623 1132 9'-8- I In PRECAST 389 843 1451 4427. 5417 6380 W DE NID M N MM MESS ME MM UM=DNS MR Ma 40 KID ADDED R®ML SEE E MUk ROTE MM 4 1J 0 .M OOCP.QT IIJ -.a Callf-olem SAFE LOAD PLF LENGTH TYPE 12U8 12FS RCMU 3 -6' (421 PRECAST 1295 4841 393 4'-0' (461 PRECAST 1295 4841 299 4'-6' (541 PRECAST 1049 3922 2417, 5'-10'(701 PRECAST 681 2547 1S5 V-6- (781 PRECAST 579 2167 123 Y-6- (90) PRECAST 474 1771 914' 9'-4- (1121 PRECAST 355 1326 5 10'-6'(126)PRECAST 106 1143 45 11'-4-(1361 PRECAST 278 1041 38 12'-W(1441 PRECAST 260 971 34 IY-4-(1601 PRECAST 229 857 278 14'-0-(1691 PRECAST 216 809 25 IT-4-(2081 PRESIRESSED N.R. 6 16 19'-4'(2321 PRLSTWW N.R. 534 130D DLL LLKL WL FWIL 10 4'-4' (521 PRECAST 4'-6-. (541 PRECAST 5'-6' (68) PRECAST 5'-10'(701 PRECAST G-8' (801 PRECAST 7'-6' (201 PRECAST 9'-8' (1161 PRECAST r I . SEE GENERAL NOTES - SHEET 1 OF 3 am;r, , EN 441 SAFE UPLIFT LOADS FOR 12" PRECAST U-LINTELS 1 O.M SAFE LOAD - POUNDS PER LINEAR FOOT LENGTH TYPE 12FD-211312-2112f16-2112M-211IF24-11 2128-211202-2T S-6' (421 PRECAST 2752 4287 5613 69M B264 9589 10915 4'-0' (48') PRECAST 2389 3721 4372 6023 7174 8325 9477 4'-6- (541 PRECAST 2113 3291 4310 5328 6347 7365 M 5'-10'(701 PRECAST 1623 2527 3310 4092 4875 5658 6441 6'-6' (781 PRECAST 226 2972 3675 4378 SW 5784Y-6- 901 PRECASI 1767 25 3194 3806 4417 50289'-4' 1121 PRECAST t1444 1111D 259 3087 3583 407910'-6'(126) PRECAST 947 1612 2281 2754 3209 365311'-4'(1361 PRECAST 629 1404 1982 2441 2902 3364 12'-0'(1441 PRECAST 814 7S3 1269 17 220IJ 2616 3032 13'-4-(1W') PRECAST 678 633 1057 1485 1826 2169 2513 14'-0-(1681 PRECAST 622 586 m 974 1365 ISM j 1993 2309 tY-4'(2081 PRECAST 434 427 695 D 964 1182 11402 1623 19'-4'(2321 PRECAST 1 3664 370 593 817 1002 1187 1372, 11) DE WWA M PMWHM ARE KRW REDWMS FOR CM 40 MD A00ED MM SEE CMML NME TILL 4 SAFE UPLIFT LOADS FOR 1Y' PRECAST w/2" RECESS DOOR U-LINTELS C WIM-6. I SAFE LOAD -POUNDS PER LINEAR FOOT 4'-4- (521 PRECAST 1626 12611S 3746 4--6' (541 PRECAST 1558 25B2 3602 5'-M (6B1 PRECAST 1210 2042 2850 5'-10'(701 PRECAST 1173 1994 2769 C-8' (80) PRECAST 1020 1-3m 2426 7'-8' (901 PRECAST 904 1226 21 1161PRECAST 703D 771 . 1472D NW E S 01 PARDRII6 All PLAW4 REOUCUM FOR 40 MD ADDED REVA SEE CDVAL NOTE M 4 1RADUI'.F1EF.VIJL•D 04 unpi :Was r6r(d, lwx!v lMo -o o .0 0% / /' /: PG c: CRAIG PARRIND a o / 81R IAt.• McRS79 SFFMM.A 3)SB4 44D4• FL.P.ENLlCA 10.1149% CAST-CRETE 4", 6" & 12" LINTEL SAFE LOAD TABLES 111E NANu wD N.T&w: OAIE: m EAYDNMDOP- 0m D40M mNL u41u 1P.m s or s MIAM I-DADE MIAMI-DARE COUNTY QiA;&L1LU PRODUCT CONTROL SECTION DEPARTMENT OF REGULATORY AND ECONOMIC RESOURCES (RER) 11805 SW 26 Street, Room 208 BOARD AND CODE ADMINISTRATION DIVISION Miami, Florida 33175-2474 T (786) 315-2590 F (786) 315-2599 NOTICE OF ACCEPTANCE (NOA) www.miamidade.gov/economy Cast -Crete USA, Inc. P.O. Box 24567 Tampa, Florida 33623 SCOPE: This NOA is being issued under the applicable rules and regulations governing'the use of construction materials. The documentation submitted has been reviewed and accepted by Miami -Dade County RER- Product Control Section to be used in Miami Dade County and other areas where allowed by the Authority Having Jurisdiction AHJ). This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Section (In Miami Dade County) and/or the AHJ (in areas other than Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perform in the accepted manner, the manufacturer will incur the expense of such testing and the AHJ may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. RER reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Section that this product or material fails to meet the requirements of the applicable building code. This product is approved as described herein, and has been designed to comply with the High Velocity Hurricane Zone of the Florida Building Code. DESCRIPTION: "Cast -Crete" 8 Inch High Strength Precast and Pre -stressed Concrete Lintels APPROVAL DOCUMENT: Drawing No. FD8, titled "Cast -Crete 8" Lintel -Fabrication Details", sheets l through 3 of 3, prepared by Craig Parrino, P.E., dated June 7,1996, last revision dated June 12, 2014, signed and sealed by Craig Parrino, P.E., on August 19, 2014, bearing the Miami -Dade County Product Control Renewal stamp with the Notice of Acceptance number and the expiration date by the Miami -Dade County Product Control Section. MISSILE IMPACT RATING: Large and Small Missile Impact Resistant LABELING: Each lintel shall bear a permanent label with the manufacturer's name or logo and the Miami -Dade County logo. RENEWAL of this NOA shall be considered after a renewal application has been filed and there has been no change in the applicable building code negatively affecting the performance of this product. TERMINATION of this NOA will occur'after the expiration date or if there has been a revision or change in the materials, use, and/or manufacture of the product or process. Misuse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause for termination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed by the expiration date may be displayed in advertising literature. If any portion of the NOA is displayed, then it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall be provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This NOA renews NOA # 14-0903.02 and consists of this page 1, evidence submitted pages E-1, E-2, E-3, E-4, & E-5 as well as approval document mentioned above. The submitted documentation was reviewed by H ]my A. Makar, P.E., M.S. NOA No. 16-0126.03 MIAMIOADECOUNTY Expiration Date: 05/21/2017 Approval Date: 04/28/2016 Page 1 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 1. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #96-0613.01 A. DRAWINGS 1. Drawing No. FD8, titled "Cast -Crete 8" Lintel Fabrication Details'; prepared by Craig Parrino, P.E., dated 06107196, revision #1 dated 11108196, sheet I of 1, and Drawing No. LT8, titled "Cast -Crete 8" Lintel Safe Load Tables", prepared by Craig Parrino, P.E., dated 0610 719 7, revision #4 dated 04128198, sheet 1 of 1, both drawings signed and sealed by Craig Parrino, P. E. B. TESTS 1. Test report on fexural testing on Precast and Pre -stressed Concrete Lintels Filled Models, total of (36) concrete lintel specimens, per ASTMS-529-94, prepared by Applied Research Laboratories, Report No. 29702B, dated 07130197. signed and sealed by Christopher A. Hamon, P.E. C. CALCULATIONS 1. Calculations for Cast -Crete 8-inch Lintels, dated 06106196, 349 pages, prepared by Craig Parrino, P. E., signed and sealed by Craig Parrino, P. E. 2. Calculations for Cast -Crete 8-inch Lintels, dated 11/11196, •45 pages, prepared by Craig Parrino, P.E., signed and sealed by Craig Parrino, P.E. D. MATERIAL CERTIFICATIONS 1. Mill Certified Inspection Report Silo #4 dated April 1996 for cement by Southdown Brooksville Cement Laboratory. 2. Mill Certified Inspection Report #20-8275 dated 06120195 for pre stressing strand by The Crispin Company. 3. Mill Cer-1 fled Inspection Reporl #20-8345 dated 11/13195 for pre -stressing strand by The Crispin Company. 4. Mill Certified Inspection Report #2111-078240 dated 04/25/96 for #3 rebar by Ameristeel. S. Mill Certified Inspection Report #84-M19614 dated 02/29/96for #5 rebar by Birmingham Steel Corp. 6. Mill Cerlif ed Inspection Report 458A66332 dated 01128/96 for #4 rebar by Birmingham Steel Corp. 7. Mill Certified Inspection Report #84-M20749 dated 04/05/96 for 45 rebar by Birmingham Steel Corp. 8. Mill Certified Inspection Report #84-M19805 dated 03/06/96 for #4 rebar by Birmingham Steel Corp. 9. Mill Certified Inspection Report #84-M21208 dated 04/21/96 for 94 rebar by Birmingham Steel Corp. 10. Mill Certified Inspection Report #84-M20652 dated 04/03/96 for #5 rebar by Birmingham Steel Corp. ny A. Makar, P.E., M.S. Produc ontrol Section Supervisor NOA No. 16-0126.03 Expiration Date: 05/21/2017 Approval Date: 04/28/2016 E-1 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 11. Mill Certified Inspection Report ##84-M20749 dated 04105196for #S rebar by Birmingham Steel Coi p. 12, Quality Control Manual for Cast -Crete Machine Made Precast Lintels dated 05114196. 13. Quality Control Manual for Pre -stressed Products dated 03120195. 2.. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #01-0209.03 A. DRAWINGS 1. , - None. B. TESTS 1. None. C. CALCULATIONS 1. None. D. MATERIAL CERTIFICATIONS 1. None. 3. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL # 03-0605.05 A. DRAWINGS: 1. Drawing No. FD8, titled "Cast -Crete 8" Lintel Fabrication Details", sheet 1 of I, prepared by Craig Parrino, P.E., dated June 7, 1996, revision 42 dated January 28, 2003, and Drawing No. LT8, titled "Cast -Crete 8" Lintel Safe Load Tables", sheets 1 & 2 of 2, prepared by Craig Parrino, P.E., dated June 7, 1996, revision #S dated March 24, 2003, all drawings are signed and sealed'by Craig Parrino, P.E. B. TESTS: 1. Test report on flexural testing on Precast Concrete Lintels Filled Models, total of 12) concrete lintel specimens, per ASTM E-529-94, prepared by Applied Research Laboratories, Report No. 30404B, dated 04123103, signed and sealed by Christopher A. Hamon, P.E. C. CALCULATIONS: 1. Calculations for Cast -Crete High Strength Precast and Pre -stressed 8-inch Lintels, dated May 29, 2003, sheets 1.1 through 1.493 and 2.1 through 2.336, prepared by Craig Parrino, P.E., signed and sealed by Craig Parrino, P.E. D. MATERIAL CERTIFICATION: 1. Quality System Manual for Cast -Crete Machine Made Precast Lintels revised on May 01, 2002. 2. Cast -Crete Quality System Manual for Pre -stressed Products dated 2002. w IGMij A. Makar, P.E., M.S. Product Control Section Supervisor NOA No. 16-0126.03 Expiration Date: OR21t2017 Approval Date: 04/28/2016 E-2 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 4. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #06-0222.01 A. DRAWINGS 1. Drawing No. FD8, titled "Cast -Crete 8" Lintel Fabrication Details".. sheets I through 3 of 3, prepared by Craig Parrino, P.E., dated June 7, 1996, last revision dated February 17, 2006, signed and sealed by Craig Parrino, AE. B. TESTS 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Miami -Dade Building Code Compliance Office. E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter fi-orn Cast -Crete Corporation, dated 0212012006, signed by Craig Parrino, P. E. 5. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL # 11-0121.04 A. DRAWINGS 1. None. B. TESTS 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Miami -Dade Building and Neighborhood Compliance Department (BNC). E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter fi-om Cast -Crete Corporation, dated January 18, 2011, signed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2007 Edition. Hjjf46 A. Makar, P.E., M.S. Product Control Section Supervisor NOA No. 16-0126.03 Expiration Date: 05/21/2017 Approval Date: 04/28/2016 E-3 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 6. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #12-0209.13 A. DRAWINGS 1. Drawing No. FD8, titled "Cast -Crete 8" Lintel Fabrication Details", sheets 1 through 3 of 3, prepared by Craig Parrino, P.E., dated June 7, 1996, last revision dated February 17, 2006, signed and sealed by Craig Parrino, P.E., on .,March 22, 2012. B. TESTS 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Miami -Dade County Department of Permitting, Environment, and Regulatory Affairs. E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter from Cast -Crete Corporation, dated 0210312012, signed and sealed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2010 Edition. 7. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #14-0903.02 A. DRAWINGS 1. Drawing No. FD8, titled "Cast -Crete 8" Lintel Fabrication Details", sheets 1 through 3 of 3, prepared by Craig Parrino, P. E., dated June 7, 1996, last revision dated June 12, 2014, signed and sealed by Craig Parrino, P.E., on August 19, 2014. B. TESTS 1. None. C. CALCULATIONS 1. Calculations for High Strength Precast and Pre -stressed 8-inch Lintels, dated August 19, 2014, sheets 14.101 through 14.124, prepared, signed, sealed by Craig Parrino, P.E. D. - QUALITY ASSURANCE 1. By Miami -Dade County Department of Regulatory and Economic Resources (RER). E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter from Cast -Crete USA, Inc., dated August 19, 2014, signed and sealed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2014 Edition. He A. Makar, P.E., M.S. Product Control Section Supervisor NOA No. 16-0126.03 Expiration Date: 05/21/2017 Approval Date: 04/28/2016 E-4 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMQTTED 8. NEW EVIDENCE SUBMITTED A. DRAWINGS 1. None. B. TESTS 1. None. C. -CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Miami -Dade County Department of Regulatory and Economic Resources (RER). E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter from Cast -Crete USA, Inc., dated January 13, 2016, signed and sealed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2014 Edition. 140WA. Makar, P.E., M.S. Product Control Section Supervisor NOA No. 16-0126.03 Expiration Date: 05/21/2017 Approval Date: 04/28/2016 E - 5 44W%T RETC HIGH STRENGTH PRECAST AND l PRESTRESSED CONCRETE LINTELS y "In 1 PRODUR RI!h"M of CoAlAyw wifn WO Florda 7/32"0 STIRRUPS TYPE '8' STIRRUPS Y A 6" 1 STIRRUP DETAILS awa fAu PRESTRESSED U- R[ Tmt Mrl SPAfJW n iOR/ t4 -11 0.134 642 4 -a 4 O X-Or 0 13 -4 0.140 DQ OAR 1 -] W-27 14 O 0 17 - 0.131 630 7 32 BAR 3 7 !2 B 17 -2 1 O 3 -Y 0 0-2 4 0 4-1 a 21•-C 0.124 p 37 S 7/]2 9AR 21'-Y 0 O 3'-a 3/4' W 22'-0' 0.200 all 32 AR 7/32 La RI'-10• O S'-10 S/a 10 4•-1,- U2,0 07 fe-0 7/32 RAR 2!•-10- 0 O 4•-3 ,/0• 10 no n u r n" s rcc nnnn 11_I IAITrt nATA TALI r 7i!!11 jj••••r•17—'Z•}-—_ T-. Y/•7i1^_KSTLi>f Y->ri7iZ tAJO IFEIMUn" n-R 1 oa u=Wlr aret al c v ne" rU"Wm BLUMr lmdO iW"fal:'aFl::IF,"!UtY! SGE1 7iva, N=.Jd[.lC- Emil 1. S1 rLllilfT.4'•I r'r" C]©Ll tf KMA 92!9 r,,:,rtR rrla oar;ar7no oavrm am+tru rt::>Irfi.vrr,rtr:ra m, •.• ,1N1V1 W nA,af fmoa 1m •,• afro, W •r1a uw y. u A PRECAST U-LINTEL DATA TABLE so L V ME CNI 16 f 3•-M C032 120 03 ROAR I 3•-Y 7 32 MR 3'-1' A 1 4 0 0.037 II 7 am 3- A 4 a -4 0.040 aAa 3 - 7 32 a e_ 0 3: a e Wo 1 MEMAR a 7 32 LR t-2• A t• 004 270 Rl"It 7•-a 7 2 WI 7'-2' 0 V-4 OA 4 OAR e-Y 3 KAAA 0 hot 370 4 W AA fi' 3 a20AR 0'- ` 11•-0 REaAA91. 11-3• MLR 1'-0' 3-0 0 12-W 0.t10 RELR 11-11 3 R[tAll 11-a 3- a 3'- • 0.1" 4e0 S RCLR 17-3• 3 R[Wt 13- 3 a 14- • 4 S 13-1 3 RAau IS -a a iMi n01110ARr O1rOWATION 0 PROVRED Iql P1e0Vt1 AMWAL n e PROSOMID 41 CWTIMY 1AWS AND CANNOT K R17R00=8 OM 0CTR10V1ED WnVV t IK rem "FISH Co.VSMI or UN-1.817E USA. KG 1. KWIOK010 StItL• 7/32 TIN AS1N A3101 4% 04. 0. n01t1 TRA IDIAL OMEN Or S11I1RV/3 AND 10 WAR OKOA b AM A8111 7/10 1MN K"M n COONID StARIM FROM EACH lQWttR 2/0a11 =-AnASATON PRISTUSS r tao OI ml WWOasa6 Lug Mt moo Solkkb ASJV AAIL 0. Ofsymm • 4. INOf 111 RLnIrWOO10 tACE N001% aNUli a anllan0. CONCKTE atRdPll6x f• . low Ps MRa' f10Y dCN OK ralslRM16 t00tAS: f4. 4000 PSI I" ALL rattail a D" =US. L sa IW1if or ManA4r1UK nIRL IVA s WALL faEilans /D11a . 0.70 [ rP. CUAL Or CDN01nA NA7 K VAAO 01 1RV or rKUKaafD uNfat Kwomm LOE t SrRirlMt IW rMlA[N4Y 10 atROt Un0l Alm NANOLa1D FMM rnODtrCt ucvlSllD loaya„w r7lf Aa FbAfb CeNAcapraAtGpIAAteWo!4•-o OT.oZ J Q' CRAIG Zol6 PAFWMAl SEFFNER. 64FL3Z TONAL N.dt FL. P E. LIC. MD.44756 OF , a I mu, CAST-CRETE 8" LINTEL FABRICATION DETAILS QY'I;,,ALlIILYC3, ret u1W. [ml-Il DKW Rf GAR rArtlf'JI Pt - t[L l4 IllSO RAW M 10 it l 4 A89rS71 f '•' ." i ,.. A. ,M, a rnm aff r nnm r.L - ar, An 4nx I mm r m attt 1 or 3 4:eco cRevlry I nAna 9riR W PRECAST 8 PRESTRESSED WI-1NTELS a eecn c Fi eneeErRAoescenDiFOirRrct a SAFE UPLIFT LOADS FOR 8" PRECAST 3 PRESTRESSED Ud-INTELS 4ws9 4-gw SAFE LOAD - POUNDS PER LINEAR FOOT TYpE LENGTH sue us-Ia eriz-oe 616-OD en0-00 VN-m 0"49 8r32-WSM-18 er12-19 Isle-u OM-10 04-19 8M-le ern -le 3'-8' (42 PRECAST 2231 3012 3719 5163 AM 054 95ot 10951 Sow 4605 au 7S47 8974 10394 11ro0 4'-0' (48 PRECAST 1966 2551 21S) 3W 4990 5981 7ou elm 2693 4605 6113 n47 074 I0394 IIUA 4'-0' (54 PRECAST 1599 19w 2110 293t 3733 4576 6400 e224 N89 4375 6f13 7547 06I2 IDm4 1Itm 5'-4- (641 PRECAST 1217 lu5 1438 195! 2Sio 3113 3656 4249 1063 3D90 Sias 7547 7ua 8733 10127 5'-10(701 PRECAST 1062 1103 1173 1631 20ro ISM 3009 3470 1451 26n 4360 716e eo Nel elm 6'-6' ()8 PRECAST g the 2177 3480 3031 3707 4W 5011 12M 2177 3490 Sul 6lw IOM am Y-6- (90-) PRECAST 743 loll lrt9 2632 ems 2999 319I lies lost 1720E131 3996 UM au 6472 9'-4' (11Z PRECAST 554 I" too 2584 34U 2810 3302 I52 124S 2554 34U 4705 elro 10'-6'(1267PRECAST 475 3b a07 2003 2717 2163 25M N3 1U313 2093 2791 4751 11'-4'(1367 PRECAST 362so 94S 5 tat N23 St27 4006 see 9156 lab Ntl u21 4006 12'-0' (144 PRECAST 137 40 n31 tte4 2193 2m 3552 s40 en4 16e4 2193 2005 SSt IT-4-(I SDI PRECAST 296 471 m 14m 183e 2319 2003 471 7565 1428 Iw 23fe 2ee314'-0' 166 PRECAST7 279 424 toe 1320 Is" 21v 2630 442 Mt I)Ti Iw7 2127 2630 14'-8-(1767 PRESTRESSED NR M 24 M Nt5Insemo190t9rns2svPRESIRESSEDKR is M NR lei ai M 412 710 1733 lose 2n0 2513 17'-4'(2Dr) PRESTRESSED N.R. N.4 M RR MR 1 91 1 M M 300 518 1 00 If4M lag ia7 19'-4'(2321 PRESTRESSED KR. M 0R e0 Ne M M235420750It62151s1711 21'-4'(256' PRESTRESSED p R MMNRMArtUO340 6" R1901 1114 1359 1468 2Y-0'(2641 PRESIRESSED NR. Mfa M M M 10l165J13SSD1047IMS1$9 24'-0'(2881 PRESTRESSED M R MM M MRRIm230450e141012Itn 4-409a". SAFE LOAD PLF TYPE LENGTH BU8 8F8 R CMU 3'-6' (427' PRECAST 1025 1024 1598 4'-0- (461 PRECAST 765 763 1 1309 4'-6' •(541 PRECAST 592 591 1073 Y-4- (64') PRECAST 411 411 745 s'-1o•(70 PRECAST 34D 339 616 6'-Hi (761 PRECAST 507 721 490 7'-r (901 PRECAST 424 534 363 9'-4- (1121 PRECAST 326• 512 230 0'-6'(1261 PRECAST 284 401 180 1'-4-(1361 PRECAST 260 452 154 12'-0'(1441 PRECAST 244 402 137 IS-4'(1601 PRECAST 217 324 110 14'-0'(1651 PRECAST 205 793 100 14'-8-(1761 PRESTRESSED N.R. 284 15'-4' (184) PRESTRESSED N.R. 259 d6417'-4-(208') PRESIREM N.R. 194 19'-4'(2321 PRESTRESSED N.R. 148 52 21'-4' (256) PRESIRESSED N.R. 125 42 22'-O'(2647 PRESTRESSED N.R 116 40 24'-0'(28nPRESTRESSED N.R. 91 33 4 AS9*CRi10VV SAFE LOAD - POUNDS PER LINEAR FOOT TYPE LENGTH are-n els-2i eru-n Nst-21 ertt-tr a s-21 elto-11 erro-21 4-IT erN-21 era-n En6-v ern-11 9r32-2r 3'-6' (42 PRECAST 1569 tars 4 Z94 520 6132 7001 is" 2655 35N 43% 52N 032 7001 4'-0- (481 PRECAST flee 2305 Sow 3815 4570 5 6079 Iles 2306 30ro 3815 4570 S325 6079 4'-6' (S4 PRECAST 1207 ro40 2707 3375 4D13 4711 5179 II07 Coro 2707 3375 4043 4711 537! 5'-4' (64 PREp1Si 1016 171 2216 25M lx5 3961 4322 tole 015 22M NU 3N9 3961 45n 5'-10'(707 PRECAST em ISSI 2393 3107 362D 4133 v. 9n 1517 20 0 2513 3107 3620 4133 8'-6' (7n PRECAST m 140 186 23n 2 325) 3712imi 6S 1407 feae 23N 2760 3251 37n 7'-6' (90 PRECAST m IN 1624 mts 2 2 3W n7 1224 I624 2023 Nee 2827 nm 9'-4' (I in PRECAST s91 70e n36 1474 Ias 2157 2500 Sol e67 131e 1143 im rm 2619 10'-B-(1261 PRECAST m SIS 916 19e 1451 It roll nd 530 695 Ilro 1472 1753 2065 2346 11''(1367 PRECAST 414 SO4 SOD 1037 1274 1513 1753id 424 im 1a 13n Im lots 2ta7 12'-O'(1M7 PRECAST 470 49 724 5A 11 13wN173-4 47D s5o 40 1302 1560 IDIOMMIS 13'-4'(160 PRECAST 41e 3e6 607 715 964 1141 425. 460 tro 1159 141e 1 14'-O'(1687 PRECAST 3a 369 SW 724 NO 1054 410 4m It) lost UN 15n 14'-B'(IMV) PRESTRESSED 238 314 sm 672 US 972 249 395 K1 no 1303 Isle PRESTRESSED 224 313 406 a7 7q 91t IOx m 369 16 106 1N 14ro 160 ml 17'-4-(2081 PRESTRESSED IN 192 203 Ot 4D6 506 St1 740 638 1005 I56 1271 e» 1473 19'-4-(2321 PRESTRESSED u: ni ue 447 517 at 747 1" 263 4m 623 a1 1059 Im 21'-4'(2561 PRESTRESSED t42 ro4 Sot 3t1 420 Ste 655 142 232 373 S17A 721 WSW 104e 22--0-(2641 PRESTRESSED I" 191 296 371 462 546 63D 137 m 32 113 686 e6S Mid 24'-0'(288j PRESTRESSED 124 170 267 342 416 492 5e1 1N 22 319 455 W so nd 757 eT0 J) THE NUMBERS 1N PARENTHESIS ARE PERCENT REDUCIONS FOR GRADE 40 ' SEE GENERAL NOTE NO. 18 ON SHEET 3 OF 3. U) IHL4t Iy EN111ESIS AM KXCLN1 NEDUGIIUNS WIC VWh 411 FIELD ADDED REDAK SEE GENERAL NOTE NO. 4 ON SHEET 3 OF 3 *0DUcrRE E CENERAL NOTE NO. 4 ON SHEET 3 OF 3. cxclvt7D (. C E N swd&v t44 Florida : PN0DUCrR1iV738D ft"ftA• e!IOme 3 • 0 / DuQd•Nu .1pf4)+et.4i4AIlr Pl4Mdo 7d,m„ CRAIGRVM CR$ 632424Hx9 79 2SEE GENERAL NOTES -SHEET 3 OF 3 ••• O R p j a SF. FFNER. FL 3W Fol9r 1 S,S+ ! 44 FL RE LIC. MD.44758 ON NUMB ILI 42941 IA04B6R OF I ma. CAST ICRETE 8" LINTEL FABRICATION DETAILS eT " i ra wlu o6sw-I4 9uy9 it.. um rwm a - an w 4ox 1 Wm m a scut gun ovio/ x I 0113 0 It taro PAW% rt, - a4 M 4Dx OUVA Nw I" 1116203 I n SAFE GRAVITY LOADS FOR r PRECAST w12" RECESS DOOR U-LINTELS cwadre SAFE LOAD - POUNDS PER LINEAR FOOT TYPE LENGTH 6AI9-W 98t a1F14- Wto-96 618 "6A1w-66 66r6-is mto-fe 61R14-1 OE16-ls mn- m7s-1e mao-le 1'-4' (52-) PRECAST 1635 049 33H 32110 4346 5421 6493 7367 1891 3691 9206 Wit 606o 9479 I= 4'-6' 54 PRECAST 1424 I5W 3063 2992 3560 4946 W24 69D4 1759 3699 52" 6939 SM 9479 10693 S'-8- (681 PRECAST 866 1770 u1s u» 203917402m 3966 1107 2481 4567 809 e06D9311rd 5'-10"(70') PRECAST b10 an 1653 IN* 2124 26493700 1113 2342 4242 66)f W 07066'-B' BD' PRECAST 7971W5 3120 SW6 77477360 tot 1025 3120 eae 791s10 7'-6 (907 PRECAST 669 755 1490 2452 3776 57433623 755 1490 24S9 J776 57431 9'-0' (1167 PRECAST 411 466 999 1558 2251 31293148 526 9" 1556 2253 3129 5691 U) THE NUMBERS D1 PARENTHESIS ARE PERCENT REDUCTIONS FOR GRADE 40 FIELD ADDED REBAR SEE GENERAL NOTE NO. 4 GENERAL NOTES 1) Nddpk re C ptmg tdd . 4000 pd re pr»bew.4 DW • woo pfre6n14 - J000 ndenr 3AI 4.! 444.yeY dnaeb rws.y wb 66nn A o C90 dY r•Mrs mlammlpmin1100pd wlr p ASW AS. SI 60pdhnin6f1»N 6wttf ASNN Alle riW 2M Y. reYWbe mtlw p. A3711 Q7, It" W aS A Al mis b.d bWo We4 to MWan 4 bm WAW lot0w E—,%6 IX66 ml0de.a li" ka bW expo ' 3) Re" Id mar bd aM had ON& 4) qnh 40m 1. tl 6rl YDm10 1a gWn6. d fdn1110 1» W15S r &. n 647722 (N i pin W Al Odri ar.1 r erd/d33o Od11dbrFa>S 2 hdlre wWi4.fd6/djr, W 17 f w Wqo m b 0» b tr3d b agai.e m.da0 Or i ito &afiy Cole Sskd 140451 a 47tlYVOle 6) 9•0 OW GWo to te4C.a 7) On 17 mW# mq he $*AMd Ito to 03 nUm 8) Mh20iaA/e0eeleW d 60d real a tpr'b Vs "Iee4/.r elneb.d 4emorAl 9) ti 4dipa eq w.b.b w•4nY4 I»b rnm V. »b led %*.. by 41Np9tq 9e 1, . , wlf.9 me•.ed .d .bw ofb4-a.q m Do 4. d .7puu 10) Nl • Sol Y6d It) tolm 6m edbl Wa It to WA..d d D. be5.m d IN mm to*. SAFE LATERAL LOADS FOR 009&.*T. lj. 0ereaa M7 eka 11.8 WTm At 1Rrn SAFE LOAD PLF LENGTH TYPE 8RU6 8RF6 RCMU 4'-4- (52-) PRECAST 758 757 1164 4'-6- (54l PRECAST 694 693 1073 5'-8' (681 PRECAST 408 407 655 5'-10' (701 PRECAST 382 1 381 616 6'-8' (60) PRECAST 595 788 464 7'-6' (90-) PRECAST 509 674 363 9_r(116) PRECAST 370 490 214 SEE GENERAL NOTE 18 12) unukOol .mod .eYf•t1y bq• W mtlu. at W .& b meeO.Y 13) lb daft ad= d Idde bAdt4 Y dtdw tomrtb .oD .Nm1 Aw. t»8q d .oam •IW4 b 14) Ub adddJo led% daddW .0IeYaaWne.-1bee4oYdb 7ASlwIYd elC Pp 8I1G126 ~1dmy 4pa:1r(w1eMne1, twG} AAp[.4 .r6W 4w6 l* d bd..rl bd W. _" lo.d , solo 4. 4.mW bw i IA 13) rot Ceagwb &W %d0b ad Q. % m alit bob bem ml bm k*d 0aft 16) r( Inld kr4W o t Onk de tole led e.m (.d b Vd 100 dmM1 17) SA W. n. owrf d .f.»Nb bee. 10) sd. bet. End m " C1d 0.* on j. P., AD 33D wd Ad 3u 10) A4.7.W emri d ni3e..d .eem •reedy ..24 001V) e0we Wd Sd Ooltl.6etar. 1/2' 13R SAFE UPLIFT LOADS FOR 8" PRECAST w/ 2" RECESS DOOR U-LINTELS IAZT-Cl6an SAFE LOAD - POUNDS PER LINEAR FOOT TYPE LENGTH WO-I1 WO- 21 W' 0-1 LKID-21 un4-1 8n4- 21111r16- WIs- 1 022- 118RF26-1 w7z-: une-2 6Nrx-11 ma- 4'-1'. ( 527 PRECAST Ws 166e 2363 3051 3751 5140 600 1668 2362 3086 3751 514E 4'-6' (54' PRECAST 867 104 n72 293f 3W7 4275 4243 607 IW4 m2 2939 3WT 4113 5'-6. (681PRECAST 67$ 1 1797 2321 2Mt 3382 1 3911 675 1269 1 1797 2326 2854 3362 3811 5-10-(701 PRECAST 65s p 225f277! 32e6as 2259 2773 3nC 2791-g 7019W242920)9 3ms7o 19W 2419 2879 197'-6- W)PRCOWit V884 1765 212168s0617R216025' 29689'-8' 1167PRECAST3951222ISIOtest21WJ9513e6 1701 2016 2331 U) THENUMBERSINPARENTHESISARE PERCENT REDUCTIONS FOR GRADE 40 FIELD ADDED REBAR SEE GENERAL NOTE HO. 4 TYPE DESIGNATION J3 I/(711 1 8 •¢ J r - mir9 rm am / e - 190DI[ D 16mwu or was awa r 61" Iff 07 15 ama IS?111'4,, 8F16—lB/IT mum Imi at mm NOW J L W Is 1s Km u W J V SEE SAFE IA1FA4 LOAD mn FOR LOAD RA1NCACII Z WORCED CHO (CMJ) FULL COURSEPR0DurTReNjwED 1 5 RM4R 9.1,:NIf d6lWeAaide - maR60 O t,o IOL (1) no1-1/Y tAEA9 CAI% cWW 1S 6EElt At IDIION Or all m, WW 6t4•t WMM Rm906W Komi) N Wfia 7-5' A011Nr t, 6'NDlmill11L81gym) CRAIGPARRINO 79 SEFFFNNER. FL 33504 PRODUCrI1tIVIS1W 4M 7d7R'B niA m. 1' 8vid. DtWdAewp "IN 14 WDbdbn17Ak 6Z A6 A4 n CamA". nfa- 6: 1 3rtrirT>:.ia r rai rr .ice: 6a[ rnr:1a116ytmr clQli t6vcT:CAST— CRETE 8" LINTEL FABRICATION DETAILS L GT.Ed+rn;7.1>.: raw I errtom &: i• J 6 3C`v.,,1 ' c I.\CAT: r.ials N:7. 4 Ti7Cin rYiZYL? l w..I1'f.i 4lir/l I:l Ttl 11.1: I:YiYId CB MIAM1-DADS l%1lL4 lI-DADECOUNTY PRODUCT CONTROL SECTION DF,PARTl1•IENT OF REGULATORY AND ECONOiNUC RESOURCES (RER) 11805 SW 26 Street, Room 208 BOARD AND CODE ADMIMSTRAT(ON DIVIS(ON Miami, Florida 33175-2474 T (786) 315-2590 F (786) 315-2599 NOTICE OF ACCEPTANCE (NOA) w%nv.mlamidade.eov/cconomv Cast -Crete USA, Inc. P.O. Box 24567 Tampa, Florida 33623 SCOPE: This NOA is being issued tinder the applicable rules and regulations governing the use of construction materials. The documentation submitted has been reviewed and accepted by Miami -Dade County RER Product Control Section to be used in Miami Dade County and other areas where allowed by the Authority Having Jurisdiction AHJ). This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Section (In Miami Dade County) and/or the AHJ (in areas other than Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perfonn in the accepted manner, the manufacturer will incur the expense of such testing and the AHJ may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. RER reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Section that this product or material fails to meet (lie requirements of the applicable building code. This product is approved as described herein, and has been designed to comply with the High Velocity Hurricane Zone of the Florida Building Code. DESCRIPTION: ( Cast -Crete) 4", 6" & 12" High Strength Precast and Prestressed Concrete Lintels APPROVAL DOCUMENT: Drawing No. FD4612, titled "Precast and Prestressed Lintel Details", sheet 1 of 1, prepared by Craig Parrino, P.E., dated March 24, 2003 and Drawing No. LT4612, tilled "Cast -Crete 4", 6" & 12" Lintel Safe Load Tables", sheets 1 through 3 of 3, prepared by Craig Parriuo, P.E., dated March 24, 2003, last revision dated June 12, 2014, all signed and sealed by Craig Pan•ino, P.E., on August 19, 2014, all bearing the Miami -Dade County Product Control Revision stamp with the Notice of Acceptance number and the expiration date by the Miami -Dade County Product Control Section. MISSILE IMPACT RATING: Large and Small Missile Impact Resistant LABELING: Each lintel shall bear a permanent label with the manufacturer's name or logo and the Miami -Dade County logo. RENEWAL of this NOA shall be considered after a renewal application has been filed and there has been no change in the applicable building code negatively affecting the performance of this product. TERMINATION of this NOA will occur after the expiration date or if there has been a revision or change in the materials, use, and/or manufacture of the product or process. Misuse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause for termination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed. by the expiration date may be displayed in advertising literature.. If any portion of the NOA is displayed, than it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall be provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This NOA revises NOA 1113-0321.07 and consists of this page 1, evidence submitted pages-1, E-2 and E-3 as well as approval document mentioned above. The submitted documentation was reviewed by Helmy A. Makar, P.E., M.S. NOA No. 14-0903.03 MIAMI DADE COUNTY `' i = ' Gi'^- Expiration Date: 09/11/2018 MEW f Approval Date: 10/09/2014 Page 1 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 1. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #03-0605.04 A. DRAWINGS 1. Draining A'o. FD4612, tilled "Precast and Prestressed Lintel Details", sheet 1 of 1, prepared by Craig Parrino, P.E., slated Ala•ch 24, 2003 and Drmving A'o. LT4612, titled Cast -Crete 4", 6" & 12" Lintel SOc Load Tables`; sheets I through 3 oj3, prepared bl, Craig Parrino, AE., dated March 24, 2003. last revision #1 dated April 28. 2003 both drawings signed and sealed bl, Craig Parrino, P. E. B. TESTS 1. Test reporl on flemo-al lesting on 4 ", 6" & 12 " Precast Concrete Lintels Filled and Unfilled A/odels, total of (13) concrete lintel specimens, per ASTAI E-529-94, prepared by Applied Research Laboratories, Report No. 30404A, dated 04110103, signed and sealed by Christopher A. Hanlon, P. E. C. CALCULATIONS 1. Calculations for Cast -Crete Lintels, dated 05129103, 209 pages, prepared by Craig Parrino, AE., signed and sealed b>; Craig Parrhuo. P. E. 2, Calculations for Cast -Crete Lintels, dated 05129103, 140 pages, prepared by Craig Parrino. P.E., signed and sealed by Craig Parrino, P.E. D. MATERIAL CERTIFICATION: 1. Quality System Alanual for Cast -Crete Alachine Alatle Precast Lintels revised an 11tuv 1, 2002. 2. Cast -Crete Quality S1,stem Alanual for Prestressed Products dated 2002. 2. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL # 08-0320.09 A. DRAWINGS 1. Drmving No. FD4612, filled "Precast and Prestressed Lintel Details", sheet prepared by Craig Parrino, P.E., dated Alarch 24, 2003 and Draidng No. LT4612, titled Cast -Crete 4", 6" & 12" Lintel Safe Load Tables", sheets 1 through 3 of 3, prepared b1, Craig Parrino, P. E., dated Afarch 24, 2003, last revision dared Alarch 11, 2008. B. TESTS 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. Qy Miam!-Dade Comity Building Code Compliance Office. E. MATERIAL CERTII+ICATIONS 1. A'oue. Hlehfiy A. Maim-, P.E., M.S. Product Control Unit Supervisor NOA No. 14-0903.03 Expiratlon Date: 09/11/2018 Approval Date: 10/09/2014 E-1 Cast -Crete USA, tut. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED ' 3. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL b 12-0209.12 A. DRAWINGS 1. Draining No. FD4612, titled "Precast atul Prestressed Lintel Details'; sheet I vl' 1, prepared by Craig Parrino, P.E., dated March 24, 2003 and Draining No. LT4612, titled "Cast -Crete 4", 6" & 12" Lintel Sq e Load Tables", sheets I through 3 0l'3, prepared by Craig Parrino, P.E., dated klarch 24, 2003, last revision dated Adarch 11, 2008, all signed and sealed by Craig Parrino, P.E., oil rllarch 22, 2012. B. TEST'S 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Xfland-Docle County Department of Permitting, Envlrorrrnew, and Regulatory ,4ffairs. E. MATERIAL CERTIFICATIONS 1. None. F. ' OTHER 1. Leper fr-onr Cast -Crete Corporation, dated February 03, 2012, signed and settled by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2010 Edition. 4. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL # 13-0321.07 A. DRAWINGS 1. None. B. TESTS 1. None. C. CALCULATIONS 1. Atone. D. QUALITY ASSURANCE 1. By A4iarni-Dade County Department of Regulatory and Economic Resources (RER). E. MATERIAL CERTIFICATIONS 1. None. Jj ny A. Makac, P.E., M.S. Product Control Unit Supervisor NOA No. 14-0903.03 Expiration Date: 09/11/2018 Approval Date: 10/09/2014 E-2 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED S. NEW EVIDENCE SUBMITTED A. DRAWINGS 1. Draining No. FD4612, titled "Precast and Prestressed Lintel Details", sheet I of 1, prepared by Craig Parrino, P. &, dated kfarch 24, 2003 and Drawing r\Vo. LT4612, tilled "Cast -Crete 4", 6" & 12" Lintel Safe Load Tables', sheets 1 through 3 of 3, prepared by Craig Parrino, P. E., dieted March 24, 2003, lost revision dated June 12, 2014, all signed and sealer! by Craig P(117'1170, P. E., on August 19, 2014. B. TESTS 1. /None. C. CALCULATIONS 1. Calculations for Cast -Crete Linrels, dated 0811912014, pages 14.201 through 14.236. prepared by Craig Parrino, P.E., signed and sealed by Craig Parrino, P. E. D. QUALITY ASSURANCE 1. By Miand-Dade Cown), Department of Regulaloty and Economic Resorn-ces (RF,R). E. MATERIAL CERTIFICATIONS 1. None. F. OTHER 1. Letter fivta Cast -Crete USA, htc., dated August 19, 2014, signed and sealed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2014 Edition. d z. I wf - .",/"' HelqjPA. lWalcar, P.E., M.S. Product Control Unit Supervisor NOA No. 14-0903.03 Expiration Date: 09/11/2018 Approval Date: (0/0912014 E-3 0 AS7 RE.w HIGH S STRENGTH PRECAST AND PRESTRESSED CONCRETE UNTELS WE •R' TIRRUPS iY E "e4jrIRRRILPS TOP Si 5' 'C' SPACING! S 6' & 12' PRECAST LINTEL REINFORCING CAGE FABRICATION MODEL t• Nr .e, .ulr. yY rn.[•.t / .• Sterty seat Itiln.m r tlr•.r nrtn .• tee- Inm - ISAW I SAS• ,1t 11 r 1 314151le tlr , Ir3r s i w las • n : ee wo ts alv l y N. /O Y0I1 f/lir M tltl t ItY.n •1 V Y.f W A • I/3' ItAt ASp L n Y 11111SS n Mt •.• fil.11M i 4O LO L 31 I . w r t3!' 7 t t Il S 3. 71S w.. ______ _. It' SR[." 11 Ill 4" SOLID LINTEL DATA TABLE r lrJ 1 ji it s,arnur II7Q, i9lJltL:iJ_ amrll>rt?aa 6" PRECAST U—LINTEL DATA TABLE rim®rral F7zL.]^ vno r tituar:a!ic.loelalnn 3 r a©a u ru uruc::.to v®r,Fti•va to rat o r u,l raa rPzrn r va rave-nrrnrn, rmv rs>rmra vatn ia'd rt:Flli i7 r L1 L"J r T9L71S7ttSTila1 r27O rtiag•IiIL_'i 7 it7W."'ry. llrnarlvlm 1^:eraflrM toWrILNrxanrTMjvu-.tlrTargrrif8gi[•mIry rFf_:'.1lrer7m Ite7 r 0 rravr*n TaIt RSaglr,,,o,rtQvrL.7aa rrMilly-!7®W1, illlllfry 7 l rT2mr2nO KnuRr"InMrt»Itnr_rrlu m aoc tu rriTtr_t.ar©tire,I n'[sa'yo o 17" PRFCAST U-LINTEL DATA TABLE Fmi 10 rTII^7 I7III^7 Cd1i r?A to rz uta r}, ,, ",OQ'ia yr uc mama o rant®Pia UCIMEWIO" CmMEvlu pru" rl, rurtLl=J r7QI]rve L' 7 iarMVMI!arla: FA"IMIM Ma t>tM rma inuarta rc rei>s nalma o eregr Tnl©rLa l• SmMiriu; mgi2mt9rlLMrtll?,Ir ill n E o, acrrti mcsa u gr--w illm* rxa7L'Yarto'_L_.7mrtm- mcI r21 mc DaO' cu"- m RILMf t»¢+ nr5aocstu, Fro' 131CMrm rr.:.arruf z ncyrrmentotarra.>_att Q7Li_ImO t]G1u cam im twpzrun St[OSI.AOM rt0t t0 rW FAOWU Attm1AL 0 O MUCa0 R CWTWn LAM AID A:l• M Of 2I0400011Cto 01 0mmoao t01.,It ra 1WS *W= Comm "UJ Klt ICL SO. I. SO0300 MCU" W AM SSIL SL 34. AM 33 AOD Stm10 SLptlb S "IS It 01W MASS . SIAS tL IWtMAM "IS L OM m IWK I M/D MW9M DO.IrD YC {011 IX WM W L mMDSR SOOr3SA r. . me m OffW 1 YO DtD ACISSWnmODoWbitAaSSOCAW 103 CUXAS - XL W tmum wmu% r.. no PIN too • / IN= S,OaSS . L ram IK t0aufs Ott IASAtSMSS IImR two L SW,SM SaLL OWL m CIA MCI ONMM TO IIAN t,C. t" 1 cultum I'm dial O. 0 S AM I, 00 WAILS AITU ttlrttD M" fCft CEN' • O: 0. 4 o' . c IP%p• a' CRWC PARRWO FL SEPNLIC.NO. PRECAST AND PRESTRES pRanut-i" ttty FlrlaA p, JIdiIC OMI I4 o c ,o'j Acupla"+ pglmt;" nlnu 1$ n LINTEL DETAILS SWL• AS Sr01! wimI0: roalt mn 10r I GENERAL No1ES 1) Yaublr: ft 4' Nuod fAW . XM rd ra 1' a IY p 4 Idd 6000 fa pod . ]etle pd .6(p n wman ndl asmpprrpydd. atlnb mnenY d 0b Cf0 s0fi-s5•eao td FA e.fyr.tla. IS Q . D pdadsfaASSsets " 9tnabrpaA57YQ70qpaY a 5 2) M set. bd Wdm .aloe m mi Wn 4 iedf maid eluYy L1afta ai'raae a 2G[ Yperab 1m gNlb in. 14m a I/2 iafka 3) ft." M 11ltla Nd ad lead }Ma 4) 1h. M~ N pasa•mb Yoko on WWI f *Xzm W Web 40 SM a/dd tetrt. tea w/ 142 ft&KUm 1 11442am'4ee) * ILI 0114 S) AIe s =aJT AbM anuchommdWI0dkc%k Ik. b Nita b mMrmm me 1M Ham a:•/fq Coda Sali.a IM 43.1 m g7M61a. 0) 9ws Mod bleb a .Pa 7) 4' Idd Odob b Oo ieketd 1/ 4' dm obl IodfmW od e dYamlm VWCIa e) l•td iob%ueda.I t a Gad mud _" sib w ordrmnrvl ad/a ffneawl aonlmdf a) aOdoddmp ftmmoloom muting mqmwAtAAv4tlbc1dd--vM fim W Nee a mrpo t 10) 11.R• • IN Rcl.d 11) alarm raw add taoa b 1e bald at the bod" of td Idd ado. TWr OFCICNAMON r . Alto .t awn / • . ttacw 1 oralita"dm° 12F16-2B/2T M C4 Qjmawe no w um p) amoto to C •1•a N •, OA cm r 1, J: •y 1 O Ili W.mll p N 1I' taut lq m®tw .• 11ab! III 3YV ACIWL lood000ltmaa um 12) Y a fY uaeb an 1mN•clad wU S-1/Y IYq ..tAu d Ine [1tdl b oardmhb vodka [d .IiNtaq od ped,q 13) 1E. s low adm. a Gd.b istew k .dads a•e.b mmlrry .ob IId acre em" of den Opow fa =N mm an am C-M a aka appo.d aN 4 la) udYs MWd riMaieemb 12a fad (arwlf ar ceflll m/ Nam•W bads d•dd M d•ad w ft anYnd-beCM r/J6 ba (abdq Apple• w1Gm1 bee "M • rLwm bad Sal urftkd boo + Sa. 1•t im" bd i ID IS) fw fatnfedo NO WIWI at dm% we sop bd dam ad b.a MW Ittml 16) fir row wqw ad dm% ta..aa bed low ned fmprd fmpn Ibo1 17) We Loeb m. wpaNpod ab.atl. be" 12) Sae bob t.ud ss rdbal daipt wdlpb pa AD S7erapnd AO 71a 19) raOddlimal ivddm bbad= uda (epAQ .1-I Ile I.It Sod ftl A M... SEESAFE UIEPAL WN IAMB FOR WAD RATING FOR EACH ADD RER4r=D CMU (ROM FULL OD11RSE r. 1) 15 RF&R FOR C ITNIELS 1/2, 12) 15 FEW FOR 12LINTELS CR40 or GR60 SAFE LOADS FOR 4" SOLID LINTELS 4w 444ln GRAVITY LENGTH TYPE 4S8 3•- 6' ( 421 PRECAST 1180 4'-W (481 PRECAST 959 4'-6' (541 PRECAST 789 5'-10'(701 PRECAST 460 6'-6- (7n PRECAST 360 7'-6- (901 PRECAST 260 9'-4' (112' PRECAST 156 10'-6'(1261 PRECAST 116 12UB 4-4- UPLIFT LATERAL TYPE LENGTH 4S8 4S8 3'-C (421 PRECAST 687 371 4'-0' (481 PRECAST 597 320 4'-6- (541 PRECAST 529 258 5'-IW(701 PRECAST 407 148 6'-C (787 PRECAST 366 118 7'-6- (901 PRECAST 280 87 9'-4- (1121 PRECAST 187 55 10'-6'(1261 PRECAST 152 43 12FB 12F12 12F16 6U8 6F8 6F12 6F16 "W Y..1 1 •: J.i.i: 4 tom! ;:. '+Ct •" '. :+ 1it: t, .; tip.. •. S:): :•!: 4S8 9 • 12F28 12F24 12F20 rit0OUC1'10iY1Sl;n ST T F' UtYI oiN •aitA fArFlafda Aeaytrdca AU /Q• - o O . o 1 • 0' p /_%: : MAJGPAMNpOR Sn 0tD1n17wrrza le 6F32 6F28 6F24 6F20 ''•,`;S'/...... p ;G.` aI 4EN9YRw . CAST- CRETE 4", 6" & 12" LINTEL SAFE LOAD TABLES M MYL NAS A14 /06ME-in 54 11 Swo 1 Of 3 SAFE GRAVITY LOADS FOR 6" PRECAST U-LINTELS Cwar-cmw SAFE LOAD - POUNDS PER LINEAR FOOT TYPE LTH ENGKO 6F8-10 6F12-16 6F16-10 6120-18 6F24-10 6F28-18 6F32-16 3'- 6- (421 PRECAST 2332 2676 3892 5050 6148 7227 8297 9357 4'- 0' (481 PRECAST 2025 2313 3892 5050 6148 7227 8297 9357 4'- 6' (541 PRECAST 1654 1887 3633 5050 6148 7227 7 5'- 10'(701 PRECAST 1067 1260 2198 3557 5734 7227 5 6'- 6' (781 PRECAST 949 1078 1831 2850 4328 6737 7 r- 6- (90l PRECAST 779 883 1459 2188 3151 4524 7 9'- 4' (1121 PRECAST 584 660 1056 1523 2084 2795 7 24923163 10'- 6'(12n PRECAST 503 566 895 1270 1706 2236 7 11'- 4'(136') PRECAST 457 513 805 1133 1507 1952 312'- O'(1441 PRECAST 425 477 744 1042 1377 1769 8 13'- 4'(1601 PRECAST 373 417 646 895 1170 1485 1852 2285 14'- 6'(1681 PRECAST w 392 60S 835 1087 1373 1703 2087 17'- 4'(2081 PRECAST put 299 455 620 794 985 1195 1437 1) THE NUMBERS IN PARENTHESIS ARE PERCENT REDUCTIONS FOR GRACE 40 FIELD ADDED REBAR SEE GENERAL NOTE NO. 4 SEE GENERAL NOTES - SHEET 1 OF 3 1 ew,ffin.rs. SAFE LATERALLOADS CAD 0 oaccecT al IMx1 c C E SAFE LOAD PLF LENGTH TYPE 6UB 6F8 RCM Y- 6' (421 PRECAST 587 1055 596 4'- 0' (481 PRECAST 487 787 445 4'- 6' (541 PRECAST 416 609 344 5'- 10'(701 PRECAST 300 350 198 B- S' (7BJ PRECAST 263 496 157 T- 6' (90') PRECAST 222 367 116 9'- 4' (1121 PRECAST 173 352 74 10'- 6'(126) PRECAST 151 276 58 11'- 4-(136) PRECAST 139 311 49 12'- U'(1441 PRECAST 131 277 44 13'- 4' (160`) PRECAST 117 223 35 14'- O'(168j PRECAST 111 202 32 17'- 4-(2081 PRESTRESSEO N.R. 130 21 SEE GENERAL NOTE 18 1 0", cmm.. @ n Row, - - I .. SAFE UPLIFT LOADS FOR 6' PRECAST U-LINTELS 4 — 9.4- 16 SAFE LOAD - POUNDS PER LINEAR FOOT LENGTH TYPE 6m-I1 m2-116n6-11 6F20-17 6F24-1T 6128-116F32-11 Y- 6' (421 PRECAST 1412 2074 1 2715 3356 3997 469 5279 4'- 0' (i81 PRECAST 1225 1800 2357 2913 3470 4027 4583 4'- 6' (54) PRECAST 1083 1592 2084 2577 3069 3562 4055 5'- 10'(701 PRECAST 831 1222 1600 1579 2357 2736 3114 6'- B' (781 PRECAST 723 1097 1437 ro 1777 2117 2457 2797 r- 6- (901 PRECAST 648 803. 1249 1544. 1840 m 2135 ro 2431 9'- 4- (1121 PRECAST 575 57100 98D 1252 SK 1492 IN 1732 1972 10'- 6'(1261 PRECAST 514 462m 787 1121 1336 W. 1766 11'- 4*(1367 PRECAST 474 404 85 a 985 aj 1213 1442 1645 1Y- O'(1441 PRECAST 454 367 1 619 of 885 1093 1299 1506 IT- 4'(1B0') PRECAST 402 308 516 736 9D6 1076 18 1247 14'- 0-(1681 PRECAST 363 285 475 fm 677 832 to 989 1145 LR 17'- 4'(2087 PRECAST 253 208 32 476 585 693 j 803 1) THE NUMBERS IN PARENMESIS ARE PERCE141 REOlIC1IONS FOR CRADE 40 FIELD ADDED REBAR. SEE CENERAL NOTE NO. 4 PA.,,,,•, G ,.•• ENS 44 FRODUCr118V,Y6D 1k • . i I"IIIs cw. Mi1111IM wid, V. qRl At* roc1.a. TgFy.,: CRAIGPARRINO h '"" D+fii^` ^ Ze, P 11; 07ONAIE;:G•• SEFPN Rs3358o Ulm FL. P.E MNO.44766 CAST- CRETE 4", 6" & 12" LINTEL SAFE LOAD TAB SAFE GRAVITY LOADS FOR 12" PRECAST U-LINTELS w"cwmr SAFE LOAD - POUNDS PER LINEAR FOOT LENGTH TYPE 12UB I2i8-28I2F12-20IV16-20IM-21IV24-21IV2D-2612M-29 Y-6- (421 PRECA51 3428 5000 5638 7619 9352 11060 12755 14438 e-e (481 PRECAST 2923 4232 5838 7619 9352 11060 12755 14439 4'-6' (541 PRECAST 2396 3464 5304 7619 9352 11060 12755 14438 5'-10'(701 PRECAST 1612 2320 3218 52M 9487 11060 12755 144344 6'-6' (781 PRECAST 1383 1986 2679 4196 6421 10032 12755 144 7'4- (901 PRECAST 1138 1628 2131 3218 4678 6756 9763 135 9'-4- (1121 PRECAST 795 1216 1535 223D 3083 4167 5593 7552 10'-6'(1261 PRECAST 614 1043 1295 ISM 2516 3323 4334 5632 11'-4'(1361 PRECAST 518 945 1162 1649 2216 2893 3719 474 12'-C(1441 PRECAST 456 878 1073 1 1513 2D20 12617 1 Mn 4205 13'-4-(1607 PRECAST 359 767 926 1294 1709 2188 2743 3409 14'-O'(1681 PRECAST 321 720 865 1204 1554 2017 2451 3106 17--4-(2081 PRECAST N.R. 4511, 6314 881, 1141 14280 1750 2102 19'-4' (2321 PRECAST N.R. 343 4, 477 4 700,j 925 1152 138D 1609 In TIE MOKK 91 IAUMNESIS ARE F(JW4 RIDXnM Wlt OM 40 FIELD AWED REAAR. SEE Ct/E1tAl NOR N0. 4 SAFE GRAVITY LOADS FOR 12" PRECAST w/ 2" RECESS DOOR U.LINTELS 4mm-*,am SAFE LOAD - POUNDS PER LINEAR FOOT LENGTH TYPE IM IM6411121FI0- ttldt4- M 129f22- 12tl26 Y1Af70- 4'-4' (521 PRECAST 252 2942 5468 7564 9640 11669 13679 15679 4'-6' (54') PRECAST 2319 2740 5468 7584 9640 11669 13679 15679 5'-B' (681 PRECAST 1347 1541 3555 8395 9640 11669 13679 1 V-10'(701 PRECAST 1259 1758 3361 5954 93% 11669 13679 156 6'-8' (801 PRECAST 924 1430 2633 4415 6884 1 1257 148oq 7'-6- (9n PRECAST 703 1203 2157 3494 525 I 7922 9623 1132 9'-8' (Iw) PRECAST 369 843 1451 2157 3203 4427, 541749 6380 ti) of NY1 om If mu"am AIu ro¢uo guxcn Ala !m CM 40 FIELD Amin AMWt SEE CENTRAL OTE W 4 FDIA 11• DFlFI'ABT III IAISFI R Cam/ SAFE LOAD PLF LENGTH TYPE 12US 12FO RCNU 3'-6- (421 PRECAST 1295 4041 393 481 PRECAST 1295 4841 299 4'-C (541 PRECAST 1049 3922 2417 5'-10'(701 PRECAST 681 2547 155 6'-6- (76') PRECAST 579 2167 123 Y-C (90-) PRECAST 474 1771 914' V-4- (f 121 PRECAST 355 1326 58004 10'-C(126') PRECAST 306 1143 45400 I1'-4-(1361 PRECAST 278 1041 38 12'-C(144' PRECAST 260 971 34 13'-4- (1$01 PRECAST 229 857 278 14'-D'(1681 PRECAST 216, 009 251 17'-4' (208) PRESTRESSED N.R. 63 167,9 19'-4'(2321 PRESTRESSED N.R. 1 534j 130 LL Ut.KtKILL IWIL 10 SAFE LATERAL LOADS FOR SAFE UPLIFT LOADS FOR 12" PRECAST U-LINTELS 4mm-4--ft SAFE LOAD - POUNDS PER LINEAR FOOT LENGTH TYPE IM-21 12F12-2112FIS-21IV20-2112124-1112128-211932-21 Y-6- (421 PRECAST 2752 4287 5613 6938 8264 9589 10915 4'-C' (451 PRECAST 2389 3721 4872 6023 7174 8325 9477 4'-C (541 PRECAST 2113 3291 4310 5328 6347 7365 8384 5'-le(701 PRECAST 1623 2527 3310 4092 4875 5658 6441 6'-6' (78-) PRECAST 1444 2269 2972 3675 4378 5081 5784 7'-6- (901 PRECAST 1267.j 1767.125M.1 3194.j 38061tl 4417 5028 T-4' (1121 PRECAST 1028 117 2006 2590 W 3563 4079 10'-C(126) PRECAST 920 947 1612 228t 2764 3209 3653 I1'-4-(1361 PRECAST 858 829 1404 1982 2441IN12'-W(1441 PRECAST 814 753 1269f 1788 220113'-4-(16C) PRECAST 678 633 1057 1485 182614'-O'(16C) PRECAST 622 566 974 1365 1679174'(2087 PRECAST 434 427 695 964 1182IT-4'(232) PRECAST 366 370 593 817 D 1002 U) In mwm Im PA4UIDESS Au Rmw OmUC1101a mR MDE 40 FIELD ADDED IE&IL SEE MMk NOR IA 4 SAFE UPLIFT LOADS FOR 12" PRECAST w/ 2" RECESS DOOR U•LINTELS 4 W-t- n I SAFE LOAD - POUNDS PER LINEAR FOOT 4'-4- (521 PRECAST 1295 3692 2 4'-4' (521 PRECAST 1626 126M 13746 4'-6', (541 PRECAST 1213 3458 2417 4'-C (541 PRECAST 1558 2582 3602 5!-e (691 PRECAST 784 2236 165 5'-C (68) PRECAST 1210 2042 2850 5'-10'(707 PRECAST 747 2129 155 5'-10'(707 PRECAST 1173 1984 2769 6'-8' (001 PRECAST 602 1716 117 6'-11 (101 PRECAST 1020 1538 2426 T-C (901 PRECAST 504 1438 91404 7'-6' (W) PRECAST 904 1226 2163 V-8' (116) PRECAST 355 1011 4 " A;8' (1161 PRECAST 1 703,j 771 11472, 4. NIN1U6 N fAAfNDE56 ARE PU:iN1 NCOOLIG6 (OR G • ENS ' 40 Ftt1D ADDED IEM0. SU CEM AL )IDR NA 4 447 r I. SEE GENERAL NOTES - SHEET 1 OF 3 m0weR or wm. FRODucruvise•D b culTlyfnNwilh Nk 11"i-Is Du4di.S Llode 9=0-0 I" c e o 3 F• CRMCR579O l9gsjboo o/8 fRG\C,, Cl24CR519 MImNOmde ue y`v SETt•14Ead,A 3351T4 i is%$ FI.P.EFLT6 N0.AA756 CAST—CRETE 4", 6" & 12" LINTEL SAFE LOAD TAB ME IIANI: nsI¢)-u aun 4r _ auN waw seALt Nu COL. 4/I4/DA 0=110 m CHID AMMO. fl. - 4EG ID. u/x OAAUQm 1.14111 SSm J M IAM bDADE MIAMI-DADE COUNTY PRODUCT CONTROL SECTION DEPARTMENT OF REGULATORY AND ECONOMIC RESOURCES (RER) 11805 SW 26 Street, Room 208 BOARD AND CODE ADMINISTRATION DIVISION Miami, Florida 33175-2474 T (786) 315-2590 F (786) 315-2599 NOTICE OF ACCEPTANCE (NOA) www.miamidade.gov/economy Cast -Crete USA, Inc. P.O. Box 24567 Tampa, Florida 33623 SCOPE: This NOA is being issued under the applicable rules and regulations governing'the use of construction materials. The documentation submitted has been reviewed and accepted by Miami -Dade County RER- Product Control Section to be used in Miami Dade County and other areas where allowed by the Authority Having Jurisdiction This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Section (In Miami Dade County) and/or the AHJ (in areas other than Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perform in the accepted manner, the manufacturer will incur the expense of such testing and the AHJ may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. RER reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Section that this product or material fails to meet the requirements of the applicable building code. This product is approved as described herein, and has been designed to comply with the High Velocity Hurricane Zone of the Florida Building Code. DESCRIPTION: "Cast -Crete" 8 inch High Strength Precast and Pre -stressed Concrete Lintels APPROVAL DOCUMENT: Drawing No. FD8, titled "Cast -Crete 8" Lintel- Fabrication Details", sheets 1 through 3 of 3, prepared by Craig Parrino, P.E., dated June 7, 1996, last revision dated June 12, 2014, signed and sealed by Craig Panitro, P.E., on August 19, 2014, bearing the Miami -Dade County Product Control Renewal stamp with the Notice of Acceptance number and the expiration date by the Miami -Dade County Product Control Section. MISSILE IMPACT RATING: Large and Small Missile Impact Resistant LABELING: Each lintel shall bear a permanent label with the manufacturer's name or logo and the Miami -Dade County logo. RENEWAL of this NOA shall be considered after a renewal application has been filed and there has been no change in the applicable building code negatively affecting the performance of this product. TERMINATION of this NOA will occur'after the expiration date or if there has been a revision or change in the materials, use, and/or manufacture of the product or process. Misuse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause .for termination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed by the expiration date may be displayed in advertising literature. If any portion of the NOA is displayed, then it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall bo provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This NOA renews NOA H 14-0903.02 and consists of this page 1, evidence submitted pages E-1, E-2, E-3, E-4, & E-5 as well as approval document mentioned above. The submitted documentation was reviewed by H, f Itny A. Makar, P.E., M.S. L1 NOA No. 16-0126.03 MIAMMADE COUNTY /' Expiration Date: 05/21/2017 Approval Date: 04/28/2016 0 4A Page 1 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 1. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #96-0613.01 A. DRAWINGS 1. Drawing No. FD8, titled "Cast -Crete 8" Lintel Fabrication Details", prepared by Craig Parrino, P.E., dated 06107196, revision #1 dated 11/08196, sheet I of 1, and Drawing No. LT8, titled "Cast -Crete 8"Lintel Safe Load Tables", prepared by Craig Parrino, P. E, dated 0610 719 7, revision #4 dated 04128198, sheet 1 of 1, both drawings signed and sealed by Craig Parrino, P. E. B. TESTS 1. Test report on flexural testing on Precast and Pre -stressed Concrete Lintels Filled Models, total of (36) concrete lintel specimens, per ASTME-529-94, prepared by Applied Research Laboratories, Report No. 29702B, dated 07130197, signed and sealed by Christopher A. Ramon, P. E. C.• CALCULATIONS 1. Calculationsfor Cast -Crete 8-inch Lintels, dated 06106196. 349 pages, prepared by Craig Parrino, P. E., signed and sealed by Craig Parrino, P. E. 2. Calculations for Cast -Crete 8-inch Lintels, dated 11111196, •45 pages, prepared by Craig Parrino, P. E., signed and sealed by Craig Parrino, P. E. D. MATERIAL CERTIFICATIONS 1. Mill Certified Inspection Report Silo #4 dated April 1996 for cement by Southdown Brooksville Cement Laboratory. 2. Mill Certified Inspection Report #20-8275 dated 06120195 for pre stressing strand by The Crispin Company. 3. Mill Certified Inspection Report 420-8345 dated 11/13195 for pre -stressing strand by The Crispin Company. 4. Mill Certified Inspection Report 42111-078240 dated 04125196 for #3 rebar by Ameristeel. S. Mill Certified Inspection Report #84-M19614 dated 02129196for #5 rebar by Birmingham Steel Corp. 6. Mill Certified Inspection Report 958-A66332 dated 01128196 for #4 rebar by Birmingham Steel Corp. 7. Mill Certified Inspection Report #84-M20749 dated 04105196for #5 rebar by Birmingham Steel Corp. 8. Mill Certified Inspection Report #84 M19805 dated 03106196 for #4 rebar by Birmingham Steel Corp. 9. Mill Certified Inspection Report #84-M21208 dated 04121196 for• #4 rebar by Birmingham: Steel Corp. 10. Mill Certified Inspection Report #84-M20652 dated 04103196 for ##5 rebar by Birmingham Steel Corp. 4. & 41d ny A. Makar, P.E., M.S. Produc ontrol Section Supervisor NOA No. 16-0126.03 Expiration Date: 05/21/2017 Approval Date: 04/28/2016 E- 1 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 11. Mill Certified Inspection Report #84-M20749 dated 04105196for #S rebar by Birmingham Steel Corp. 12. Quality Control Manual for Cast -Crete Machine Made Precast Lintels dated 05114196. 13. Quality Control Manual for Pre -stressed Products dated 03120195. 2.. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #01-0209.03 A. DRAWINGS 1. . • None. B. TESTS 1. None. C. CALCULATIONS 1. None. D. MATERIAL CERTIFICATIONS 1. None. 3. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL # 03-0605.05 A. DRAWINGS: 1. Drawing No. FD8, titled "Cast -Crete 8" Lintel Fabrication Details", sheet I of 1, prepared by Craig Parrino, P.E., dated June 7, 1996, revision #2 dated January 28, 2003, and Drawing No. LT8, titled "Cast -Crete 8" Lintel Safe Load Tables". sheets 1 & 2 of 2, prepared by Craig Parrino, P.E., dated June 7, 1996, revision #5 dated March 24, 2003, all drawings are signed and sealed'by Craig Parrino, P.E. B. TESTS: 1. Test report on flexural testing on Precast Concrete Lintels Filled Models, total of 12) concrete lintel specimens, per ASTME-S29-94, prepared by Applied Research Laboratories, Report No. 30404B, dated 04123103, signed and sealed by Christopher A. Hamon, P.E. C. CALCULATIONS: 1. Calculations for Cast -Crete High Strength Precast and Pre stressed 8-inch Lintels, dated May 29, 2003, sheets 1.1 through 1.493 and 2.1 through 2.336, prepared by Craig Parrino, P.E., signed and sealed by Craig Parrino, P.E. D. MATERIAL CERTIFICATION: 1. Quality System Manual for Cast -Crete Machine Made Precast Lintels revised on May 01, 2002. 2. Cast -Crete Quality System Manual for Pre -stressed Products dated 2002. r - wze:: ny A. Makar, P.E., M.S. Product Control Section Supervisor NOA No. 16-0126.03 Expiration Date: 05/21/2017 Approval Date: 04/28/2016 E-2 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 4. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #06-0222.01 A. DRAWINGS 1. Drawing No. FD8, titled "Cast -Crete 8" Lintel Fabrication Details", sheets I through 3 of 3, prepared by Craig Parrino, P.E., dated June 7, 1996, last revision dated February 17, 2006, signed and sealed by Craig Parrino, P.E. B. TESTS 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Miami -Dade Building Code Compliance Office. E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter from Cast -Crete Corporation, dated 0212012006, signed by Craig Parrino, P. E. 5. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL # 11-0121.04 A. DRAWINGS 1. None. B. TESTS 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Miami -Dade Building and Neighborhood Compliance Department (BNC). E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter from Cast -Crete Corporation, dated January 18, 2011, signed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2007 Edition. H A. Makar, P.E., M.S. Product Control Section Supervisor NOA No. 16-0126.03 Expiration Dale: 05/21/2017 Approval Date: 04/28/2016 E-3 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 6. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL 012-0209.13 A. DRAWINGS 1. Drawing No. FD8, titled "Cast -Crete 8"Lintel Fabrication Details'; sheets I through 3 of 3, prepared by Craig Parrino, P.E., dated June 7, 1996, last revision dated February 17, 2006, signed and sealed by Craig Parrino, P.E., on March 22, 2012. B. TESTS 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Miami -Dade County Department of Permitting Environment, and Regulatory Affairs. E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter from Cast -Crete Corporation, dated 0210312012, signed and sealed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2010 Edition. 7. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL i#14-0903.02 A. DRAWINGS 1. Drawing No. FD8, titled "Cast -Crete 8"Lintel Fabrication Details", sheets 1 through 3 of 3, prepared by Craig Parrino, P. E., dated June 7, 1996, last revision dated June 12, 2014, signed and sealed by Craig Parrino, P.E., on August 19, 2014. B. TESTS 1. None. C. CALCULATIONS 1. Calculations for I4igh Strength Precast and Pre -stressed 8-inch Lintels, dated August 19, 2014, sheets 14.101 through 14.124, prepared, signed, sealed by Craig Parrino, P.E. D. " QUALITY ASSURANCE 1. By Miami -Dade County Department of Regulatory and Economic Resources (PER). E. MATERIAL CERTIFICATION ' 1. None. F. OTHER 1. Letter from Cast -Crete USA, Inc., dated August 19, 2014, Signed and sealed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2014 Edition. He A. Makar, P.E., M.S. Product Con(eol Section Supervisor NOA No. 16-0126.03 Expiration Date: 05/21/2017 Approval Date: 04/28/2016 E-4 Cast -Crete USA, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 8. NEW EVIDENCE SUBMITTED A. DRAWINGS 1. None. B. TESTS 1. None. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. By Miami -Dade County Department of Regulatory and Economic Resources (RER). E. MATERIAL CERTIFICATION 1. None. F. OTHER 1. Letter from Cast -Crete USA, Inc., dated January 13, 2016, signed and sealed by Craig Parrino, P.E., certifying compliance with the Florida Building Code, 2014 Edition. wzz'e-- HqLWA. Makar, P.E., M.S. Product Control Section Supervisor NOA No. 16-0126.03 Expiration Date: 05/21/2017 Approval Date: 04/28/2016 E-5 r 'I 4CAV HIGH STRENGTH PRECAST AND PRESTRESSED CONCRETE LINTELS tMtODUCT RC•NEWED a ao mfgh7 At.dlb w rlmrb ewdrAt C01e Accept— E* Iim. Dm. 1n t coned ETYPE " A- STIRRUPS 7 32"/ BA M TIRRUPS 6 1 - 8 LINTEW STIRRUP DETAILS 8" PR Vo6YCV II s;A%;o MD M10,134 U2 7 7 32 4 -1 O - 0.140 ba7 1-3 32 MAR Ib- O.Isa M 7 32 7 MAR7-2 4oS-r 0 41 1a-2 4 e 4 -: I O.IH 7a7= 7/32 JAR 21'-2- O r-A 3/4- 10 amo SIt 13 07/32 MAR r1--10- b O s•-fo 3 to I Y21! Ia5 7/32 OAR 23•-IO- t O 4'-3 1/r 1011- 8" PRECAST W/ 2" RECESS DOOR U-LINTEL DATA TABLE Y•Il<irr Si7Mi,,:ia!]:L7li1t•Tr"4slr iY': IaT.Y'i1 R4!wL. gY:YhIL Hahn ERMEM vim 111D rmo EffEr©atau:ar 1, rryrrt roalr[.err+Iular anl:e tr err ao, r nra tl l c3r u arsa::l.:anr i]e:,ar r r e russ::nRse r ocA v 03 . PRECAST U-LINTEL DATA TA13LE ti t•Ti Tr:i Ll:lil1 2:1_l:l. ram®gym®rn o R•2T1flflQl.'lL! Da:.:ld 3i.700 rr nl-n®rzmrt r mo QII 7 tall rya m>r fFla.:l lnali F]I tt7 rnmlilEstKuRrammo CFI[f,C]it ME MRM OARf MIM01AIMM 12 MROMED M M000CT MM11oVAt. R jaNTWEe n COMt NT ME AND WMDI ME KPF UMO M 00111MED IAIm" IBM MOM MO11I11 COMM Of CASt-CKIE USA, am. t. MRNOMDA*SiDL' 7/S7 AM A31M A510, A 04, D. 10011- /NS IOIM MWft% 01 S7IMIIH AM /S MMn 0MM 40 ASIY MIS, 7/I6 utll FU MD O WOMEN SWIM WOO CAM o1AMD0 170CS1 %W-MA1A M fSCSTIMS 10 CMD 0C iM SOSFOM= C14t, fob CL1011 S11ASD ASIY MIL - Ma Of IMMM " 4. IM IM11 SORMRf f. CMtKtC SlmMmle: f.. 4ow MSl fall S- SdfM all WE1 06 SKU I 1 lQS1MSSum16t2t f. - 40M M fM ALL FXrA EACR DO. molt S nlpl UWy, k !d FOUO3 Of p"TraofruME rmu Mfa S. M11K M 1111flS FORM . Rio ON. a•Yo. M cnmm khy K Wall) at UCU ar rac3Mssto tmt Muromm CADE 4..sm M0 , KCL EMEMto .Etril UnM AIM MU01a10 1`010M f E N S :, tvtoouct trv'm31;n j MmRtPlyiq. u7llwFI,v1O! F" • Af ieAnn No o oT.o2. 0 * Ikx U4u2let6 3s.E CRAIO PARPoWO y A• c 90 C.` am CR S" i Ud n 1muC u1" t'``ss,! ONAL fcN;.'4, I'L. P.E LIC. q0. 447S8 TYr'l\ l I[•1[[rN•,LL'>iI:119t .1111r asYt fYaa'lI F..zSiUt.]Ktlrt.IPllal1LLulR aaly7n'a>lE;';[.)l_nt;I t 7 rin:rIr[[ aIbanf E4.;',..-;•,r a DETAILS r- SAFE GRAVITY LOADS FOR 8" PRECASTwl2" RECESS DODR U-LINTELS 4-4-10" SAFE LOAD - POUNDS PER LINEAR FOOT TYPE1 LENGTH ITRU6 e9rs ao 41:1 MIT1 4-00 9fill- a OM eMMIll ear3o-M 6lrs IB sslo-te mm4-fll 69r16-1ll wn-la e6126-IB MO -ill 4'-4' (521 PRECAST ion1749 3155 2604340 5421 6493 760 1611 J6S9 9D6 60! ISMf47! 10693 4'- G' S4 PRCGAST 1494 1596 300 2993 3062 4940 924 6904 1750 3699 5M Un 8060 9479 10093 5 - e- (68") PRECAST 866 22D IM 1716 2277 2839 3402 3956 1167 2401 4567 081 7917 1311 5- 10'(707 PRECAST 810659 1653 1600 2124 2649 174 3700 1113 230 4242 86"A 1101100 74021. 8703 6- 8- (801 PRECAST 797 901 1825 3120 SO" 7747 f148 7360 201 IN$ 3120 SIM 7115 l419 1 7'- 6' (9D j PRECAST g 7A 1490 24% 3?n 5743 7239 W23 5s N90 2459 3n6 n43 699 foe! 9'- 0' (1167 PRECAST 411 466 999 1365 229 3129 4001 3146 526 9!! 1360 2251 3129 4I50 ass 1) TK FIELD ADDED REBAR SEE GENERAALL ROTENq PMW REDUCTIONS FOR GRADE 40 GENERAL NOTES 11 14W414: to C p ocast RM - 40ro pd re pakbaN iMa1 - UM VolraRf - 30ro & abLO . BAD" d°in s1 ra o 190D 1d room pu ASW NU do M at M SN Ofi I..N i 1pMa270 M mb fa 2) At ado kd bMr bud . delaan 4 kd, mrbd beaAq EII065 ) [iBN f k61N6 d to 3) Radm b• w u Od ar mad OWL 4) The Mies % b *d,% Joe petal t. ,dk. too E1sA3: i/ Ist%el/l" 164at ww0 ti pnw5) alaoft MtA a m Told 48 IT-/' ad kaqu nenh IW b WIM W aMkr mr.B,p IM Mib Is"* Cab Ba94b 160"1 0 ip9:se0r Shwe am 11deb a tovat 7) On 17 roboo mar to ma-Mo100 1r fao A leapt ID b f dlaehd old W mal cw* TA Ito 4RA2rt.'Id 8) wjv.00bg vw mama loy mmeda anddw d lay k eeoaoksa du1pkL 10) Ilk - Rd odd 11) 00 m MM adbl idoo le 4 kaW d 0. Mom .1 W. Ldd $.*. SAFE LATERAL LOADS FOR A" p11112I`A41' and 2" NFPM eeea U.L123MA Rm 1 SAFE LOAD PLFLENGTH TYPE 8RU6 8RF6 RC1dU 4'-4' (521 PRECAST 758 757 1164 4'-6' (541 PRECAST 694 691 1073 5'-8' (6n PRECAST 408 407 655 V-10'(701 PRECAST 382 381 616 6'-8' (OD-) PRECAST 595 788 464 7'-6' (901 PRECAST 09 674 363 1161 PRECAST 370 490 1 214 a SEE CENERAL NOTE 15 12) uMoo .W' 1a1 5-1./Y I" notew d Od uW 16 m•erW 13) fY we& swum d Mob imb9d k tddlr womb 9chub Mhoot M0* Il) Iblb loam! d0 , Inist ulk Bla w aa.iedliad.9"a66IAa h1ud A oia kab ddl r ld t4aikaAIphd -SSW WI Aodrb.dd kad We Mod load , sdo ha bvft bad 15) rot aff"o A Odd Wgtb • d 4bo4 w Sib 111• him pad loom aipM era. 16) rat tale) k1y9d ad dmA .L ado land rm 0ao1 IoM&d %MP MA 17) Sao look ro auWxfud 45.4b boA t8) $do bah b16d a• a9asi dWp 41d1N w kAD W aid aAr11 ItK) o.urni r1:. eaa U: eeltl. Sado1Wbdal0AQmdWdf&MNd 1/2' CLR SAFE UPLIFTLOADSFOR 8" PRECAST w/ 2" RECESS DOOR U-LINTELS CAi7 A41T• SAFE LOAD - POUNDS PER LINEAR FOOT TYPE LENGTH eue a e91e-21 elrlo 1 e6rto- 21 69ru- 1 eer14- 21 exne- 1 wse- 2i elm- n cAn2- 21 9nc- I e6171- 21 avlo- n W30- Il 4'- 4' (52? PRECAST905 16U 2352 MI 37SI 4445 5140 903 INS 2362 3058 3751 4443 140 4'-6' (54') PRECAST Bn 1604 2277 29D 3607 42)5 4943 e07 ISM 22n 2429 3607 4275 4943 5'-8- (66") PRECAST 75 1AA 2326 MS4 3M 3911 075 12D 1797 2316 2854 Slot 3911 5'-10-(70r) PRECAST 655 1207 174 2259 2773 3266 2N9 6% 123 11746 2259 32S 2799 6,- 8' (60') PRECAST 570 929 I530 1M nit 3329Sm Imo 15A 19t0 2879 33297-6` 907PRECAST506712INH 1ns242-jot 2567 2968soi e!e 1364 u65 25e7 2l689'-8'(1161 PRECAST N7 439 eel IU2fOSO21e0]95 Sso ion 13e6 20t6 LA11 1) THE NUk18ER5 IN PARENTHESIS ARE PERCENT REDUCTIONS FOR GRADE 40 FIELD ADDEO REBAR SEE GENERAL NOTE NO. 4 TYPE DESIGNATION m Hffl eliz BE]S1 r - 1l11D tml cAalr / V - MBLIri F' O A1 W 0/ 051118M At FI Botma a uma rain 8F16—lB/IT Mom" mMJ L am ay or is Imm d1 M 1EeM Al Ill? is RRN At top SEE SAFE LATERAL LOAD TABLES FTR4 LOAD RATINCa 8F28 .•aa 4 FOR EACII AMMONAL MWORCED CUU (RCIII •G rULLCOURSEPROD )MMNEWED I" REMCM p 4adA.knln.ebiL .` j 111L ( 1) !rob I -Sir CUM i ,*• Q R 1• 4 CALL TS MOM AT 8N101Cr AIM Can 4taaA N.dV O •,_ 7- W ACIA MUMRURICRIff, MOM N INIR 1e f 00Ucr ItOVMM ttp* lAe hA"i0a b Ateapbna 6 CRNOPARRNOe1bn17 6324 CR S79 SEFFNER. FL 3f686 anFita3r 7>t1i r4rrirrr Ar vGT L\ aT a'F'OF1S1I6diii:LT i C1G 1—iAl YohFABRICATIONDETAILS eEa lda•1avL•1u1: ;rnm n : "',J`;;'l14' fYrdrer .re:7.1>tLvn; zrra rarl:r1. 1fF>ta:rt td irArit T I, \fM9IN6:Id:7,1\da7l•1pi; I: IIIYYI LL : 4/28/2017 Florida BuikBng Code Online BCIS Home ! Log In ! User Registration I Hot Topics Submit Surcharge I Slats 6 Facts I Publications I FBC Staff I BCIS Site Map I Links Search Fkiii(h i " Product Approval USER: Public User 416 .:.lr:.. Product Approval Menu > Product or Application Search > Application List > Application Oetall FL # FL3792-R8 Application Type Revision Code Version 2014 Application Status Approved Approved by DBPR. Approvals by DBPR shall be reviewed and ratified by the POC and/or the Commission If necessary, Comments Archived Product Manufacturer Lomanco, Inc Address/Phone/Email 2101 West Main Street Jacksonville, AR 72076 501) 982-6511 acarter@lomanco.com Authorized Signature Andrew Carter acarter@lomanco.com Technical Representative AndrewCarter Address/ Phone/Email 2101 West Main Street Jacksonville, AR 72076 501) 982-6511 Ext 361 acarter@lomanco. com Quality Assurance Representative Andrew Carter Address/ Phone/Email 2101 West Main Street Jacksonville, AR 72076 S01) 982-6511 Ext 6163 acarter@lomanco. com Category Roofing Subcategory Roofing Accessories that are an Integral Part of the Roofing System Compliance Method Certification Mark or Listing Certification Agency Miami -Dade BCCO - CER Validated By Miami -Dade BCCO - VAL Referenced Standard and Year (of Standard) Standard Year Miami - Dade TAS 100 (A) 1995 Equivalence of Product Standards Certified By Product Approval Method Method 1 Option A hltps: Uwww.floridabuilding.orglpr/pr app dll.aspx7param=wGEVXOwtDgsFgPhXouzz9PGbeVIdikEk7oGQ6zyYnmk%3d 1/3 A 4/28/2017 S . Date Submitted Date Validated Date Pending FBC Approval Date Approved Date Revised Florida Building Code Online 09/30/2015 10/06/2015 10/09/2015 08/16/2016 of Products FL # Model, Number or Name 3792.1 135 Roof Louver Limits of Use Approved for use in HVHZ: Yes Approved for use outside HVHZ: Yes Impact Resistant: N/A Design Pressure: N/A Other: 1. Refer to applicable building codes for required ventilation. 2. Model 135 Roof Vent and Model 2000 Power Roof Vent shall be installed over composition shingles roofs only. 3. Model 135 Roof Vent and Model 2000 Power Roof Vent shall not be Installed on roof mean heights greater than 33 feet. Description . Aluminum Roof Louver Certification Agency Certificate FL3792 R8 C CAC Lomanco 135 - 2000 PV - NOA 11- 0602.02.odf Quality Assurance Contract Expiration Date 08/17/2016 Installation Instructions FL3792 R8 II Lomanco 135 - 2000 PV - NOA 11-0602.02.odf Verified By: Miami -Dade BCCO - CER Created by Independent Third Party: Evaluation Reports FL3792 R8 AE Lomanco 135 - 2000 PV - NOA 11- 0602.02.odf Created by Independent Third Party: Yes 3792.2 730 Roof Lower Aluminum Roof Louver N - Limits of Use Certification Agency Certificate Approved for use In HVHZ: Yes EL3792 R8 C CAC Lomanco 700 Series - NOA It - Approved for use outside HVHZ: Yes 0602.04.odf Impact Resistant: N/A Quality Assurance Contract Expiration Date Design Pressure: N/A 08/16/2016 ' Other: 1. Refer to applicable building codes for required Installation Instructions ventilation. 2. Lomanco's Model 730,7S0,770 Roof Louvers FL3792 R8 II Lomanco 700 Series - NOA 11-0602.04.odf Verified By: Miami -Dade BCCO - CERshallcomplywithapplicablebuildingcode. 3. Lomanco's Model 730,750,770 Roof Louvers shall not be installed on roof Created'by Independent Third Party: mean heights greater than 33 feet. Evaluation Reports FL3792 R8 AE Lomanco 700 Series - NOA 11-0602.04:odf Created by Independent Third Party: Yes 3792.3 1750 Roof Louver Limits of Use Approved for use in HVHZ: Yes Approved for use outside HVHZ: Yes Impact Resistant: N/A Design Pressure: N/A Other: 1. Refer to applicable building codes for required ventilation. 2. Lomanco's Model 730,750,770 Roof Louvers shall comply with applicable building code. 3. Lomanco's Model 730,750,770 Roof Louvers shall not be installed on roof mean heights greater than 33 feet. 3792.4 770 Roof Louver Limits of Use ' Approved for use in HVHZ: Yes Approved for use outside HVHZ: Yes Impact Resistant: N/A Design Pressure: N/A Other: 1. Refer to applicable building codes for required ventilation. 2. Lomanco's Model 730,750,770 Roof Louvers shall comply with applicable bulding code. 3. Lomanco's Model 730,750,770 Roof Louvers shall not be installed on roof mean heights greater than 33 feet. Aluminum Roof Louver Certification Agency Certificate FL3792 R8 C CAC Lomanco 700 Series - NOA 11- 0602.04.odf Quality Assurance Contract Expiration Date 08/16/2016 Installation Instructions FL3792 R8 II Lomanco 700 Series - NOA 11-0602.04.odf Verified By: Miami -Dade BCCO - CER Created by Independent Third Party: Evaluation Reports FL3792 R8 AE Lomanco 700 Series - NOA 11-0602.04.odf Created by Independent Third Party: Yes Aluminum Roof Louver Certification Agency Certificate FL3792 R8 C CAC Lomanco 700 Series - NOA 11- 0602.04. odf Quality Assurance Contract Expiration Date O8/16/2016 Installation Instructions FL3792 R8 II'Lomanco 700 Series - NOA 11-0602.04.odf Verified By: Miami -Dade BCCO - CER Created by Independent Third Party: Evaluation Reports FL3792 R8 AE Lomanco 700 Series - NOA 11-0602.04.odf Created by Independent Third Party: Yes 13792.5 17700 Roof Louver Aluminum Roof Louver Limits of Use Certification Agency Certificate Approved for use in HVHZ: Yes FL3792 R8 C CAC NOA 15-0709.09.odf Approved for use outside HVHZ: Yes Quality Assurance Contract Expiration Date Impact Resistant: N/A 10/04/2020 I Design Pressure: N/A Installation Instructions Other: FL3792 R8 II NOA 15-0709.09.odf i Verified By: Miami -Dade BCCO - CER Created by Independent Third Party: t Evaluation Reports httpsJhvww.floridabUldng.orgtpr/pr app dtl.aspx?param=wGEVXQwtDgsFgPhXouzzgPGbe\ jdikEk7oGQGzyYnmk%3d c 2/3 I 4/28/2017 Florida Building Code Online FL3792 R8 AE NOA 15-0709.09.odf Created by Independent Third Party: Yes Contact Us :: M01 Blair Stone Road, Tallahassee FL 32399 Phone: 850-487.1824 The State of Florida Is an AA/EEO employer. Copyright 2007.2013 State of Florida.:: Privacy Statement :: Accessibility Statement :: Refund Statement under Florida law, email addresses are public records. If you do not want your e-mail address released In response to a public -records request, do not send electronic mall to this entity. Instead, contact the office by phone or by traditional mall. If you have any questions, please contact 850.487.139S. -Pursuant to Section 4S5.27S(l), Florida Statutes, effective October 1, 2012, licensees licensed under Chapter 455, F.S. must provide the Department with an email address If they have one. The emails provided may be used for official communication with the licensee. However email addresses are public record. if you do not wish to supply a personal address, please provide the Department with an email address which can be made available to the public To determine If you are a licensee under Chapter 455, F.S., please dick here . Product Approval Accepts: Wa ® ff.Lffi -tiT Credit Card Safe hltpsl/www.noridabuilding.orglpr/pr app dtl.aspx?param=wGEVXQwtOgsFgPhXouzz9PGbeVIdikEk7oGQ6zyYnmk%3d 3/3 MIAMI QADE MIAMI-UADE COUNTY a PRODUCT CONTROL SECTION BUILDING AND NEIGHBORHOOD COMPLIANCE DEPARTMENT (BNC) 11805 SW 26 Strcet, Room 208 BOARD AND CODE ADMINISTRATION DIVISION Miami, Florida 33175-2474 T (786) 315-2590 F (786) 315-2599 NOTICE OF ACCEPTANCE (NOA) www.miamidatte.eov/huildinL,/ Lomanco, Inc. 2101 West main Street Jacksonville, AR 72076 SCOPE: This NOA is being issued under the applicable rules and regulations governing the use of construction materials. The documentation submitted has been reviewed and accepted by Miami -Dade County BNC - Product Control Section to be used in Miami Dade County and other areas where allowed by the Authority Having Jurisdiction AHJ). This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Section (In Miami Dade County) and/or the AHJ (in areas other than Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perform in the accepted manner, the manufacturer will incur the expense of such testing and the AHJ may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. BNC reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Section that this product or material fails to meet the requirements of the applicable building code. This product is approved as described herein, and has been designed to comply with the Florida Building Code including the High Velocity Hurricane Zone of the Florida Building Code. DESCRIPTION: 135 Roof Vent, Lomancool 2000 Power Vent LABELING: Each unit shall bear a permanent label with the manufacturer's name or logo, city, state and following statement: "Miami -Dade County Product Control. Approved", unless otherwise noted herein. RENEWAL of this NOA shall be considered after a renewal application has been tiled and there has been no change in the applicable building code negatively affecting the performance of this product. TERMINATION of this NOA will occur after the expiration date or if there has been.a revision or change in the materials, use, and/or manufacture of the product or process. Misuse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause for termination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed by the expiration date may be displayed in advertising literature. If any portion of the NOA is displayed, then it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall be provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This renews NOAf# 06-0501.11 and consists of pages l through 4. The submitted documentation was reviewed by Alex Tigera. NOA No.: I1-0602.02 Expiration Date: 8/ 7 16MIAM40AOECOUNTYp 1 / Approval Date: 08/17/11 Page 1 of 4 ROOFING COMPONENT APPROVAL CateEorv: Rooting Sub-Cate2orv: Ventilation Material: Aluminum TRADE NAMES OF PRODUCTS MANUFACTURED OR LABELED BY APPLICANT: Test Product Product Dimensions Specification Description 135 Roof Vent, 9" x 28.5" TAS 100 Powered Roof Vent, with fan and Lomancool 2000 Power thermostat with a aluminum hood. Vent MANUFACTURING LOCATION 1. Jacksonville, AR EVIDENCE SUBMITTED: Test Aeencv/ldentifrer Name Report Date PRl Asphalt Technologies, inc. TAS 100(A) LOM-0l 1-02-01 04/05/06 NOA No.: 11-0602.02 MIAMI•DADECExpiration Date: 08/l7/16 Fj• • • OUNfTY Approval Date: 08/17/1 l Page 2 of 4 APPROVED APPLICATIONS Cutout: Vent must be located 18" from ridgeline. At chosen location and centered between two roof rafters, cut a 14" diameter hole through shingles and sheathing boards. Using marked position as center point; scribe a circle that is the same diameter as the vent throat opening. Starting with the drill hole cut vent hole. Installation: Vents should be evenly spaced on the rear slope of the roof. Remove roofing nails from top row of shingles so the flashing of the roof vent will slide under shingles. Apply approved roof cement around the edge of the hole. Carefully slide base of vent under shingles with arrow facing up. Make sure the throat of the vent is centered over vent hole. Fasten the base to roof decking at corners, and approx. 4" o.c. 1" from the outside edge of the flange and I" from stack every 45° with approved roofing nails, keeping heads of nails under shingles where possible. Use a minimum of 32 nails and shall be of sufficient length to penetrate through roof sheathing a minimum of ''/i'. See details drawings herein. Seal all seams and nails with roofing cement. Net Free Area: Refer to manufacturers published literature LIMITA'I:IONS: 1. Refer to applicable building codes for required ventilation. 2. 135 Roof Vent, Lomancool 2000 Power Vent, thermostat and wiring shall be installed in compliance with Lomanco, Inc. published instiuctions, and in accordance with applicable Building Codes. 3. This -acceptance is for installations over asphaltic shingle roofs only. 4. '135 Roof Vent, Lomancool. 2000 Power Vent, shall not be installed on roof mean heights greater than 33 feet. 5. All products listed herein shall have a quality assurance audit in accordance with the Florida BuildingCode and Rule 9B-72 of the Florida Administrative Code NOA No.: 11-0602.02 Expiration Date: 08/17/16 Approval Date: 08/17/lt Page 3 of 4 DETAIL DRAWINGS 135 Roof Vent, Lom:tncool 2000 Power Vent PART N IIEw.. REO UESCRIP110N MAIERIAL MAI WI, 0201-501 1 1 OilME 032 0025 X 28 50 X 26 50 5005-0 AL 32300 020I-502 2 I OAS" 0321.0025 X 20 Y 23 5005-0 AL 1840Q 0201-503 11I RAINSHIEI.O 0191.0075 X 1950 X 19.50 5005-0 Al. 913.` 0410-501 4 3 BRACKET 1C CA. X 1.250 X 7.580 CALV. STEEL A95q 0201-507 5 1 SCRELM 029 ;< 5 A 41, 175-8X8 MESH P"I:M-A-Korc I404000165 G 12 RIVET 3/I60 X 7/32 OVAL HO. AL 1405000281 3 SCRCIv Y14 X 1/2 HWUHO TYPEM 'AS" LINO PLT glu f• END OF THIS ACCEPTANCE NOA No.: 11-0602.02 Expiratiou Date: 08/17/l6 Approval Date: 08/17/11 Page 4 of 4 MIDADE MIAMI- DADE COUNTY PRODUCT CONTROL SECTION BUILDING AND NEIGIIBORROOD COMPLIANCE DEPARTMENT (BNC) 11805 SW 26 Street, Room 208 BOARD AND CODE ADMINISTRATION DIVISION Miami, Florida 33175-2474 T ( 786) 315-2590 F (786) 315-2599 NOTICE OF ACCEPTANCE (NOA) www.mismidadesov/buildinU, Lomanco, Inc. 2101 West main Street Jacksonville, AR 72076 SCOPE: This NOA is being issued under the applicable rules and regulations governing the use of construction.materials. The documentation submitted has been reviewed and accepted by Miami -Dade County BNC - Product Control Section to be used in Miami Dade County and other areas where allowed by the Authority Having Jurisdiction AHJ). This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Section ( in Miami Dade County) and/or the AHJ (in areas other than Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perform in the accepted manner, the manufacturer will incur the expense of such testing and the AHJ may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. BNC reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Section that this product or material fails to meet the requirements of the applicable building code. This product is approved as described herein,.and has been designed to comply with the Florida Building Code including the High Velocity Hurricane Zone of the Florida Building Code. DESCRIPTION: 135 Roof Vent, Lomancoo12000 Power Vent LABELING: Each unit shall bear a permanent label with the manufacturer's name or logo, city, state and following statement: "Miami -Dade County Product Control Approved", unless otherwise noted herein. RENEWAL of this NOA shall be considered after a renewal application has been filed and there has been no change in the applicable building code negatively affecting the performance of this product. TERMINATION of this NOA will occur after the expiration date or if there has been.a revision or change in the materials, use, and/or manufacture of the product or process. Misttse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause for tenuination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed by the expiration date may be displayed in advertising literature. If any portion of the NOA is displayed, then it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall be provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This renews NOAII 06-0501.1 1 and consists of pages I through 4. The submitted documentation was reviewed by Alex Tigera. NOA No.: 11-0602.02 Expiration Date: 08/17/16 Approval Date: 08/17/11 Page I of 4 ROOFING COMPONENT APPROVAL Categorv: Roofing Sub -Category: Ventilation Material: Aluminum TRADE NAMES OF PRODUCTS MANUFACTURED OR LABELED BY APPLICANT: Test Product Product Dimensions Specification Description 135 Roof Vent, 9" x 28.5" TAS 100 Powered Roof Vent, with fan and Lomancool 2000 Power thermostat with a aluminum hood. Vent MANUFACTURING LOCATION 1. Jacksonville, AR EVIDENCE SUBMITTED: Test Aeencv/Identifier Name PRI Asphalt Technologies, Inc. TAS 100(A) Report Date LOM-011-02-01 04/05/06 NOA No.: 11-0602.02 Expiration Date: 08/17/16 Approval Date: 08/17/11 Page 2 of 4 APPROVED APPLICATIONS Cutout: Vent must be located 18" from ridgeline. At chosen location and centered between two roof rafters, cut a 14" diameter hole through shingles and sheathing boards. Using marked position as center point; scribe a circle that is the sane diameter as the vent throat opening. Starting with the drill hole cut vent hole. Installation: Vents should be evenly spaced on the rear slope of the roof. Remove roofing nails from top row of shingles so the Flashing of the roof vent will slide tinder shingles. Apply approved roof cement around the edge of the hole. Carefully slide base of vent under shingles with arrow facing up. Make sure the throat of the vent is centered over vent hole. Fasten the base to roof decking at corners, and approx. 4" o.c. I" from the outside edge of the flange and I" from stack every 45° with approved roofing nails, keeping heads of nails under shingles where possible. Use a minimum of 32 nails and shall be of sufficient length to penetrate through roof sheathing a minimum of/2". See details drawings herein. Seal all seams and nails with roofing cement. Net Free Area: Refer to manufacturers published literature LIMITATIONS: I. Refer to applicable building codes for required ventilation. 2. 135 Roof Vent, Lomancool 2000 Power Vent, thermostat and wiring shall be installed in compliance with Lomanco, Inc. published instructions, and in accordance with applicable Building Codes. 3. This acceptance is for installations over asphaltic shingle roofs only. 4. 135 Roof Vent, Lomancool 2000 Power Vent, shall not be installed on roof mean heights greater than 33 feet. 5. All products listed herein shall have a quality assurance audit in accordance with the .Florida BuildingCode and Rule 9B-72 of the Florida Administrative Code NOA No.: 11-0602.02 Expiration Date: 08/17/16 Approval Date: 08/17/11 Page 3 of 4 PAR 0201 0201 0201 0410 0201 14040 14050 a. DETAIL DRAWINGS 135 Roof Vent, Lomancool 2000 Power Vent r y I IEM Pro I UESCHIP IION MA I EHIAL NA I W I' 501 1 1 riOMr; 032-1.0025 X 2850 X 26.50 5005-0 AL 2501 502 t 1 BASE 0323.0025 X 20 X 23 500!----0 AL I.840q RA1H$N1rL0 019t 0025 X 19.56 X 11).50 5005-0 AL 9134F 501 a 1BRACI'Er 16 GA. X 1.250 X 7.580 CALM ;(EEL 195/ 507 5 1 SCREEN 028 X 5 X al. S79-BX8 W'&i PERM-4-KOrr 00165 6 12 R1Vr:1 3/1613 X 7/32 OVAL r10. AL 00281 1 3 SCREW 14 X 1/2 HWUHO rYPEM -ae" ZINC PL.i END OF THIS ACCEPTANCE NOA No.: 11-0602.02 M1AMI-DADECOUN- Y Expiration Date: 08/17/16 Approval Date: 08/17/11 Page 4 of 4 MIAMI-DARE MIAMI-DADE COUNTY PRODUCT CONTROL SECTION BUILDING AND NEIGHBORROOD COMPLIANCE DEPARTMENT (BNC) 11805 SW 26 Street, Room 208 BOARD AND CODE ADMINISTRATION DIVISION Miami, Florida 33175-2474 T (786) 315-2590 F (786) 315-2599 NOTICE OF ACCEPTANCE (NOA) www.miamidade.aov/baildina/ Lomanco, Inc. 2101 West main Street Jacksonville, AR 72076 SCOPE: This NOA is being issued tinder the applicable rules and regulations governing the use of construction materials. The documentation submitted has been reviewed and accepted by Miami -Dade County BNC - Product Control Section to be used in Miatni Dade County and other areas where allowed by the Authority Having Jurisdiction AI-0). This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Section (In Miami Dade County) and/or the AHJ (in areas other than Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perform in the accepted manner, the manufacturer will incur the expense of such testing and the AH.I may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. BNC reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Section that this product or material fails to meet the requirements of the applicable building code. This product is approved as described herein, and has been designed to comply with the Florida Building Code including the High Velocity Hurricane Zone of the Florida Building Code. DESCRIPTION: 135 Roof Vent, L omancool 2000 Power Vent LABELING: Each unit shall bear a permanent label with the manufacturer's name or logo, city, state and following statement: "Miami -Dade County Product Control Approved", unless.otherwise noted herein. RENEWAL of this NOA shall be considered after a renewal application has been filed and there has been no change in the applicable building code negatively affecting the performance of this product. TERMINATION of this NOA will occur after the expiration date or if there has been a revision or change in the materials, use, and/or manufacture of the product or process. Misuse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause for termination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed by the expiration dale may be displayed in advertising literature. if any portion of the NOA is displayed, then it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall be provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This renews NOA# 06-0501. l l and consists of pages I through 4. The submitted documentation was reviewed by Alex Tigera. e'elor"' 7_ NOA No.: 11-0602.02 Expiration Date: 08/17/16 Approval Date: 08/17/11 Page 1 of 4 J ROOFING COMPONENT APPROVAL Catetorv: Roofing Sub-Cateaory: Ventilation Material: Aluminum TRADE NAMES OF PRODUCTS MANUFACTURED OR LABELED BY APPLICANT: Test Product Product Dimensions Snecification Descrintion 13.5 Roof Vent, 9" x 28.5" TAS 100 Powered Roof Vent, with fan and Lomancool 2000 Power thermostat with a aluminum hood. Vent MANUFACTURING LOCATION 1. Jacksonville, AR EVIDENCE SUBMITTED: Test Aeencv/Identifier Name PRI Asphalt Technologies, Inc. TAS 100(A) Renor Date LOM- 011-02-01 04/05/06 NOA No.: 11-0602.02 Expiration Date: 08/l7/16 Approval Date: 08/1.7/11 Page 2 of 4 APPROVED APPLICATIONS Cutout: Vent must be located 18" from ridgeline. At chosen location and centered between two roof ratters, cut a 14" diameter hole through shingles and sheathing boards. Using marked position as center point; scribe a circle that is the same diameter as the vent throat opening. Starting with the drill hole cut vent hole. Installation: Vents should be evenly spaced on the rear slope of the roof. Remove roofing nails from top row of shingles so the flashing of the roof vent will slide under shingles. Apply approved roof cement around the edge of the hole. Carefully slide base of vent under shingles with arrow facing up. Make sure the throat of the vent is centered over vent hole. Fasten the base to roof decking at comers, and approx. 4" o.c. I" from the outside edge of the flange and l" from stack every 45° with approved roofing nails, keeping heads of nails under shingles where possible. Use a minimum of 32 nails and shall be of sufficient length to penetrate through roof sheathing a minimum of/2". See details drawings herein. Seal all seams and nails with roofing cement. Net Free Area: Refer to manufacturers published literature LImrfAT.LONS: 1. Refer to applicable building codes for required ventilation. 2. 135 Roof Vent, Lomancool 2000 Power Vent, thermostat and wiring shall be installed in compliance with Lornanco, Inc..published instructions, and in accordance with applicable Building Codes. 3. This acceptance is for installations over asphaltic shingle roofs only. 4. 135 Roof Vent, Lomancool 2000 Power Vent, shall not be installed on roof mean heights greater than 33 feet. All products listed herein shall have a quality assurance audit in accordance with the Florida BuildingCode and Rule 9B-72 of the Florida Administrative Code NOA No.: 11-0602.02 Expiration Date: 08/17/16 Approval Date: 08/-17/11 Page 3 of 4 DETAIL DRAWINGS 05 Roof Vent, Lomancool 2000 Power Vent PART .4 17F1/. RF0 I OtSCRIP110N MAIERIAL MAt W1 0201-501 1 1 COME I 0321.00715 X 7d.50 X 28.50 5005-0 AL 3 250# 0201-502 2 I CASE 031.t.0025 X 20 X 23 5605-0 At. 1.8400 0201-503 3 1 RAmStnELC 019•r.0025 X 19.50 X 19.50 5005-0 AL 9131 0410-WI 4 3 BRACKET 16 CA. X 1 250 X 7.580 CALV• STEEL 195a 02111-°.,17 5 1 SCREEN 028 :< 5 X 41..17i-8X8' MFSH PERM-A-KOIF 1404000165 6 12 RIVET 3/:60 X 7/32 OVAL HD AL 1405000281 7 3 I SCRLW 14 X 1/2 mmimo r-MEM "AS- ZINC PLT c1l u f END OF THIS ACCEPTANCE NOA No.: 11-0602.02 Expiration Date: 08/17/16 Approval Date: 08/17/1 l Page 4 of 4 4/28/2017 1 Florida Building Code Online ri 1 .. r ,....-..._._.._. t , t n ` t .til //^' ; t t 1;1,t.G(rlYjtsifL• • -•, r . . SCIS Home Log In User Registration Hot Topics Submit Surcharge Stats & Facts Publications FBC Staff j 80S Site Map Links j Search hkNlf 1 r Product Approval@USER:Public user Product Approval Menu > product or AnoliraLlon Search > Aenllrl+tion List > Application Detail i 1% rSL:3• a!nc• FL # FL12328-R7 Application Type Revision i ' • • • I Code Version 2014 Application Status Approved Comments Archived Product Manufacturer TAMKO Building Products, Inc. Address/Phone/Email PO Box 1404 Joplin, MO 64802 417)624-6644 Ext2305 kerri—eden@tamko.com Authorized Signature Carter Lea carter_lea@tamko.com Technical Representative Kerri Eden r. Address/Phone/Email PO Box 1404 Joplin, MO 64802 417) 624-6644 Ext 2305 r kerri eden@tamko.com i, •.'. Quality Assurance Representative j• ?• • Address/Phone/Small Category Roofing Subcategory Underlayments Compliance Method Evaluation Report from a Florida Registered Architect or a Licensed i : '• .. Florida Professional Engineer Evaluation Report - Hardcopy Received Florida Engineer or Architect Name who developed Zachary R. Priest the Evaluation Report Florida License PE-74021 r••i ., a Quality Assurance Entity UL LLC s : Quality Assurance Contract Expiration Date 01/07/2019 Validated By Locke Bowden j Validation Checklist - Hardcopy Received Certificate of Independence FL12328 R7 COI TBP14001.3 2014 FPA TAMKO Underlavments- FINAL, odf Referenced Standard and Year (of Standard) Standard Year ASTM 01970 2009 ASTM D226 2006 ASTM D4869 2005 ASTM D6380 2003 Equivalence of Product Standards Certified By I Sections from the Code https:/twww.floridabuilding.org/pr/pr ppp dtl.aspx?param=wGEVXQwtDgtF2AezuarjgOIAramDGm5e%2bS%2baRvkOl3ThCOrlWi58TQ%3d%3d 1/4 4/28/2017 Florida Building Code Online Product Approval Method Date Submitted Date Validated Date Pending FBC Approval Date Approved Method 1 Option D 08/23/2016 08/23/2016 08/25/2016 10/13/2016 Summary_ofProducts ' _ .- •.:-.... .. :.:: :. -... --- -- - FL # Model, Number or Name Description 12328.1 ASTM Slate Surfaced Roll Roofing Roll roofing surfaced with mineral granules Limits of Use Installation Instructions Approved for use in HVHZ: No FL12328 R7 If TBP14001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL.odf Impact Resistant, N/A Verified By: Zachary R. Priest 74021 Design Pressure: N/A Created by Independent Third Party: Yes Other: See evaluation report for limits of use. Evaluation Reports FL12328 R7 AE TBP14001.3 2014 FPA TAMKO Underlavments-FINAL. odf Created by Independent Third Party: Yes 12328.2' ASTM Tile Underlayment Coated organic underlayment Limits of Use Installation Instructions Approved for use in HVHZ: No FL12328 R7 II TBPL4001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL, odf Impact Resistant: N/A Verified By: Zachary R. Priest 74021 Design Pressure: N/A Created by Independent Third Party: Yes Other: See evaluation report for limits of use. Evaluation Reports FL12328 R7-AE TSP14001.3 2014 FPA TAMKO U nderlavments-FINAL. odf Created by Independent Third Party: Yes 12328.3 Master Smooth Asphalt saturated organic underlayment. Limits of Use Installation Instructions Approved for use in HVHZ: No FL12328 R7 II TBP14001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL. adf Impact Resistant: N/A Verified By: Zachary R. Priest 74021 Design Pressure: N/A Created by Independent Third Party: Yes Other: See evaluation report for limits of use. Evaluation Reports FL12328 R7 AE TSP14001.3 2014 FPA TAMKO U nderl a vments-FINAL. odf Created by Independent Third Party: Yes 12328.4 Moisture Guard Plus A self -adhering modified bitumen-underlayment. Limits of Use Installation'Instructions Approved for use in HVHZ: No FL12328 R7 H TBP14001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL, odf Impact Resistant: N/A Verified By: Zachary R. Priest 74021 Design Pressure: N/A. Created by Independent Third Party: Yes ' Other: See evaluation report for limits of use. Evaluation Reports FL12328 R7 AE TBP14001.3 2014 FPA TAMKO Underlavments-FINAL.odf Created by Independent Third Party: Yes 12328.5 No. 15 ASTM Asphalt saturated organic felt Limits of Use Installation Instructions Approved for use in HVHZ: No FL12328 R7 It TBP14001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL.odf Impact Resistant: N/A Verified By: Zachary R. Priest 74021 Design Pressure: N/A Created by Independent Third Party: Yes Other: See evaluation report for limits of use. Evaluation Reports FL12328 R7 AE TSP14001.3 2014 FPA TAMKO U nderlavm ents-FINAL• odf Created by Independent Third Party: Yes 12328.6 I No. 15 UL Asphalt saturated organic felt Limits lof Use Installation Instructions Approved for use In HVHZ: No . FL12328 R7 II TBP14001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL.odf Impact Resistant: N/A Verified By: Zachary R. Priest 74021 https:/Aaww.floridabuilding.orgtpr/pr app dtl.aspx?param=wGEVXOwtDgtF2AezuarjgOlAramDGm5e%2bS%2baRvkOl3ThCOrtAfi58TQ°/a3d%3d 214 Florida Building Code Online Design Pressure: N/A Other: See evaluation report for limits of use. Created by Independent Third Party: Yes Evaluation Reports FL12328 R7 AE TBP14001.3 2014 FPA TAMKO Underlavments-FINAL.odf Created by Independent Third Party: Yes 12328.7 No. 30 ASTM Asphalt saturated organic felt Limits of Use Installation Instructions Approved for use in HVHZ: No FL12328 R7 It TBP14001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL.ndf Impact Resistant: N/A Verified By: Zachary R. Priest 74021 Design Pressure: N/A Created by Independent Third Party: Yes Other: See evaluation report for limits of use. Evaluation Reports FL12328 R7 AE TBP14001.3 2014 FPA TAMKO Underlavments-FINAL odf Created by Independent Third Party: Yes 112328.8 1 No: 30 UL I Asphalt saturated organic felt Limits of Use Approved for use In HVHZ: No Approved for use outside HVHZ: Yes Impact Resistant: N/A Design Pressure: N/A Other: See evaluation report,for limits of use. 12328.9 1 TAM -FELT Umits of use Approved for use in HVHZ: No Approved for use outside HVHZ: Yes Impact Resistant: N/A Design Pressure: N/A Other: See evaluation report for limits of use. Installation Instructions 12328 R7 II TSP14001.3 2014 FPA TAMKO Underlavments-FWAL.odf Verified By: Zachary R. Priest 74021 Created by Independent Third Party: Yes Evaluation Reports FL12328 R7 AE TBP14001.3 2014 FPA TAMKO Underlavments-FINAL. odf Created by Independent Third Party: Yes Alternate to ASTM D 226, Type II underlayment Installation Instructions FL12328 R7 11 TBP14001.3 2014 FPA TAMKO Underlavments-FINAL, odf Verified By: Zachary R. Priest PE-74021 Created by Independent Third Party: Yes Evaluation Reports FL12328 R7 AE TBP14001.3 2014 FPA TAMKO U nderlavments-FINAL. odf Created by Independent Third Party: Yes 12.328.10 I TW Metal and rife Underlayment self -adhering modified' bitumen underlayment Umits of Use Installation Instructions Approved for use In HVHZ: No FL12328 R7 It TBP14001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL.odf Impact Resistant: N/A Verified By: Zachary R.• Priest 74021DesignPressure: N/A Created by Independent Third Party: Yes Other- See evaluation report for limits of use. Evaluation Reports •• FL12328 R7 AE TBP14001.3 2014 FPA TAMKO Underlavments-FINAL, odf Created by Independent Third Party: Yes 12328.11 TW Underlayment self -adhering modified bitumen underlayment Limits of Use Installation Instructions Approved for use in HVHZ: No FL12328 R7 If TBP14001.3 2014 FPA TAMKO Approved for use outside HVHZ: Yes Underlavments-FINAL.odf Impact Resistant: N/A Verified By: Zachary R. Priest 74021 Design Pressure: N/A Created by Independent Third Party: Yes Other: See evaluation report for limits of use. Evaluation Reports FL12328 R7 AE TBP14001.3 2014 FPA TAMKO Underlavments-FINAL, adf Created by Independent Third Party: Yes L11E Q Contact Us :: 2601 Blair Stone Road. Tallahassee FL 32399 Phone: OSO-487-1824 The State of Florida Is an AA/EeO employer. Copyright 2007.2013 State of Florida.:: Privacy Statement :: Accessibility Statement :: Refund Statement Under Florida law, email addresses are public records. If you do not want your e-mail address released In response to a public -records request, do not send electronic mall to this entity. Instead, contact the office by phone or by traditional mall. It you have any questions, please contact 850.487.139S. *Pursuant to Section 45S.275(t), Florida Statutes, effective October 1, 2012, licensees licensed under Chapter 4SS, F.S. must provide the Department with an email address If they have one. The entails provided may be used for official communication with the licensee. However email addresses are public record. tf you do not wish to supply a personal address, please provide the Department with an email address which can be made available to the public. To determine 11' you are a licensee under Chapter 4SS, F,S., please click gM_. Product Approval Accepts: 2" Qrs ht(ps.ltwvww.Ooridabuilding.org/pr/pr_app dtl.aspx?param=wGEVXQwIiJglF2AezuarjgOlAramOGmSe°o2bS%g2baRvkOl3ThCOrIWiSBTQ%3d%3d 314 4/28/2017 Florida Building Code Online Credit Card Safe htlps:/Mrww.floridabuilding.orglpr/pr app dl1.aspx?param=wGEVXQwIOglF2Ae¢uarjgOlAramOGm5e%2bS%2baRvkOl3ThCQrI'Ni58TQ%3d%3d 4/4 r CREEK TECHNICAL SERVICES, LLC Certificate of Authorization No. 29824 17520 Edinburgh Drive Tampa, FL 33647 813) 480-3421 EVALUATION REPORT FLORIDA BUILDING CODE, 5T" EDITION (2014) Manufacturer: TAMKO BUILDING PRODUCTS, INC. Issued August 22, 2016 P.O. Box 1404 Joplin, MO 64802 417) 624-6644 http;//www.tamko.com Quality Assurance: UL LLC (QUA9625) SCOPE Category: Roofing Subcategory: Underlayments Code Sections: 1507.2.3, 1507.2.4, 1507.2.8, 1507.2.9.2, 1507.3.3, 1507.4.5.1, 1507.4.5.2. 1507.4.5.3, 1507.5.3, 1507.5.3.2, 1507.6.3, 1507.6.3.2, 1507.6.5, 1507.7.3, 1507.7.3.2, 1507.8.3, 1507.8.3.2. 1507.8.8. T1507.8, 1507.9.3, 1507.9.3.2, 1507.9.5. 1507.9.9 Properties: Physical properties REFERENCES Entity Report No. Standard Y1C PRI Construction Materials Technologies (TST6049) TAP-191-02-01 REV ASTM D 1970 2009 PRI Construction Materials Technologies (TST6049) TAP-192-02-01 ASTM D 1970 2009 PRI Construction Materials Technologies (TST6049) TAP-193-02-01 ASTM D 1970 2009 PRI Construction Materials Technologies (TST6049) TAP-214-02-01 ASTM D 4869 2005e01 PRI Construction Materials Technologies (TST6049) TAP-215-02-01 ASTM D 226 2006 PRI Construction Materials Technologies (TST6049) TAP-216-02-03 ASTM D 6380 2003(2009) PRI Construction Materials Technologies (TST6049) TAP-217-02-01 REV ASTM D 6380 2003(2009) PRI Construction Materials Technologies (TST6049) TAP-218-02-01 ASTM O 226 2006 PRI Construction Materials Technologies (TST6049) TAP-219-02-01 ASTM O 226 2006 PRI Construction Materials Technologies (TST6049) TAP-220-02-01 ASTM D 6380 2003(2009) PRI Construction Materials Technologies (TST6049) TAP-222.02-01 ASTM D 4869 2005e01 PRI Construction Materials Technologies (TST6049) TAP-319-02-01.1 ACC 188 2012 UL LLC (TST9628) 13CA12269 ASTM D 226 2006 PRODUCT DESCRIPTION AND APPLICATION TAMKO® ASTM Slate ASTM D 6380. Class M. Type II underlayment constructed from organic felt saturated Surfaced Roll Roofing with asphalt and coated on both sides with asphalt and surfaced with granules. Min. slope: 2:12 Application: The underlayment shall be installed with minimum 2" side laps and minimum 4" staggered end laps and in accordance with FRSAIfRI 07230 for tile applications. Allowable roof coverings: Attachment of asphalt shingle valleys and clay and concrete tile shall be permitted in accordance with the FBC. TBP14001.3 FL12328-R7 Page 1 of 4 This evaluation report is provided for Stale of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This -evaluation report does not express nor Imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TAMKO BUILDING PRODCUTS, INC. TAMKO Underlayments TECHNICAL SERVICES, LLC TAMKO® ASTM Tile ASTM D 6380, Class M, Type II underlayment constructed from an organic felt saturated Underlayment with asphalt then coated on both sides with asphalt and surfaced with granules. Application: The underlayment shall be installed with minlmum 2" side laps and minimum 4" staggered end .laps and in accordance with FRSA/TRI 07230 for tile applications. Allowable roof coverings: Attachment of clay and concrete tile shall be permitted in accordance with the FBC. TAMKO® Master ASTM D 6380, Class S, Type IV underlayment constructed from an organic felt saturated Smooth with asphalt then coated on both sides with asphalt and surfaced with a fine mineral. Application: The underlayment shall be installed along the valley In accordance with FBC requirements. Allowable roof coverings: Attachment of asphalt shingle valleys shall be permitted In accordance with the FBC. TAMKO® Moisture Self -adhered, ASTM 0 1970, fiberglass reinforced, modified bitumen sheet membrane Guard Plus® with a mineral surfacing and a removable release film on the adhesive side. Application: The underlayment shall be attached by adhering directly to the roof deck with minimum 3-1/2" side laps and minimum 6" staggered end laps. Min. application temperature: 40°F. Allowable roof coverings: Attachment of asphalt shingles and mechanically fastened concrete and clay tile roofing shall be permitted in accordance with the FBC. TAMKO® No. 15 ASTM ASTM D 226, Type I underlayment constructed from a non -perforated organic felt that is Asphalt Saturated saturated with asphalt. Organic Felt Application: The underlayment shall be Installed with minimum 2" side laps and minimum 4" end laps. Allowable roof coverings: Attachment of asphalt shingles, metal roofing, wood shingles, wood shakes, and roll roofing shall be permitted in accordance with the FBC. TAMKO® No. 15 UL ASTM D 226, Type I underlayment constructed from a non -perforated organic felt that is Asphalt Saturated saturated with asphalt. Organic Felt Application: The underlayment shall be installed with minimum 2" side laps and minimum 4" end laps. Allowable roof coverings: Attachment of asphalt shingles, metal roofing, wood shingles, wood shakes, and roll roofing shall be permitted in accordance with the FBC. TBP14001.3 FL12328-R7 Page 2 of 4 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report Is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC TAMKO BUILDING PRODCUTS, INC. TAMKO Underlaymonts TAMKO® No. 30 ASTM ASTM D 226, Type II underlayment constructed from a non -perforated organic felt that is Asphalt Saturated saturated with asphalt. Organic Felt Application: The underlayment shall be installed with minimum 2" side laps and minimum 4" end laps. Allowable roof coverings: Attachment of asphalt shingles, metal roofing, clay and concrete tile, slate shingles, wood shingles, wood shakes, and roll roofing shall be permitted in accordance with the FBC. TAMKOO No. 30 UL ASTM D 226, Type II underlayment constructed from a non -perforated organic felt that is Asphalt Saturated saturated with asphalt. Organic Felt Application: The underlayment shall be Installed with minimum 2" side laps and minimum 4" end laps. Allowable roof coverings: Attachment of asphalt shingles, metal roofing, clay and concrete tile, slate shingles, wood shingles, wood shakes, and roll roofing shall be permitted in accordance with the FBC. TAMKOO TW Metal and Self -adhered, flexible, ASTM D 1970, rubberized asphalt sheet membrane with a Tile Underlayment polymer film on the surface and a removable release film on the adhesive side. Application: The underlayment shall be attached by adhering directly to the roof deck with minimum 4' side laps and minimum 6' staggered end laps. Min. application temperature: 40"F Allowable roof coverings: Attachment of asphalt shingles, metal roofing, and mechanically fastened clay and concrete tiles shall be permitted In accordance with the FBC. TAMKO® TW Self -adhered, flexible, ASTM D 1970, rubberized asphalt sheet membrane with a Underlayment polymer film on the surface and a removable release film on the adhesive side. Application: The underlayment shall be attached by adhering directly to the roof deck with minimum 4" side laps and minimum 6" staggered end laps. Min. application temperature: 40"F Allowable roof coverings: Attachment of asphalt shingles and metal roofing shall be permitted in accordance with the FBC. TAMKOO TAM -FELT Alternate to ASTM D 226, Type I and Type II underlayment constructed from a non - perforated organic felt that is saturated with asphalt. Application: The underlayment shall be installed with minimum 2' side laps and minimum 4" end laps. Allowable roof coverings: Attachment of asphalt shingles shall be permitted in accordance with the FBC. TSP14001.3 FL12328-R7 Page 3 of 4 This evaluation report is provided for Slate of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services. LLC of any product changes or quality assuranoe changes throughout the duration for which this report Is valid. This evaluation report does not express nor Imply warranty, Installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TCCHNICAL SERVICES, LLC LIMITATIONS TAMKO BUILDING PRODCUTS, INC. TAMKO Undedayments 1) This evaluation report is not for use in, the HVHZ. 2) Fire Classification is not within the scope of this evaluation. 3) Wind uplift resistance in not within scope of this evaluation. 4) Installation of the evaluated product shall comply with this report, the FBC, and the manufacturer's published application instructions. Where discrepancies exist between these sources, the more restrictive and FBC compliant installation detail shall prevail. 5) Minimum application temperature shall be 50°F unless otherwise noted. Contact the manufacturer when installing at temperatures below the minimum application temperature. 6) Deck substrates shall be clean, dry, and free from any irregularities and debris. All fasteners in the deck shall be checked for protrusion and corrected prior to underlayment application. 7) The roof deck shall be constructed of closely fitted sheathing for new or existing construction. Roof deck shall be installed in accordance with FBC requirements. 8) Unless otherwise stated, the minimum roof slope shall be in accordance with F8C requirements. 9) All underlayments shall be installed with the roll length parallel to the save, starting at the eave, and lapped in successive courses installed up the deck in a manner that effectively sheds water from the deck. End laps shall be staggered between courses in accordance with the manufacturer's application instructions. 10) The underlayment may be used as described in other current FBC product approval documents. 11) The underlayment shall not be installed over existing roof coverings. 12) Contact the manufacturer regarding specific exposure limits for each underlayment. 13) All products listed in this report shall be manufactured under a quality assurance program in compliance with Rule 61 G20-3. COMPLIANCE STATEMENT The products evaluated herein by Zachary R. Priest, P.E. have demonstrated compliance with the Florida Building Code, 51h Edition (2014) as evidenced in the referenced documents submitted by the named manufacturer. 1l l l l l a 111"" i E E NsG No 74021 STATE OF • S'`S10 N A • CERTIFICATION OF INDEPENDENCE 2016.08.2 AXt)-2 09:35:39 a„ryi a blwaM - 0 4 t00t Zachary R. Prlest, P.E. Florida Registration No. 74021 Organization No. ANE9641 CREEK Technical Services, LLC does not have, nor wilt it acquire, a financial Interest In any company manufacturing or distributing products under this evaluation. CREEK Technical Services, LLC Is not owned, operated, or controlled by any company manufacturing or distributing products under this evaluation. Zachary R. Priest. P.E. does not have, nnr will acquire, a financial Interest In any company manufacturing or distributing products under this evaluation. Zachary R. Prlest, P.E. does not have, nor vAll acquire, a financial Interest In any other entity Involved In the approval process of the product. END OF REPORT TBP14001.3 FL12328-R7 Page 4 of 4 This evaluation report is provided for Slate of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report Is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK Certificate of Authorization bur Drive17520EdinburghDrive Tampa, FL 33647 TECHNICAL SERVICES, LLC (813)480-3421 EVALUATION REPORT FLORIDA BUILDING CODE, 5T" EDITION (2014) Manufacturer: TAMKO BUILDING PRODUCTS, INC. P.O. Box 1404 Joplin, MO 64802 417)624-6644 htto://www.tamko.com Quality Assurance: UL LLC (QUA9625) SCOPE Issued August 22, 2016 Category: Roofing Subcategory: Underlayments Code Sections: 1507.2.3, 1507.2.4, 1507.2.8, 1507.2.9.2, 1507.3.3, 1507.4.5.1, 1507.4.5.2. 1507.4.5.3. 1507.5.3. 1507.5.3.2. 1507.6.3, 1507.6.3.2. 1507.6.5. 1507.7.3. 1507.7.3.2, 1507.8.3, 1507.8.3.2, 1507.8.8. T1507.8, 1507.9.3. 1507.9.3.2. 1507.9.5, 1507.9.9 Properties: Physical properties REFERENCES E tity Report No. Standard Y= PRI Construction Materials Technologies (TST6049) TAP-191-02-01REV ASTM 0 1970 2009 PRI Construction Materials Technologies (TST6049) TAP-192-02-01 ASTM D 1970 2009 PRI Construction Materials Technologies (TST6049) TAP-193-02-01 ASTM D 1970 2009 PRI Construction Materials Technologies (TST6049) TAP-214-02-01 ASTM O 4869 2005e01 PRI Construction Materials Technologies (TST6049) TAP-215-02-01 ASTM D 226 2006 PRI Construction Materials Technologies (TST6049) TAP-216-02-03 ASTM D 6380 2003(2009) PRI Construction Materials Technologies (TST6049) TAP-217-02-01 REV ASTM D 6380 2003(2009) PRI Construction Materials Technologies (TST6049) TAP-218-02-01 ASTM D 226 2006 PRI Construction Materials Technologies (TST6049) TAP-219-02-01 ASTM 0 226 2006 PRI Construction Materials Technologies (TST6049) TAP-220-02-01 ASTM D 6380 2003(2009) PRI Construction Materials Technologies (TST6049) TAP-222-02-01 ASTM D 4869 2005e01 PRI Construction Materials Technologies (TST6049) TAP-319-02-01.1 ACC 188 2012 UL LLC (TST9628) 13CA12269 ASTM D 226 2006 PRODUCT DESCRIPTION AND APPLICATION TAMKO® ASTM Slate ASTM D 6380, Class M, Type II underlayment constructed from organic fell saturated Surfaced Roll Roofing with asphalt and coated on both sides with asphalt and surfaced with granules. Min. slope: 2:12 Application: The undedayment shall be installed with minimum 2" side laps and minimum 4" staggered end laps and in accordance with FRSA/TRI 07230 for tile applications. Allowable roof coverings: Attachment of asphalt shingle valleys and clay and concrete Tile shall be permitted in accordance with the FBC. TBP14001.3 FL12328-R7 Page 1 of 4 This evaluation report is provided for Stale of Florida product approval under Rule 614320-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TAMKO BUILDING PRODCUTS, INC. TAMKO Underlayments TECHNICAL SERVICES, LLC TAMKO® ASTM Tile ASTM D 6380, Class M, Type II underlayment constructed from an organic felt saturated Underlayment with asphalt then coated on both sides with asphalt and surfaced with granules. Application: The underlayment shall be installed with minimum 2" side laps and minimum 4" staggered end laps and in accordance with FRSA/TRI 07230 for tile applications. Allowable roof coverings: Attachment of clay and concrete tile shall be permitted in accordance with the FBC. TAMKO® Master ASTM D 6380, Class S, Type IV underlayment constructed from an organic felt saturated Smooth with asphalt then coated on both sides with asphalt and surfaced with a fine mineral. Application: The underlayment shall be installed along the valley in accordance with FBC requirements. Allowable roof coverings: Attachment of asphalt shingle valleys shall be permitted in accordance with the FBC. TAMKO® Moisture Self -adhered, ASTM D 1970, fiberglass reinforced, modified bitumen sheet membrane Guard Plus® with a mineral surfacing and a removable release film on the adhesive side. Application: The underlayment shall be attached by, adhering directly to the roof deck with minimum 3-1/2" side laps and minimum 6" staggered end laps. Min. application temperature: 40'F. Allowable roof coverings: Attachment of asphalt shingles and mechanically fastened concrete and Gay tile roofing shall be permitted in accordance with the FBC. TAMKO® No. 15 ASTM ASTM D 226, Type I underlayment constructed from a non -perforated organlc felt that is Asphalt Saturated saturated with asphalt. Organic Folt Application: The underlayment shall be Installed with minimum 2" side laps and minimum 4' end laps. Allowable roof coverings: Attachment of asphalt shingles, metal roofing, wood shingles, wood shakes, and roll roofing shall be permitted in accordance with the FBC. TAMKO® No. 15 UL ASTM D 226, Type I underlayment constructed from a non -perforated organic felt that is Asphalt Saturated saturated with asphalt. Organic Felt Application: The underlaymenl shall be installed with minimum 2" side laps and minimum 4" end laps. Allowable roof coverings: Attachment of asphalt shingles, metal roofing, wood shingles. wood shakes, and roll roofing shall be permitted in accordance with the FBC. TBP14001.3 FL12328-R7 Page 2 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CRE" TAMKO BUILDING PRODCUTS, INC. Lr TAMKO Underlayments TECHNICAL SERVICES, LLC TAMKO® No. 30 ASTM ASTM D 226, Type II underlayment constructed from a non -perforated organic felt that is Asphalt Saturated saturated with asphalt. Organic Felt Application: The underlayment shall be installed with minimum 2" side laps and minimum 4' end laps. Allowable roof coverings: Attachment of asphalt shingles, metal roofing, clay and concrete tile, slate shingles, wood shingles, wood shakes, and roll roofing shall be permitted in accordance with the FBC. TAMKO® No. 30 UL ASTM D 226, Type II underlayment constructed from a non -perforated organic felt that is Asphalt Saturated saturated with asphalt. Organic Felt Application: The underlayment shall be installed with minimum 2" side laps and minimum 4' end laps. Allowable roof coverings: Attachment of asphalt shingles, metal roofing, clay and concrete tile, slate shingles, wood shingles, wood shakes, and roll roofing shall be permitted in accordance with the FBC. TAMKO® TW Metal and Self -adhered, flexible, ASTM D 1970, rubberized asphalt sheet membrane with a Tile Underlayment polymer film on the surface and a removable release film on the adhesive side. Application: The underlayment shall be attached by adhering directly to the roof deck with minimum 4" side laps and minimum 6' staggered end laps. Min. application temperature: 40'F Allowable roof coverings: Attachment of asphalt shingles, metal roofing, and mechanically fastened clay and concrete tiles shall be permitted In accordance with the FBC. TAMKO® TW Self -adhered, flexible, ASTM D 1970, rubberized asphalt sheet membrane with a Underlayment polymer film on the surface and a removable release film on the adhesive side. Application: The underlayment shall be attached by adhering directly to the roof deck with minimum 4" side laps and minimum 6" staggered end laps. Min. application temperature: 40'F Allowable roof coverings: Attachment of asphalt shingles and metal roofing shall be permitted in accordance with the FBC. TAMKO® TAM -FELT Alternate to ASTM D 226, Type I and Type II underlayment constructed from a non - perforated organic felt that is saturated with asphalt. Application: The underlayment shall be installed with minimum 2' side laps and minimum 4" end laps. Allowable roof coverings: Attachment of asphalt shingles shall be permitted in accordance with the FBC. TBP14001.3 FL12328-R7 Page 3 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TAMKO BUILDING PRODCUTS, INC. TAMKO Underlayments TECHNICAL SERVICES, LLC LIMITATIONS 1) This evaluation report is not for use in the HVHZ. 2) Fire Classification is not within the scope of this evaluation. 3) Wind uplift resistance in not within scope of this evaluation. 4) Installation of the evaluated product shall comply with this report, the FBC, and the manufacturer's published application instructions. Where discrepancies exist between these sources, the more restrictive and FBC compliant installation detail shall prevail. 5) Minimum application temperature shall be 50'F unless otherwise noted. Contact the manufacturer when installing at temperatures below the minimum application temperature. 6) Deck substrates shall be clean, dry, and free from any irregularities and debris. All fasteners in the deck shall be checked for protrusion and corrected prior to underlayment application. 7) The roof deck shall be constructed of closely fitted sheathing for new or existing construction. Roof deck shall be installed in accordance with FBC requirements. 8) Unless otherwise stated, the minimum roof slope shall be in accordance with FBC requirements. 9) All underayments shall be installed with the roll length parallel to the eave, starting at the eave, and lapped in successive courses installed up the deck in a manner that effectively sheds water from the deck. End laps shall be staggered between courses in accordance with the manufacturer's application instructions. 10) The underlayment may be used as described in other current FBC product approval documents. 11) The underlayment shall not be installed over existing roof coverings. 12) Contact the manufacturer regarding specific exposure limits for each underlayment. 13) All products listed in this report shall be manufactured under a quality assurance program In compliance with Rule 61620-3. COMPLIANCE STATEMENT The products evaluated herein by Zachary R. Priest, P.E. have demonstrated compliance with the Florida Building Code, 5"' Edition (2014) as evidenced in the referenced documents submitted by the named manufacturer. ttt111rr//1I p,FtY R. Ell No 74021 IZ STATE OF '•IJJ Z 0T' P:'': 0F1 N CERTIFICATION OF INDEPENDENCE 2016.08.2 2 09:35:39 0400' Zachary R. Priest, P.E. Florida Registration No. 74021 Organization No. ANE9641 CREEK Technical Services. LLC does not have, far will it acquire, a financial Interest in any company manufacturing or distributing products under (his evaluation. CREEK Technical Services, LLC Is not owned, operated, or controlled by any company manufacturing or distributing products under this evaluation. Zachary R. Priest, P.E. does not have, nor will acquire, a financial Interest In any company manufacturing or distributing products under this evaluation. Zachary R. Priest, P.E. does not have, not will acquire, a financial Interest In any other entity Involved In the approval process of the product. END OF REPORT TBP14001.3 FL12328-R7 Page 4 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report Is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. 4/28/2017 Florida Building Code Online Florida r i •:ram+:;=+r.41i , . r. 1 ' i SCIS Home ( Log In ( User Registration ; Not Topics I submit Surcharge I Slats & Facts ( Publications ( FBC Staff I SCIS Site Map ( Links ( search IQ.' Product Approval USER: Public user Product Approval Menu > Product or Anolintion Search > Application List > Application Detail FL # Application Type Code Version Application Status Comments Archived droduct Manufacturer Address/Phone/Email Authorized Signature Technical Representative Address/Phone/Email Quality Assurance Representative Address/Phone/Emall Category Subcategory Compliance Method Florida Engineer or Architect Name who developed the Evaluation Report Florida Ucense Quality Assurance Entity Quality Assurance Contract Expiration Date Validated By Certificate of Independence Referenced Standard and Year (of Standard) Equivalence of Product Standards Certified By Sections from the Code FL5444-RIO Revision 2014 Approved CertainTeed Corporation -Roofing 18 Moores Road Malvern, PA 193SS 610) 651-5847 mark.d.harner@saint-gobain.com Mark Harper mark.d.harner@saint-gobain.com Mark D. Harrier 18 Moores Road Malvern, PA 193SS 610) 6S1-S847 Mark. D.Harner@saint-gobain.com Roofing Asphalt Shingles Evaluation Report from a Florida Registered Architect or a Ucensed Florida Professional Engineer l Evaluation Report - Hardcopy Received Robert Nleminen PE-59166 UL LLC 03/09/2020 John W. Knezevich, PE f' Validation Checklist - Hardcopy Received FL5444 RIO COI 2016 01 COI Nleminen.Ddf Standard Year ASTM D3161, Class F 2009 ASTM D3462 2009 ASTM D71S8, Class H 2O08 https:itwww.floridabuilding.org/pr/Pr_app dU.aspx?param=wGEVXQwtDgtah1g07CSsoycOr128CcpCJinUeXwTibKvIUzOW4hL8w%3d%3d 1/2 4/28/2017 Florida Building Code Online Product Approval Method Method 1 Option O Date Submitted 12/08/2016 Date Validated 12/14/2016 Date Pending FBC Approval 12/15/2016 Date Approved 02/07/2017 Sum iinaryo?Products --- 4----... :. --- —_ :.. -. ,.•_`..•. - _.. ____ FL ft Model, Number or Name Des :rlptioh- 5444.1 CertalnTeed Asphalt Roofing 3-tab, 4-tab, strip (no -cut-outs), laminated and architectural Shingles asphalt roof shingles Limits of Use Installation Instructions Approved for use In HVHZ: No Approved for use outside HVHZ: Yes FLS444 R10 It 2016 12 FINAL ER CERTAINTEED Asphalt Shlnale FL5444-R10.odf Impact Resistant: N/A Verified By: Robert Nieminen, PE PE-59166 Design Pressure: N/A Created by Independent Third Party: Yes Other: Refer to ER Section 5 for Umits of Use Evaluation Reports FL5444 R10 AE 2016 12 FINAL ER CERTAINTEED Asphalt Shinale FL5444-1110.pdf Created by Independent Third Party: Yes 9_10 Contact Us :: 2601 Blair Stone Road. Tallahassee FL 32399 Ptone: OSG-487-1824 The State of Florida Is an AA/EEO employer. Coovdaht 2007-2013 State of Florida.:: Privacy Statement :: Accesribllhr Statement :: Refund Statement Under Florida law, email addresses are public records. if you do not want your e-mail address released In response to a public -records request, do not send electronic mall to this entity. Instead, contact the office by phone or by traditional mall. if you have any questions, please contact BS0.487.139S. *Pursuant to Section 4SS.27S(L), Florida Statutes, effective October 1, 2012, licensees licensed under chapter 4SS, F.S. must provide the Department with an email address If they have one. The emalls provided may be used for official communication with the licensee. However email addresses are public record. If you do not wish to supply a personal address, please provide the Department with an email address which can be made available to the public. To determine If you are a licensee under Chapter 4SS, F.S., please click bM. Product Approva l Accepts: Credit Card Safe https:UWww.floridabuilding.orglpr/pr app till.aspx?param=wGEVXQwtDgtahlgO7CSsoycOr128CcpCJinUeXw7iWvlUzOW4hL8w%3da/o3d W TRINITY EVALUATION REPORT CertainTeed Corporation 20 Moores Road Malvern, PA 19355 EXTERIOR RESEARCH & DESIGN, I.I.C. Certificate of Authorization #9503 353 CHRISTIAN STREET, UNIT #13 ERD OXFORD, CT 06478 PHONE: (203) 262-9245 FAX: (203) 262-9243 Evaluation Report 3532.09.05-1131 FLS444-R10 Date of Issuance: 09/22/200S Revision 11: 12/08/2016 SCOPE: This Evaluation Report is issued under Rule 61G20-3 and the applicable rules and regulations governing the use of construction materials in the State of Florida. The documentation submitted has been reviewed by Robert Nieminen, P.E. for use of the product under the Florida Building Code and Florida Building Code, Residential Volume. The products described herein have been evaluated for compliance with the Sth Edition (2014) Florida Building Code sections noted herein. DEscRiPnON: CertainTeed Asphalt Roofing Shingles. LA9EUNG: Labeling shall be in accordance with the requirements of the Accredited Quality Assurance Agency noted herein and FBC 1S07.2.7.1 / R90S.2.6.1 CONTINUED COMPLIANCE: This Evaluation Report is valid until such time as the named product(s) changes, the referenced Quality Assurance documentation changes, or provisions of the Code that relate to the product change. Acceptance of this Evaluation Report by the named client constitutes agreement to notify Robert Nieminen, P.E. if the product changes or the referenced Quality Assurance documentation changes. TrinityJERD requires a complete review of this Evaluation Report relative to updated Code requirements with each Code Cycle. ADVERTISEMENT: The Evaluation Report number preceded by the words "Trinity)ERD Evaluated" may be displayed in advertising literature. If any portion of the Evaluation Report is displayed, then it shall be done in Its entirety. INSPECTION: Upon request, a copy of this entire Evaluation Report shall be provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This Evaluation Report consists of pages 1 through 12. Prepared by: Robert J.M. Nieminen, P.E. Florida Registration No. 59166, Florida DCA ANE1983 The facsimile seal appeo(N was authorized by Robert Nlemintn. P E on 12/08/2016. serve asdoesnotseasan eleetradally $*%ad document. Slened, sealed hardcoples ha" been transmitted to the Product Approval Adminhtrater and to the named Went CERTIFICATION OF INDEPENDENCE: 1. Trinity) ERD does not have, nor does it intend to acquire or will it acquire, a financial interest in any company manufacturing or distributing products it evaluates. 2. TrinitVI ERD is not owned, operated or controlled by any company manufacturing or distributing products It evaluates. 3. Robert Nieminen, P.E. does not have nor will acquire, a financial interest in any company manufacturing or distributing products for which the evaluation reports are being Issued. 4. Robert Nieminen, P.E. does not have, nor will acquire, a financial interest in any other entity involved in the approval process of the product. 5. This is a building code evaluation. Neither Trinity IERD nor Robert Nieminen, P.E. are, in any way, the Designer of Record for any project on which this Evaluation Report, or previous versions thereof, Is/was used for permitting or design guidance unless retained specifically for that purpose. J TRINITY l ERD I ROOFING SYSTEMS EVALUATION: 1. SCOPE: Product Category: Roofing Sub -Category: Asphalt Shingles Compliance Statement: CertalnTeed Asphalt Roofing Shingles, as produced by CertainTeed Corporation, have demonstrated compliance with the following sections of the Sth Edition (2014) Florida Building Code and Sth Edition 2014) Florida Building Code, Residential Volume through testing in accordance with the following Standards. Compliance is subject to the Installation Requirements and Limitations / Conditions of Use set forth herein. 2. STANDARDS: Section Pro a Standard Year 1507.2.5, R905.2.4 Physical Properties ASTM D3462 2009 1507.2.7.1, R905.2.6.1 Wind Resistance ASTM 03161, Class F 2009 1507.2.7.1, R905.2.6.1 Wind Resistance ASTM 071S8, Class H 2O08 3. REFERENCES: Enti Examination Reference Oate UL (TST 1740) ASTM D3161 94NK9632 05/15/1998 UL (TST 1740) ASTM D3161 99NK26506 11/23/1999 UL (TST 1740) ASTM D3161 03CA12702 05/27/2003 UL (TST 1740) ASTM D3161 03CA12702 06/16/2003 UL(TST 1740) ASTM D3161 03NK29847 10/03/2003 UL (TST 1740) ASTM D3161 04CA11329 05/24/2004 UL(TST 1740) ASTM 03161 04CA32986 12/03/2004 UL (TST 1740) ASTM 03161 OSNK07049 04/15/2005 UL (TST 1740) ASTM 03161 OSNK16778 05/12/2005 UL(TST 1740) ASTM D3161 OSCA16778 05/12/2005 UL (TST 1740) ASTM D3161 OSNK14836 05/22/2005 UL (TST 17401 ASTM D3161 OSNK22800 06/22/2005 UL (TST 1740) ASTM D3462 R684 09/21/2005 UL (TST 1740) ASTM D7158 OSNK08037 06/28/2006 UL (TST 1740) ASTM D3161 & D3462 09CA28873 07/23/2009 UL (TST 1740) ASTM D3462 IOCA41303 10/07/2010 UL (TST 1740) ASTM D3161 10CA41303 10/08/2010 UL (TST 1740) ASTM D7158 10CA41303 10/27/2010 UL (TST 1740) ASTM D3161 & D3462 10CA44960 11/11/2010 UL LLC (TST 9628) ASTM D3161, D3462 & D7158 13CA32897 11/21/2013 UL LLC (TST 9628) ASTM 03161, 03462 TFWZ.R684 04/22/2014 UL LLC (TST 9628) ASTM D7158 TGAH.R684 04/22/2014 UL LLC (TST 9628) ASTM D3161 & 03462 4786334434 09/16/2014 UL LLC (TST 9628) ASTM D3161 & D3462 4786570826 02/12/2015 UL LLC (TST 9628) ASTM 03161, D3462 & D7158 4786570717 12/16/2015 UL LLC (TST 9628) ASTM D3161 & 03462 4787195678 02/09/2016 UL LLC (TST 9628) ASTM 03161, D3462 & D7158 4787380356 10/26/2016 UL LLC (TST 9628) ASTM 03462 4787380357 10/13/2016 UL LLC (TST 9628) ASTM 07158 4787380357 11/08/2016 UL LLC (TST 9628) ASTM 03161 4787380357 11/09/2016 UL LLC (QUA 9625) Quality Control Service Confirmation Exp. 07/03/2017 Exterior Research and Design, I.I.C. Evaluation Report3532.09.OS•RIL Certykate Of Authorltatlon 09503 FBC NON•HVH2 EVALUATION FLS444-R10 Revision 11:12/08/2016 Page 2 of 12 RINITY ERD 4. PRODUCT DESCRIPTION: 4.1 CT20'", XT'" 25, XT'" 30 and XT'" 30 IR are fiberglass reinforced, 3-tab asphalt roof shingles. 4.2 Arcadia'", Belmont"", Carriage House Shangle*, Grand Manor Shangle•, Landmark'", Landmark'" IR, . Landmark" Pro, Landmark'" Premium, Landmark'" TL, Landmark`" Solarls and Landmark"" Solaris IR are fiberglass reinforced, laminated asphalt roof shingles. 4.3 NorthGatel is a fiberglass reinforced, laminated, SBS modified bitumen roof shingle. 4.4 Presidential Shake'", Presidential Shake' IR, Presidential Shake TL'" and Presidential Solaris"' are fiberglass reinforced, architectural asphalt roof shingles. 4.5 Hatteras'", Highland Slate'" and Highland Slate' IR are fiberglass reinforced, 4-tab asphalt roof shingles. 4.6 Patriot"' is a fiberglass reinforced asphalt roof strip -shingle (with no cut-outs) providing a laminated appearance through an intermittent shadow line with contrasting blend drops for color definition. 4.7 Presidential Accessory, Accessory for Hatteras, Shangle Ridge'", Shadow Ridge"', Cedar Crest', Cedar Crest'" IR, NorthGate Ridge and NorthGate Accessory are fiberglass reinforced accessory shingles for hip and ridge installation. 4.8 Any of the above listed shingles may be produced In AR (algae resistant) versions. S. LIMITATIONS: 5.1 This is a building code evaluation. Neither TrinityJERD nor Robert Nieminen, P.E. are, in any way, the Designer of Record for any project on which this Evaluation Report, or previous versions thereof, is/was used for permitting or design guidance unless retained specifically for that purpose. 5.2 This Evaluation Report is not for use in the HVHZ 5.3 Fire Classification Is not part of this Evaluation Report; refer to current Approved Roofing Materials Directory for fire ratings of this product. 5.4 Wind Classification: SAA All shingles noted herein are Classified in accordance with FBC Tables 1507.2.7.1 and R905.2.6.1 to ASTM 03161, Class F and/or ASTM D71S8, Class H, Indicating the shingles are acceptable for us in all wind zones up to V„d = 150 mph (V„I, = 194 mph). Refer to Section 6 for installation requirements to meet this wind rating. S.4.2 Presidential Accessory, Accessory for Hatteras, Shangle Ridge, Shadow Ridge, Cedar Crest, NorthGate Ridge and NorthGate Accessory hip & ridge shingles have been evaluated in accordance with ASTM 03161, Class F. All except NorthGate Ridge and NorthGate Accessory require use of BASF Sonolastic NP 1 adhesive or Henkel PLO Polyurethane Roof & Flashing Sealant, applied as specified in manufacturer's application instructions, for use In wind zones up to V„d =150 mph (VI, =194 mph). 5.4.3 Classification by ASTM 07158 applies to exposure category B or C and a building height of 60 feet or less. Calculations by a qualified design professional are required for conditions outside these limitations. Contact the shingle manufacturer for data specific to each shingle. 5.4.3.1 Analysis In accordance with ASTM D7158 indicates the measured uplift resistance (RA for the CertainTeed asphalt roofing shingles listed in Section 4.1 through 4.6 (except Presidential Salads') exceeds the calculated uplift force (FT) at a maximum design wind speed Of V„d = 150 mph (V„I, = 194 mph) for residential buildings located in Exposure D conditions with no topographical variations (flat terrain) having a mean roof height less than or equal to 60 feet. The shingles are permissible under Code for installation in these conditions using the installation procedures detailed in this Evaluation Report and CertainTeed minimum requirements, subject to minimum codified fastening requirements established within any local jurisdiction, which shall take precedence. 5.5 All products in the roof assembly shall have quality assurance audits in accordance with the Florida Building Code and F.A.C. Rule 61G20-3. Exterior Research and Design, I.I.C. Evaluation Report 3S32.09.0S4t11 Cerdfleate of Authotfiodon #9S03 FBC NON-HVH2 EVALUATION FLS44441110 Revision 11: 12/08/2016 Page 3 of 12 l 1 T, INITY i ERD 6. INSTALLATION: 6.1 Roof deck, slope, underlayment and fasteners shall comply with FBC iS07.2 / R90S.2 and the shingle manufacturer's minimum requirements. 6.1.1 Underlayment shall be acceptable to CertainTeed Corporation and shall hold current Florida Statewide Product Approval, or be Locally Approved per Rule 61G20-3, per FBC Sections 1S07.2.3, 1SO7.2.4 or R90S.2.3. 6.2 Installation of asphalt shingles shall comply with the CertainTeed Corporation current published Instructions, using minimum four (4) nails per shingle in accordance with FBC 1SO7.2.7 or Section R90S.2.6 and the minimum requirements herein. 6.2.1 Fasteners shall be in accordance with manufacturer's published requirements, but not less than FBC 1S07.2.6 or R90S.2.S. Staples are not permitted. 6.2.2 Where the roof slope exceeds 21 units vertical in 12 units horizontal, use the "Steep Slope" directions. 6.3 CertalnTeed asphalt shingles are acceptable for use in reroof (tear -off) or recover applications, subject to the limitations set forth in FBC Section 1510 and CertalnTeed published installation instructions. 6.4 CT201-, XTr" 2S, XT-.30, XTr" 30 IR: . - ' .. ' . LUW AMU )1AMUAHU )Curt STEEP SLOPE ENGLISH 12" 12" 12" Use four nalls and six spots of asphalt roollng cement* for every fullVSmm) (305 r m) (305 nm) shingle (Figuro 11-4). Asphalt roofing cement meeting ASTM 04586 1'• (25 mm) — Sealantlant I (25 mm) Type 11 is suggested. 5 sla" (145 on) — 5W-lotAbrrood ---- — — — — — — — 1 METRIC _ 131N. - - 131/8" - 131/8'• - - Roofing cement I"(25 mm) — Sealantlant — 1" (25 on) Apply 1"(25 non) spots of asphalt roofing cement under each tab conmr. 61 fg Figircnt 11.4. Use four nails and sir rpok gfaspGall amen! on sleep skpas CAIIffOX Excessive use of roofing cement can cwse shingles to blister. Ngum 11.3: Usefournailsfora-yfrJlshingfa 6.4.1 Hip & Ridne for CT20s , X" 2S, XT'" 30, XTr" 30 IR: Cut Shingles 2 1 -11— I 2 (50nm) 1 A0 Ir1-t 1"I 1 5 ^t2 (3t15mn)—' \Eases 125tnm11 Cap Cap 305Imm) Shingle Shingle Shingle P\q Figuro 11.24. 6W tabu, Emit Mtn back to asake cap shingles b'nglisb dlnuatslons sboum). figure 11-25:1nslaUallon of caps along I& hips and rfdger. 6.4.1.1 For ASTM D3161, Class F performance use BASF "Sonolastic• NPI" " adhesive or Henkel "PL' Polyurethane Roof & Flashing Sealant", in accordance with CertainTeed requirements. Exterior Research and Design, LLC. Evaluation Report 3532.09.OS-Rll Certillcote o/Authortiotlon p9503 FBC NON-HVH2 EVALUATION FLS444-R10 Revision 11: 12/08/2016 Page 4 of 12 6.5 6.5.1 ARCADIAT A. LOW AND STANDARD SLOPE STEEP SLOPE Use SIX nalls Inc even' fill shingle located as shown helon: Rd iLu naa roatm Figure 3: U,t• six nails f,r crerr firll ,slibigle. r am, 1,jTRINITY I ERD Ike SIX a:tils aad FOUR spots of :upltalt mofing cement for mery (till shingle as shown help w..:lpply upltrlt mnfing cein it V(2i no11) from edge of shingle. Asphalt roofing cen:eul mewing .1611t D •iiBG 14pe It is soy"ge.led. Hip & Ridee for Arcadia': Cedar Crest'", Cedar Crest'" IR f 1'QSfnll 1'1?S°ml— r4•; ov ;i: NSa Sir units crud ja,' S/Nds a%asphull lvmfir(j Cement on 4#rp Slopes. Use two (2), minimum 1'Y.-inch long fasteners per shingle. for the starter shingle, place fastener 1-inch from each side edge and about 2-inch up from the starter shingle's exposed butt edge, ensuring minimum inch embedment into the deck, or full penetration through the deck. for each full Cedar Crest shingle, place fasteners 8-5/8-inch up from its exposed butt edge and 1-inch from each side edge. For ASTM D3161, Class F performance use BASF "Sonolastic• NP1'"" adhesive or Henkel "PLO . Polyurethane Roof & flashing Sealant", in accordance with CertainTeed requirements, to hand -seal Cedar Crest shingles. Apply NP 1 or PL adhesive from the middle of the shingle's raised overlay on the top piece and extending approximately 4-inch along the sides of the headlap along a line % to 1-inch from each side of the shingle's headlap. Immediately align and apply the overlying shingle, gently pressing tab sides into the adhesive, and install nails. To secure the other side, apply a 1-inch diameter spot of NP 1 or PL adhesive between the shingle layers. Exterior Research and Design, U.C. C&Wficate ofAuthorization 89S03 FBC NON-HVHZ EVALUATION Hand - sealing adhesive 4° 1/ 4" 3! 4" — I •— 1° Dab of asphalt cement between — shingle layers 1" Evaluation Report 3532.09.0S-R11 FL5444- R10 Revision 11:12/08/2016 Page 5 of 12 6.6 I BELMONT-: Low and Standard Slope 2:12 to 21:12): Use FIVE nails for every full Belmont shingle, located as shown below. sw (1eom) o Add-dwtl roils d mrrited e Ye' t?2onml ITRINITY I ERD Steep Slope (greater than 21:12): Use SEVEN nails and EIGHT spots of asphalt roofing cement" for every full Belmont shingle. Apply asphalt roofing cement 1" (25mm) from edge of shingle. See below. Asphalt roofing cement meeting ASTNI 04586 Type II is suggested. 1' 12S M14 Roofing Ika tna 6.6.1 Hip & Ridge for Belmont"": 6.6.1.1 Option 1: Refer to instructions herein for Cedar Crest'", Cedar Crest'" IR hip and ridge shingles. 6.6.1.2 Option 2: Shangle" Ridge 12% Remove TIti9 Tape Exposure Remove tape from the right side and fasten III SECOND RIGHT LEFT F/gnfe 17-19. Inslallallon of.Tbanglo® Rldge sbltrgles Figure 17-18. Shangleo Ridge. Oil blps and Ndges. 6.6.1.3 for ASTM 03161, Class F performance use BASF "Sonolastic° NPi'"" adhesive or Henkel "PLO Polyurethane Roof & flashing Sealant", in accordance with CertainTeed requirements. I MoMW I Exterior Research and Oesign,LLC. Evaluation Report3S32.09.0S-R11 Certykote ofAuthorization #9502 F8C NON-HVH2 EVALUATION FLS444-R10 Revision 11: 12/09/2016 Page 6 of 12 6.7 6.7.1 6.8 CARRIAGE HOUSE SHANGLEO AND GRAND MANOR SHANGLE®: LOW AND STEEP SLOPE STANDARD SLOPE lice five nails for evey full 8ltaugle. I —as nm) (2s1mm) 5 1s nan) (21.0 mlir) l. I•ignrd /7- tr the/fn! nnflt jnr rYr.TfiditirvnAAlarmr,t'1mnAlr', l.'dnlrrlar 11018sc Mlwngk. ar P.enMrurlal Sbl1e. r f TRINITY I ERD U,m sevea nails mid three .rytuts of :rsphah roofing'mica( for every hdl Grtud Slanur Shaooc. ilk five nails and dine :pots of asplmll rarfing ceutem for every full Urriage Iluasr' ShanglC aorl (kuunulal SI21c. Apply aytlr:dt nmfing rvmtem 1' (15 sun) fnrtu (Age. of sbingle Fl8nm /7.S). AWphab nwfing centem urwalug AblIt 0,158611pe 11 11 suggested. M 1:01;L 16mm1r\ 1}1 Rgure 17-5: When iusBfthip Grrnrd.IknrorSbangi t mrsleep .do/r% rue saren calla and thnr sputt ofasphdil nwgirrg r ewpar. Hip & Ridge for Carriaee House Shanele° and Grand Manor Shanale: Refer to instructions herein for ShangleO Ridge hip and ridge shingles LANDMARK'", LANDMARK'" IR,.LANDMARK'" PRO, LANDMARK'"' PREMIUM, LANDMARK"" TL, LANDMARK''" S& A' RIs, LANDMARK'" SOLARIS IR; NORTHGATE: LOW AND STANDARD SLOPE METRIC DIMENSIONS IT' 143/4" 17' 1--( 305 mm}- --(315 mm)-- --(305 aim)-- tv: tt 9&imo.-, ''YLr: I ' ( 2S mm) kelCaSe -aye I" (7.5 am) I 11rr_• Nailabl0 Arcs LANDMARK TL NorthGate: 13W 13" 111/P' 343 mot) --(330 mm)-- --(343 mm)--I I- r (25 mm) 1" (25 nim) --EME M = 7gnro 1.1•4: (,*fourwells jnr ereq•fidl sbillye WS uM IV MFA 12" 14 314' 12' I+ ( 305 mm) (375 am) —' +- (305 mm) - j Naling L4tts r(25ma) nopoMll P(2imm Ra&g arias for low and stmtdsrtl dopes (tan 2:12 to 21121 Nal beween upper d krem Ines ms --Wn alurvn. Exterior Research and Design, I.I.C. Evaluation Report 3532.09.0S-R11 tertrykate of Authorization 09S03 FOC NON-HVH2 EVALUATION FL5444-R10 Revision 11: 12/08/2016 Page 7 of 12 STEEP SLOPE Use six nails and fuur spots of asplra t roofing cement for every fill laminmed sldngle. Wx helow. Asplclt roofing cement should meet A.1TAt 04586 lype If. Apply I' spots of asphalt roofing cement uncle etch corner and al about 12' to 13" iu from each edge. METRIC DIMENSIONS 305 nm) Nal Area _. ••— F. 12"— 375 mm) 005 mm) Tape I"(25 mm)- TRINITY I ERD LANDMARK TL 13'/2" 343 mm) 330 mm) 343 flan) 1"(25 mm) 1111 M 14MMIR.waft Figure 13-5. Use six nark amlfour spots ofM/ - U-I.. asp/xdl moflng cement on sleep slopes. arknt; ing Cement NorthGate: STEEP 12' 14-314' 12' SLOPE 1•»-(305 mm}-- — (375 mn#— 1 ---(305 mm}—jNAILING Nadin untrue 1'(25 mm) be dh. irne1'(25 mm}-- + nai meS. Nailing areas for steep slopes (greator than 21:12) and " Storn-Nall(ng" Nail between lower 2 nail 11nes as shown above. 6. 8.1 Hip & Ridge for Landmark'. Landmark'" IR, Landmark'" Pro, Landmark'" Premium Landmark'" TL Landmark'" Solaris. Landmark' Solaris IR. NorthGate: 6. 8.1.1 Option 1: Shadow Ridge'" or NothGate Accessory 12' 97/r 305mm) ( 25To t6' 415AT-415/16'(150mm) ( 150mm) (125mm)25mm) Notch for Centering IT / 7 15mm) Notches for Nipnme'to the Top Edge of the Preus r Cepror5'( 125mm)fxure fl— English Dimensi Shadow Ridge'" Exterior Research and Oeslgn, U.C. Certificate of Authortratlon e'9S03 fBC NON•HVH2 EVALUATION Notch for Cantering 7 3p71nm) Notches for Alignment to 1 76/ 8, theTopEdgeofthePreviousCap lcr5SA8'(141mm)Etpmre 196mm) Metric Olmenslon Shadow Rldge'" Evaluation Report 3532.09.0S-R11 FLS444- R10 Revision it: 12/09/2016 Page 8 of 12 TRINITY I ERD 9 2Z32• 2511 nvul, 4 W16' 1125 Inn) t tre" Cl MAJ,, N.:Ich Fe-6 W-61-d-6 S/e'III(t 68 mm)II 168 mm 33 114 i337rrin) \ Align th:se / CNntc aches IV top 7 Sr6' 13 U4' ` Notch g edge III(10L mc1) (337 mm) Nign thoso 1 planious coins. I 7 Si8- notches to top (194 corn) edge ed 1 proilous course. NorthGate Ridge NorthGate Accessory 12" 705rnm) LoyNg Notch I1 I j I 510250n) I I lj/l_ Figure 13-W. Use laying noklot to =ier Minglra on kips and. rlejw, and to bade the comwi exposure 6.8.1.2 For ASTM 03161, Class F performance use BASF "Sonolastico NP1r` adhesive or Henkel "PLO Polyurethane Roof & Flashing Sealant", in accordance with CertainTeed requirements. 6.8.1.3 Option 2: Refer to instructions herein for Cedar Crest", Cedar Crest' IR hip and ridge shingles. Exterior Research and Design, I.M. Evaluation Report 3532.09.05-R31 CertiJkate oJAuthorlrotion 09503 FOC NON-HVH2 EVALUATION FL5444-RIO Revision It: 12/09/2016 Page 9 of 12 TRINITY I ERD 6.9 I PRESIDENTIAL SHAKE"", PRESIDENTIAL SHAKE'" IR, PRESIDENTIAL SHAKE TV", PRESIDENTIAL SOLARIS'": LOW AND STANDARD SLOPE: STEEP SLOPE: For low and standard slopes, use five nails for each full Presidential Par seep slopes, use nine nails for each full Presidential shingle and shingle as shown below. apply I' diameter spots of asphalt too&& cement under each shingle tab. After applying 5 nails in between die nailing guide Wes, apply 4 nails t' Nailing 40' above tab cutouts making certain tabs of overlong shingle cover nails. Guide tines (1016 flan) 5 1/4' 1:33mm) • . • 141/4' 1 tl2' 30 nun) (362 mm) NOTE: Apply nails on painted guideline. 1I Figure /64 AumningPtesdessdal and Presidmild 116 Sbake sbingles on Jew and stand and slopes 1 T V diameter asphalt ronnng cement Figure 16-7., Fastening Presidmild and•Presidentid T/6 Shake sbtlssles on steop slopes. 6.9.1 Hip & Ridge for Presidential Shake—. Presidential Shake' IR, Presidential Shake TL"". Presidential Solarisl: 6.9.1.1 Option 1: Presidential Accessory PRESIDENTIAL ACCESSORY Presidential accessory shingles can'be used for covering hips and ridges. Apply shingles up to the ridge (expose no more Than 7• from the bottom edge of the "tooth." Fasten each accessory with two fas. tener's. The fasteners must be 13/4' long or longer, so they penetrate. either 3/4' Into the deck or completely through the deck. Presidential accessory comes in two different sizes: Accessory produced In Birmingham, AL -Is 12' x 12% Portland, OR produces 97/8' x I31/4" accessory. 6.9.1.2 For ASTM 03161, Class F performance use BASF "Sonolastic• NP11" adhesive or Henkel "PLO Polyurethane Roof & Flashing Sealant", in accordance with CertainTeed requirements. 6.9.1.3 Option 2: Refer to Instructions herein for Cedar Crest'", Cedar Crest"" IR hip and ridge shingles. 6.10 HATTERASr~: 104 STANDARD AND STEEP SLOPE: 17tmre 15d: riMr"Gg 1141/enn SM44or on Lrnr anASlasntnrd.Vopea ror Itn" and aanttan! slopes. use Me nails for each fail Ilnnents dslnRlr as sluhnt nime. mm) 1.--.1—s—flowina Ceumnl—t—J---.—t Firm 15. v tmaman} "a.nmPafa/er Fir steep dole-,, the the nails and dslu spats of mplttlt runang c l"d far each fall HAM= shtotee u shnaa ahme. Apply I' ItSnan) 41blatscr spots of nto0al ceunat CiStAi n 4596 Alv 11 wg•,r>taq undM rarh Into nuet.T. Pms AM& luto plicr, do aat e%pow eemem. WUnON: T us much ntnGt; aauvt mt cause shfiiOys to hlistee Exterior Research and Design, U.C. Evaluation Report 3S32.09.OS-Rll Certificate a/Authorization 09503 F6C NON-HVHZ EVALUATION FLS444-R10 Revision 11: 12/08/2016 Page 10 of 12 TRINITY I ERD 6.10.1 Hip & Ridge for Hatteras"": 6.10.1.1 Option 1: Accessory for Hatteras K Figure 15-14. 18 three piece emits separate to make 54 Hatteras Atxessoly shingles, 6.10.1.2 Option 2: Cut Hatteras Shingles r-9" 230 M ) I I I I I F460 Mir) t g ca 203 lnm) _ .r c o\h tears 460mfn). Cap Cap ShingleL Cap` sShingleShingle9 Figure 15-20.• Cut Halteras shingles to ruake caner cap. Figure 15-21. Installation of caps along hips and ridges. 6.10.1.3 for ASTM 03161, Class F performance use BASF "Sonolastice NPIL"I" adhesive or Henkel PLO Polyurethane Roof & flashing Sealant", in accordance with CertainTeed requirements. 6.11 HIGHLANf) SLATE'"r HI6HLANO SLATE'"" IR: n LOW AND STANDARD SLOPE: STEEP SLOPE: Plgum 11 ••i: ese M nailsforeray Blgblauf Sfate sbbtgla Ise FIVE nails and RIGHT spots of asphalt roofing cement' foe mch full tllghland Slate shingle. For Miami0ade, SIX liMs are required. Apply r diameter spots of aythall roofing cement under each tab corner. Asphah roofing Cement meeting ASTM WS86 Type n is suggested. r v r— —v yt". no tm.wl f+?n l pJOM LR Yai: Om ipule /'QSam1 U" sa oMoAa 1 r• r• r : • Yuw wreralr Rooting Carat Figure II Use RYE nails and elgbt sport ofespball rooJtng ou nant under saeb rob corner CAIrr1UN: licc/sshe use of roofing cement ran cause shingles to blister. 6. 11.1 Hip & Ridee for Highland Slate'", Hiehland SlateTM' IR: Refer to instructions herein for Cedar Crest'", Cedar Crest'" IR or Shangle Ridge'" hip and ridge shingles. Exterior Research and Design, LLC. Evaluation Report 3S32.09.OS-Rll Certlticott olAuthortiotion 99S03 FBC NON-HVHZ EVALUATION FLS444•RlO Revision 11:12/08/20LS Page 11 of 12 1 J TRINITY , ERD 6.12 PATRIOT'": : LOW AND STANDARD SLOPE STEEP SLOPE Ust. I'OI:R mails lirr every full shingle Im.-Ile l as sluncn below. Satlun r--- irt;3' fi'P25rm) 1149 I I i1ll: nl ITAttxl ('-r-ry Use FOVIi nails and four shies of asphalt moving venicat for etrry full slaingte As shoav tw:lo% Asphalt nwifing cwtent ateding ANT61 04586 T)jtc It Lt Apply I'fli min) spots of asphalt nwi ing euncot z. shotvu. CAM 10\: rwessive use of roofing cement eau cause shingl s to bl6le•r. 1.-- — — — — — - a a' Nr in BaeOno eemeea 6.12.1 Hip & Ridee for Patriot'": Refer to instructions herein for Cedar Crest'", Cedar Crest'" IR, Shadow Ridge-, NorthGate or Shangle Ridge'" hip and ridge shingles. 7. LABELING: 7.1 Each unit shall bear a permanent label with the manufacturer's name, logo, city, state and logo of the Accredited Quality Assurance Agency noted herein. 7.2 Asphalt shingle wrappers shall indicate compliance with one of the required classifications detailed in FBC Table ISO7.2.7.1 / R90S.2.6.1. 8. BUILDING PERMIT REQUIREMENTS: As required by the Building Official or Authority Having Jurisdiction in order to properly evaluate the installation of this product. 9. MANUFACTURING PLANTS: Contact the named CIA entity for information on which plants produce products covered by Florida Rule 61G20-3 CA requirements. 10. QUALITY ASSURANCE ENTITY: UL LLC — QUA9625; (414) 248-6409; karen.buchmann@us.ul.com END Of EVALUATION REPORT Exterior Research and Design, U.C. Evaluation Report 3S32.09.05-1131 Certificate of AutAorhadon d9S03 FBC NON-HVHI EVALUATION FLS444-R10 Revision 11:12/08/2016 Page 12 of 12 EXTERIOR RESEARCH & DESIGN, I.I.C. Certificate ojAuthorization #9503 I 353 CHRISTIAN STREET, UNIT #13 J TRINITY i ERD OXFORD, CT 06478 PHONE: (203) 262-9245 FAX: (203) 262-9243 EVALUATION REPORT CertainTeed Corporation Evaluation Report 3532.09.05-1111 20 Moores Road FLS444-R10 Malvern, PA 19355 Date of Issuance: 09/22/200S Revision 11: 12/08/2016 SCOPE: This Evaluation Report is issued under Rule 61G20-3 and the applicable rules and regulations governing the use of construction materials in the State of Florida. The documentation submitted has been reviewed by Robert Nieminen, P.E. for use of the product under the Florida Building Code and Florida Building Code, Residential Volume. The products described herein have been evaluated for compliance with the Sth Edition (2014) Florida Building Code sections noted herein. DESCRIPTION: CertainTeed Asphalt Roofing Shingles. LABELING: Labeling shall be in accordance with the requirements of the Accredited Quality Assurance Agency noted herein and FBC iS07.2.7.1 / R90S.2.6.1 CONTINUED COMPLIANCE: This Evaluation Report is valid until such time as the named product(s) changes, the referenced Quality Assurance documentation changes, or provisions of the Code that relate to the product change. Acceptance of this Evaluation Report by the named client constitutes agreement to notify Robert Nieminen, P.E. if the product changes or the referenced Quality Assurance documentation changes. Trinity IERD requires a complete review of this Evaluation Report relative to updated Code requirements with each Code Cycle. ADVERTISEMENT: The Evaluation Report number preceded by the words "TrinitylERD Evaluated" may be displayed in advertising literature. If any portion of the Evaluation Report is displayed, then it shall be done in its entirety. INSPECTiow Upon request, a copy of this entire Evaluation Report shall be provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This Evaluation Report consists of pages 1 through 12. Prepared by: Robert J.M. Nieminen, P.E. Florida Registration No. 59166, Florida DCA ANE1983 The facslmlle seal appearing was authatited by Robert Nleminen, P.E an 12/08/2016. This does not serve as an electrenl ally signed doormen. Signed, sealed hardcopW have been transmitted to the Product Approval Administrator and to the named client CERTIFICATION OF INDEPENOENCE: 1. TrinitylERD does not have, nor does it intend to acquire or will it acquire, a financial Interest in any company manufacturing or distributing products It evaluates. 2. Trinity) ERD is not owned, operated or controlled by any company manufacturing or distributing products it evaluates. 3. Robert Nieminen, P.E. does not have nor will acquire, a financial interest in any company manufacturing or distributing products for which the evaluation reports are being issued. 4. Robert Nieminen, P.E. does not have, nor will acquire, a financial interest in any other entity involved In the approval process of the product. S. This is a building code evaluation. Neither Trinity IERD nor Robert Nieminen, P.E. are, in any way, the Designer of Record for any project on which this Evaluation Report, or previous versions thereof, Is/was used for permitting or design guidance unless retained specifically for that purpose. C) TRINITY I ERD ROOFING SYSTEMS EVALUATION: 1. SCOPE: Product Category: Roofing Sub -Category: Asphalt Shingles Compliance Statement: CertainTeed Asphalt Roofing Shingles, as produced by CertainTeed Corporation, have demonstrated compliance with the following sections of the Sth Edition (2014) Florida Building Code and Sth Edition 2014) Florida Building Code, Residential Volume through testing in accordance with the following Standards. Compliance is subject to the Installation Requirements and Limitations / Conditions of Use set forth herein. 2. STANDARDS: Section Property Standard Year 1507.2.5, R905.2.4 Physical Properties ASTM D3462 2009 1507.2.7.1, R905.2.6.1 Wind Resistance ASTM 03161, Class F 2009 1507.2.7.1, R905.2.6.1 Wind Resistance ASTM 07158, Class H 2O08 3. REFERENCES: taiint Examination Reference Date UL (TST 1740) ASTM D3161 94NK9632 05/15/1998 UL (TST 1740) ASTM D3161 99NK26506 11/23/1999 UL (TST 1740) ASTM D3161 03CA12702 05/27/2003 UL (TST 1740) ASTM D3161 03CA12702 06/16/2003 UL(TST 1740) ASTM D3161 03NK29847 10/03/2003 UL (TST 1740) ASTM D3161 04CA11329 05/24/2004 UL (TST 1740) ASTM D3161 04CA32986 12/03/2004 UL (TST 1740) ASTM D3161 05NK07049 04/15/2005 UL (TST 1740) ASTM D3161 OSNK16778 05/12/2005 UL (TST 1740) ASTM D3161 OSCA16778 05/12/2005 UL(TST 1740) ASTM D3161 05NK14836 05/22/2005 UL (TST 1740) ASTM D3161 OSNK22800 06/22/2005 UL(TST 1740) ASTM D3462 R684 09/21/2005 UL (TST 1740) ASTM D7158 OSNK08037 06/28/2006 UL(TST 1740) ASTM D3161 & D3462 09CA28873 07/23/2009 UL (TST 1740) ASTM D3462 IOCA41303 10/07/2010 UL(TST 1740) ASTM D3161 IOCA41303 10/08/2010 UL (TST 1740) ASTM 07158 10CA41303 10/27/2010 UL (TST 1740) ASTM D3161 & D3462 IOCA44960 11/11/2010 UL LLC (TST 9628) ASTM D3161, 03462 & 07158 13CA32897 11/21/2013 UL LLC (TST 9628) ASTM 03161, D3462 TFW2.R684 04/22/2014 UL LLC (TST 9628) ASTM D7158 TGAH.R684 04/22/2014 UL LLC (TST 9628) ASTM D3161 & D3462 4786334434 09/16/2014 UL LLC (TST 9628) ASTM D3161 & 03462 4786570826 02/12/2015 UL LLC (TST 9628) ASTM D3161, D3462 & 07158 4786570717 12/16/2015 UL LLC (TST 9628) ASTM D3161 & 03462 4787195678 02/09/2016 UL LLC (TST 9628) ASTM D3161, D3462 & D7158 4787380356 10/26/2016 ULLLC (TST 9628) ASTM D3462 4787380357 10/13/2016 ULLLC ( TST 9628) ASTM D7158 4787380357 11/08/2016 UL LLC ( TST 9628) ASTM D3161 4787380357 11/09/2016 UL LLC ( QUA 9625) Quality Control Service Confirmation Exp. 07/03/2017 Exterior Research and Design, U.C. Evaluation Report3S32.09.0S•R31 Certificate Ol Authoriration #9503 FOC NON•HVH2 EVALUATION FLS444-R 10 Revision 11: 12/08/2016 Page 2 of 12 J TRINITY 1 ERD 4. PRODUCT DESCRIPTION: 4.1 CT20'", XT"" 2S, XT` 30 and XT'" 30 IR are fiberglass reinforced, 3-tab asphalt roof shingles. 4.2 Arcadia'", Belmont'", Carriage House Shangle*, Grand Manor Shangle®, Landmark'", Landmark'" IR, Landmark'" Pro, Landmark'" Premium, Landmark' TL, Landmark"" Solaris and LandmarkTM Solaris IR are fiberglass reinforced, laminated asphalt roof shingles. 4.3 NorthGate"" is a fiberglass reinforced, laminated, SBS modified bitumen roof shingle. 4.4 Presidential Shake'", Presidential Shake'" IR, Presidential Shake TL' and Presidential Solaris'" are fiberglass reinforced, architectural asphalt roof shingles. 4.5 Hatteras'", Highland Slate'" and Highland Slate'" IR are fiberglass reinforced, 4-tab asphalt roof shingles. 4.6 Patriot"' is a fiberglass reinforced asphalt roof strip -shingle (with no cut-outs) providing a laminated appearance through an Intermittent shadow line with contrasting blend drops for color definition. 4.7 Presidential Accessory, Accessory for Hatteras, Shangle Ridge'", Shadow Ridge'", Cedar Crest'", Cedar Crest' IR, NorthGate Ridge and NorthGate Accessory are fiberglass reinforced accessory shingles for hip and ridge installation. 4.8 Any of the above listed shingles may be produced In AR (algae resistant) versions. S. LIMITATIONS: 5.1 This is a building code evaluation. Neither TrinitylERD nor Robert Nieminen, P.E. are, in any way, the Designer of Record for any project on which this Evaluation Report, or previous versions thereof, is/was used for permitting or design guidance unless retained specifically for that purpose. 5.2 This Evaluation Report is not for use in the HVH2 5.3 Fire Classification Is not part of this Evaluation Report; refer to current Approved Roofing Materials Directory for fire ratings of this product. 5.4 Wind Classification: 5.4.1 All shingles noted herein are Classified in accordance with FBC Tables 1507.2.7.1 and R90S.2.6.1 to ASTM 03161, Class F and/or ASTM D71S8, Class H, Indicating the shingles are acceptable for us in all wind zones up to V„d = 150 mph (V,,,t = 194 mph). Refer to Section 6 for installation requirements to meet this wind rating. 5.4.2 Presidential Accessory, Accessory for Hatteras, Shangle Ridge, Shadow Ridge, Cedar Crest, NorthGate Ridge and NorthGate Accessory hip & ridge shingles have been evaluated in accordance with ASTM D3161, Class F. All except NorthGate Ridge and NorthGate Accessory require use of BASF Sonolastic NP 1 adhesive or Henkel PLO Polyurethane Roof & Flashing Sealant, applied as specified in manufacturer's application Instructions, for use in wind zones up to V„d =150 mph (V„l, =194 mph). 5.4.3 Classification by ASTM D7158 applies to exposure category B or C and a building height of 60 feet or less. Calculations by a qualified design professional are required for conditions outside these limitations. Contact the shingle manufacturer for data specific to each shingle. 5.4.3.1 Analysis in accordance with ASTM D7158 indicates the measured uplift resistance (RT) for the CertainTeed asphalt roofing shingles listed in Section 4.1 through 4.6 (except Presidential Solaris'") exceeds the calculated uplift force (FT) at a maximum design wind speed Of V,sd = 150 mph (V,,,t = 194 mph) for residential buildings located in Exposure 0 conditions with no topographical variations (flat terrain) having a mean roof height less than or equal to 60 feet. The shingles are permissible under Code for installation in these conditions using the installation procedures detailed in this Evaluation Report and CertainTeed minimum requirements, subject to minimum codified fastening requirements established within any local jurisdiction, which shall take precedence. 5.5 All products in the roof assembly shall have quality assurance audits in accordance with the Florida Building Code and F.A.C. Rule 61G20-3. Exterior Research and Oeslgn, LLC. Evaluation Report 3S32.09.0S-1111 Certrykote of Autborkedon a9So3 FBC NON-HVHz EVALUATION FLS444-R10 Revision 11: 12/08/2016 Page 3 of 12 6. INSTALLATION: 6.1 6.1.1 6.2 6.2.1 6.2.2 6.3 6.4 6.4.1 J TRINITY 1 ERD Roof deck, slope, underlayment and fasteners shall comply with FBC 1SO7.2 / R905.2 and the shingle manufacturer's minimum requirements. Underlayment shall be acceptable to CertainTeed Corporation and shall hold current Florida Statewide Product Approval, or be Locally Approved per Rule 61G20-3, per FBC Sections 1S07.2.3, 1S07.2.4 or R90S.2.3. Installation of asphalt shingles shall comply with the CertainTeed Corporation current published instructions, using minimum four (4) nails per shingle in accordance with FBC 1507.2.7 or Section R905.2.6 and the minimum requirements herein. Fasteners shall be in accordance with manufacturer's published requirements, but not less than FBC 1507.2.6 or R90S.2.S. Staples are not permitted. Where the roof slope exceeds 21 units vertical in 12 units horizontal, use the "Steep Slope" directions. CertainTeed asphalt shingles are acceptable for use in reroof (tear -off) or recover applications, subject to the limitations set forth in FBC Section 1510 and CertainTeed published installation instructions. CT20'', XT'"" 25, XT'"" 30, XT" 30 IR: ENGLISH 12" IT' 12" 305 mn)— (305 tmQ--(305 um) i1r-1•'(25mm) _Selant_ I"(25mm)— 5 s/e" (145 nun) fm Al mod T METRIC t3f/a" t3!le" t34e" — 1"(25mm) _ plant 1"(25mm) 6 I/r, T Flgun 113:11sa/bur nallsjor query fu11 sbtngla STEEP SLOPE Use four nails and six spots of asphalt rooting cement• for every NII shingle (Figure 11-4). Asphalt roofing cement meeting ASN. 04536 type If Is suggested. I - Roofing Cement Apply 1" (25 mn) spots of asphalt fooling cement under each tab comer. Flgrin; ll-4.• Usefourpads andsix**;tofaspbdiewnenton•dnpslopu CAUTION. Excessive use of roofing cement can cause shingles to blister. Hip & Ridge for CT201. XTt" 2S. XTt" 30, XTIO 30 IR: Cut Shingles 251mm- - - i —.. 2(50 mm) Remove 11 j1 f f `I rshlagleapCapCzp305ffun) Shingle Shingle l Figuro 1I.24. W tabs, /bon Irlut back to twks otp sbinghn English dnnmulons sbou n). 1tY.'( 305mm)—J" Fad 125 mm) Moot cyan t15j1 ` o` Novo Flguma 11.25: Installation of asps along Ito hips and r/4-. 6. 4.1.1 For ASTM 03161, Class F performance use BASF "Sonolastic• NP101" adhesive or Henkel "PLO Polyurethane Roof & flashing Sealant", in accordance with CertainTeed requirements. Exterior Research and Design, I.I.C. Certificate of Authorisation 89S03 FBC NON-HVNZ EVALUATION Evaluation Report 3532.09.OS-R31 FLS444- R10 Revision 11:12/08/2016 Page 4 of 12 6.S 6.S.1 ARCADIA'": LOW AND STANDARD SLOPE I,'.a: MIX nails for every full shingle located as ihoan heloa: E mnl tttl Liu Ktt LYu figure l: 6e si.r urtilr fur ev.vq fitll sGingld. TRINITY I ERD Gsc Sf\ nails :uld FOUR spots of asphalt looriue ceulen( fur (ten full shingle as shown bcloly: Apple aglhrl( roofing crtincytt 1'(2; nlm) from edge. of shingle. Asphalt rooriag cement meeting XMi 0 4386 Type II is suggeacd. FiLwoe .1 Llvn SIX 111111S dud fluor ,vents of asplidet rtx+finr ceoucul on steep slopes. Hip & Ridee for ArcadiaTM': Cedar Crest'", Cedar Crest' IR Use two (2), minimum 1%-inch long fasteners per shingle. For the starter shingle, place fastener 1-inch from each side edge and about 2-inch up from the starter shingle's exposed butt edge, ensuring minimum Y..-inch embedment into the deck, or full penetration through the deck. For each full Cedar Crest shingle, place fasteners 8-5/8-inch up from its exposed butt edge and 1-inch from each side edge. For ASTM D3161, Class F performance use BASF "Sonolastic• NPi'"" adhesive or Henkel "PLO Polyurethane Roof & Flashing Sealant", in accordance with CertainTeed requirements, to hand -seal Cedar Crest shingles. Apply NP 1 or PL adhesive from the middle of the shingle's raised overlay on the top piece and extending approximately 4-inch along the sides of the headlap along a line''/. to 1-inch from each side of the shingle's headlap. Immediately align and apply the overlying shingle, gently pressing tab sides into the adhesive, and install nails. To secure the other side, apply a 1-inch diameter spot of NP 1 or PL adhesive between the shingle layers. Hand -se aling adhesive 1/4" r— 4. 314" 1° Dab of asphalt cement between 1 ° shingle layers Exterior Research and Design,I.LC. Evaluation Report 3S32.09.05-R31 Certrylcete of Authorhadan p9S03 FBC NON-HVHZ EVALUATION FLS444-R10 Revision 11: 12/08/2016 Page 5 of 12 6.6 I BELMONT'": Low and Standard Slope 2:12 to 21:12): Use FIVE nails for every full Belmont shingle, located as shown below. I12'(25Wn) Cr Ira 16am) I n o Mdalel rails d t"xtel I %®P e:A' 1lirte4l) r" TRINITY I ERD Steep Slope (greater than 21:12): Use SEVEN nails and EIGHT spots of asphalt roofing cement`" for every full Belmont shingle. Apply asphalt roofing cement t" (25mm) from edge of shingle. See below. Asphalt roofing cement meeting ASTM D4586 Type II is suggested. 1in, 11CWrl GI Wu f SIB' lie ffMI 1' ( rrtd A "("O Cemen 1 12Srtrt;—•I — 6. 6.1 Hip & Ridee for Belmont—: 6. 6.1.1 Option 1: Refer to instructions herein for Cedar Crest", Cedar Crest' IR hip and ridge shingles. 6. 6.1.2 Option 2: Shangle° Ridge Figure 17-18. Sbangle" Ridge. 71ZZ- 1 Fasten the left side' FIRST Exposure Remove tape from the right side g",_ l and fasten SECOyO RIGHT F/ glrre 17-19.' blslallallon ofSbanlgloO Ridge sbingles on blps and ridges. 6. 6.1.3 For ASTM 03161, Class F performance use BASF "Sonolastic• NP1'"" adhesive or Henkel "PLO Polyurethane Roof & Flashing Sealant", in accordance with CertainTeed requirements. Exterior Research and Design, U.C. Certilkote olAutheritation Moll PBC NON•HVH2 EVALUATION dW Evaluation Report M32.09.0S-rill FLS444- RSO Revision 11:12/08/2016 Page 6 of 12 6.7 6.7.1 6.8 TRINITY i ERD CARRIAGE -HOUSE SHANGLE® AND GRAND MANOR SHANGLEO: . LOW AND STEEP SLOPE STANDARD SLOPE l a: five nails for even' full Shangle. I' —I" I+ {2$mot) (25moo I- 510"Lj 65N' 06 (find (M mn) li'igurli 17- l: b*so]L r ridtls far m my fill Gt-asid:llanor Slmagbt 6arrbrge Natue Shigla or (.1mieurdal Slide. Use seven nails mid thmc s(xns of asphalt roofing ceinent.for every fill Grand M:mor Slmngle. t!u' rice nails :md ihfte slims of asphalt roofing cement for ew:rp full Carriage Ilouse Shangic and Centennial SI31c. Apply asphalt trxifing cemeni V (1i loot) from edge. of sliingle tlertt 17.5). Asphalt roofing cement meeting ASTM 04586 T4Iie If Is suggested. 16 figum 17.5: Il bru ivsbrfling fr'nrne.l6incrSbengles anurep doper. rise $area ndilr and ibr er spulr afnspkift niojiug fetter. Hip & Ridge for Carriage House Shangle' and Grand Manor Shanale: Refer to instructions herein for Shangle"s Ridge hip and ridge shingles LANDMARK"'; LANDMARK'":• IR, LANDMARK!"".PRO, LANDMARK'` PREMIUM, LANDMARK" TL, LANDM4RK'm Sums, LANDMARK'" SOLARIS IR, NORTHGATE: LOW AND STANDARD SLOPE METRIC DIMENSIONS 12" 143/4" 17, 1--(305 mm) --(315 mm)' —(305 Rim)— n': rs.:•.t'rsLvx s.vt-...^ t :M..,, .. x :.'rvec. aspre I—I" (25 nmi) Rdcase Tape 1" (25 mn1) YI •— I IrrL Nailablel . Area LANDMARK TL NorthGate: 13 X 13" 131/2" 1 --(343 mm) (330 mot)-- --(343 mm)--j I—I"(25mm) 1"(25inm)— — lignm 13.4. I st- frnrr "m/h far Nrq fill sbingla stove w"M. I7' 14 3d' 1' 1305 mot) (115 mot) —+ (30S rot) —I Na Ing Umb P (25am) aperaallno r (25 I0w na9lrs F 17 No ling areas far low and standard "Lopes (L•om 2:12 to 21121 Hal 114461111 %JIFQ1 & ITAW In6a a= }'KM11 sOin'e. Exterior Research and Design, I.I.C. Evaluation Report 3S32.09.0S-Rli Certificate of Authorization p9S03 FBC NON-HVHI EVALUATION FL5444-R10 Revision 11:12/08/2016 Page 7 of 12 STEEP SLOPE Use six nails and four spots of zlihak roofing cement for eery fill I:uuinau:d shingle. See hcloa•. Asph:dt roofing cement should meet AS1'Af 04586 Wlie 11. Apply I- spots of asphalt roofing cement uxde each comer and w about 12- to 13' In from melt edac. METRI( DIMENSIONS 12"— 305 rnm) 14s/4'-- 375 mm) 12"— 305 mm) u&Y.G'" : /L Gk.! 1"(25 mrn) 4L"J•V!'7YG1yLL' 1J/LlL`itJ:1. 1"(25 mm) Nail Area J_ Release Tape Fix Sleep 1 - 25 mm) - - - - (25 nitq Roolino Cement LANDMARK TL NorthGate: TRINITY I ERD 131/2'* 343 rem) 13" 330 mm) 131/2'=• 343 mm) 6-1"(25 mm) 1 "(25 (nm)-*J Figure 13-5• Use sir nails. andfour spots of asphdt twfing content on sleep slopes STEEP 12" 14-3/4' 12' SLOPE 1-.-005 mm)——(375 min)—(305 rnrn—jNAILING NaiOn imilsAREAi 1' 25 b , t vNe fivermm) 1"(25 Mnl I imaa Nailing areas for steep slopes (groater than 21:12) and " Storm -Nailing" Nail between lower 2 nod Ones as shown above. 6. 8.1 Hip & Ridee for Landmark"", Landmark"' IR, Landmark"" Pro, Landmark'" Premium, landmark"' TL. Landmark'" Solaris. LandmarkTM Solarls IR, NorthGate: 6. 8.1.1 Option 1: Shadow Ridge"' or NothGate Accessory 12 305mm) G G 92f8• 250 m) 415116' 415/1G— 150mm) 150mm) 125mm) ( 125mm) Notch for Centering Notch for Centednt 17 i / Ntthe131/ 4" I gym) ches for AOgnrmnt to EdgePrevious2the 337mm) Notches for Alignment ro Top 5 op of the m) Edge o1 the Prevbus7r5'(125ntm)ExposureCapfor55B'(141mm)Fi osum 196mm) English Dimension Metric Dimension Shadow Ridge- Shadow Ridge"' Exterior Research and Design, I.I.C. Evaluation Report 3532.09.05-Rll Cerdfleote of Authorirotion a9503 feC NON-HVH2 EVALUATION FL5444-R10 Revision 11: 12/08/2016 Page 8 of 12 6.8.1.2 9 27?32' 288 rnnq 4 IW16' (125 r att! r CerlalIg Pkub 13 337 11.1. mn:) Align thm / V=1101 to top 7 rig. Ac at sop:Rriouscp0r 104 mm) NorthGate Ridge r,RINITY I ERD 13 118" II---(333 mm)--- F-6 S/a, "S/8'-•III (168 mm)II 168 mm iiCentering _ 131/4' ` Notch , 1 337 i m) Align theso 7 S/8' notchos to top edge of ( 19 nun) NorthGate Accessory flgrae 13.20.• Use laying notches to center sbingtes.on Gips and ridges, and to locate the conmi exposure For ASTM 03161, Class F performance use BASF "Sonolastic• NPi'"" adhesive or Henkel "PLO Polyurethane Roof & Flashing Sealant", in accordance with CertainTeed requirements. 6.8.1.3 Option 2: Refer to instructions herein for Cedar Crest'", Cedar Crest' IR hip and ridge shingles. Exterior Research and Design, I.I.C. Evaluation Report 3S32.09.0S-R11 CertlJtcote of Authoritarian 99S03 FSC NON-HVH2 EVALUATION FL5444-R10 Revision 11: 12/08/2016 Page 9 of 12 TRINITY I ERD 6.9 I PRESIDENTIAL SNAKE-, PRESIDENTIAL SHAKE'" IR, PRESIDENTIAL SHAKE TL"", PRESIDENTIAL SOLARISr'": LOW AND STANDARD SLOPE: For low and standard slopes, use ave nails for each full Presidential shingle as shown below. Nagilp i 40' --•t Guide Units (1016 mm) 5 1 /4' — 133mm)kN56 141I4' f) NOTE. Apply nails on painted guideline. figure l64 Aulenrng Residential and frer/dardal TL Shake skingler on lom and standard slopes STEEP SLOPE: For steep slopes, use nine nails for each hill Presidential shingle and apply 1 • diameter spots of asphalt rooting cement under each shingle lab. After applying S nails in between the nailing guide lines. apply 4 nails I above tab cutouts making certain tabs of overl)ing shingle toter halls i VT 1' diaineler asphall ruoting cemant t figure lb7.• faslering Prarlrlenl/al and Residential T/L $bake ablr810 on sreep sto ter. 6.9.1 Hip & Ridge for Presidential Shake"". Presidential Shaker" IR, Presidential Shake TL"'. Presidential Solaris"": 6.9.1.1 Option 1: Presidential Accessory PRESIDENTIAL ACCESSORY Presidential accessory shingles can be used for.covering hips and ridges. Apply shingles.up.to the ridge (expose no more Ulan 7' from the bottom edge of the -"tooth." Fasten each accessory with two fas- teners. The fasteners'must be 13/4' long or longer, so they penetrate either 3/4''lnfo the deck or completely through thedeck. Presidential accessory comes In two different sizes: Accessory produced In Birmingham, AL -is 12eix 12"; Portland, ORproduces•97/s' x 13t/4' accessory. 6. 9.1.2 for ASTM D3161, Class F performance use BASF "Sonolastico NP11"" adhesive or Henkel "PLO Polyurethane Roof & Flashing Sealant", in accordance with CertainTeed requirements. 6. 9.1.3 Option 2: Refer to instructions herein for Cedar Crest"", Cedar Crest'" IR hip and ridge shingles. 6. 10 I HATTERAS'-: :. LOW, STANDARD AM STEEP SLOPE: Ir `I+,,g_ `rr9__ ".,,,y__ `1 ff, ptM15..P Mood its!/alteMeAl4ler a, Low dad its dmrl. Qo/rs for tar and stuAird stapes, use Arc nails for cads fall Wiens ddngie us alwau ubu r. Exterior Research and Oeslgn, I.I.C. Cerrllleote o/Authorliatlan 09so3 FnC NON•HVHZ EVALUATION R5 mnQl— — erly" n /". • fRmle"ipl., /MlhrnAlAll rielnn."heN YW Ne ueep "lope,, as- Are nark and eiglu slr4s of aythah monog CetneM for each log HAM, ahlngk• as alum above Alydr V tluuul t9a,-Mer F10i of roo9ug Cement (ASTN n 4%861)1te 11 wg; rAW) amlrr em It tah cotocT Press AM* laat place: tht net 4- A(NW tfmdd. Au' noN: 7mt much rwding cnuna "va ca,ac abinglrs to boo r, Evaluation Report3S32.09.OS-R1L FL5444• R10 Revision 11:12/09/2016 Page 10 of 12 4 TRINITYIERD 6.10.1 Hip & Ridge for Hatteras'": 6.10.1.1 Option 1: Accessory for Hatteras K Figure 13-14: 18 three-piece untts separate to make 54 Hatteras Ac> wory skingles. 6.10.1.2 Option 2: Cut Hatteras Shingles 9" 230 mm) I I I I I m) f- Ease I— — — 18" (460mr 5 18") (203 mm) _ a 460MM :: •` 6c Cap_ Cap Cap Cap Shingle Shingle Shingle Shingle m Figure 15-20: Cut Hatteras sbin& to make cover cap. Figure 15-21. lnslallallon of caps along hips and ridges 6.10.1.3 For ASTM 03161, Class F performance use BASF "Sonolasticm NP11" adhesive or Henkel "PL° Polyurethane Roof & Flashing Sealant", in accordance with CertainTeed requirements. 6.11 HIGHLAND SLATE'.",•HIGHLAND SLATE"IR: LOW AND STANDARD SLOPE STEEP SLOPE: r Me M11 nalls and BIGHT spots of asphalt roofing cement- for each IcnM rn".y. RJr t Inowd full Highland Slate shingle. For hBaml•Dade, Six a:tlfs are required. Apply t' diameter drat; of asphalt roofing cement under each tabL,_ , L Comer. Abiphalt tooOng cemen(nteenng ASIU D4ie6l)pe It b suggested. wrodi.r" oq*ft srx Na (-Ms Yu'.1 orrerlr mbIA u Irrwrll• Flgum I I ••T: Uso RVE palls for ewy lobtold date sbhlgla rno.y I Iae N pe".y v.°.t J,r w"nFoarrp ia ,. Smnl OraI..,( YrYltW onr orW "1 OAOW ataal -- Roofkrp erlreM Figure II-J& Use RYE Jn ear and sot rpols oforMall Moftfig Cent[ rndar tatb tab torMr. cAUrtON: nscesshe use of roofing cemeo( can cause shingles to blister. 6.11.1 Hip & Ridge for Hiehland Slate"", Highland Slate'' IR: Refer to instructions herein for Cedar Crest"", Cedar Crest' IR or Shangle Ridge'" hip and ridge shingles. Exterior Research and Design, U.C. eerUllcote o/Authorization 99S03 FOC NON-HVH2 EVALUATION Evaluation Report 3S32.09.OS•R11 FLS444-RlO Revision 11: 12/08/2016 Page 11 of 12 6.12 1 PATRIOT-: LOW AND STANDARD SLOPE lisr FOUR naiLti for crcn' full shioglc luaucd a: sluncn bcloa'. l luu ISJ nrq t IT SA1rM 7mwl tzmire j TRINITY I ERD STEEP SLOPE Use FOUR nail, end (nur span td agtlul( ronf(ug (mini for c%vrn full Ahingle as ahmo b0mv. A.q(h:dt twifiiug ccn(au utcaiug.l Td1 D4586 Type. It Le sutkgm(cd. Apply I'(1i min) sixw(s of asphAt mormu cclnall m% shoseu. f.AU110iX: lisccssisc use of roofing cenu•n( can ame sltiuglcs (o blWer. 1:34mj l r aeoneq Ctmeel • fmm (SA 6.12.1 Hip & Ridge for Patriot': Refer to instructions herein for Cedar Crest', Cedar Crest"' IR, Shadow Ridge"', NorthGate or Shangle Ridge' hip and ridge shingles. 7. LABELING: 7.1 Each unit shall bear a permanent label with the manufacturer's name, logo, city, state and logo of the Accredited Quality Assurance Agency noted herein. 7.2 Asphalt shingle wrappers shall indicate compliance with one of the required classifications detailed in FBC Table 1S07.2.7.1 / R90S.2.6.1. 8. BUILDING PERMIT REQUIREMENTS: As required by the Building Official or Authority Having Jurisdiction in order to properly evaluate the installation of this product. 9. MANUFACTURING PLANTS: Contact the named QA entity for information on which plants produce products covered by Florida Rule 61G20-3 Q4 requirements. 10. QUALITY ASSURANCE ENTITY: UL LLC — QUA9625; (414) 248-6409; karen.buchmann@us.ul.com END OF EVALUATION REPORT - Exterior Research and Design, LLC. Evaluation Report 3S32.09.OS-RIL Certi lcate ofAuthorltatlon NOW FBC NON-HVH2 EVALUATION FLS444-R10 Revision 11:12/08/2016 Page 12 of 12 4/28/2017 Florida Building Code Online ems" '.r. r :f ,, :o.: • t rT- , t ri . ` ' 4 . • r t'S': - .r' . Y , t y • r• !-—'f^.F! -. .. - _ 5.,, .,•,h - h' yr t 3•` r•• :' - 5,t' r r ;ter .,., , is ••. Ifi 1:• 7.•'zl;r•. ,'tiL'•etil,C•, ,(i'ji'j• - t .Y :. •.y,«. Via,''( t'•'•- .+ ` .,; i i •`. - `• s'jjo ` 7. • . .. _. a.: .)• Iw: • r: w ra°' i?"_4,Y D '4 r:. I-i_' ,• • .. . . n •z,1 ::: 1 P 1 i..; ? • S{(' f_' .A g r} i a 0 f d: q-„ 1.51'd'., '••9 S%•.1, :.`f. , - ? r ! V f•.. .a1 •: t ' r 'q .ti .,R, + •lu : h : r • ..e •.v i a, f d, ... y • I p, M.i"5.:.:'s f,t:. r. .I:,4r •.4.•:,._.":_i3_ - a- F_.. :i. 'l••: _ 4•coA`_.._%i'•'•'I..'_li1L:w'•+'1'•"'" '!"' '• eaS Home I Log In I User Registration I Hot Topics I submit surMarge I Stats fr Facts I Publications I F8C staff ! SCIS site Map I Unks I Search 4 . I<;"` Product Approval j y usea: Dubuc user Product Aeoroval Menu > Product or Aodlcrtlan Searchh AnnllnUeLn Lj,r > Application Oatall t;fiCs$r;a FL lF FL12194-R3 r`'j ; a ,t •• • Application Type Revision i;:E•:.t.;li Code Version 2014 1;9::r:rr Application Status Approved Comments Archived Product Manufacturer Address/Phone/Email Authorized Signature Technical Representative Address/Phone/Email Quality Assurance Representative Address/Phone/Email Category Subcategory Compliance Method Aluminum Coils, Inc. 5001 West Knox Street Tampa, FL 33634 813) 249-9743 grahman@aluminumcoilsinc.com Gareth Rahman grahman@aluminumcollsinc.com Paul Frost 5001 West Knox Street Tampa, FL 33634 813) 249-9742 PFrost@aluminumcolisinc.com Panel Walls Soffits Evaluation Report from a Florida Registered Architect or a Licensed Florida Professional Engineer Evaluation Report - Hardcopy Received Florida Engineer or Architect Name who developed Zachary R. Priest. the Evaluation Report Florida License PE-74021 Quality. Assurance Entity PRI Construction Materials Technologies, LLC Quality Assurance Contract Expiration Date 06/19/2020 Validated By Locke Bowden f' Validation Checklist - Hardcopy Received Certificate of Independence FL12194 R3 COI ALC15001 Evaluation Report 2014 FBC 04 T4 Soffits:odf Referenced Standard and Year (of Standard) Standard AAMA 1402 Equivalence of Product Standards Certified By Sections from the Code Year 1986 httpsJ/www.fioridabuilding.orglpr/pr app dU.aspx?param=wGEVXQwtDquk24AUC%2fEHMrNrkL4bysALEZSXMisXSGEO%2f1CX2YpyxA%3d%3d 1/2 4/28/2017 Florida Building Code Online Product Approval Method Method L Option D Date Submitted 08/27/2015 Date Validated 08/28/2015 Date Pending F8C Approval 09/04/2015 Date Approved 10/16/2015 Date Revised 04/05/2017 FIL !R l; Number or NameTAlumunum Description 12194.1 Colls Aluminum Soffit Aluminum soffit panels Limits of Use Installation instructions Approved for use in HVHZ: No FL12t94 R3 II ALC15001 Evaluation Report 2014 FBC 04 T4 Soffits.odfApprovedforuseoutsideHVHZ: Yes Impact Resistant: N/A Verified By: Zachary R. Priest PE-74021 Design Pressure: +80/-90 Created by Independent Third Party: Yes Other: See Evaluation Report for limits of use. Evaluation Reports FL12194 R3 AE ALC15001 Evaluation Report2014 FBC 04 T4 Sofflts.pdf Created by Independent Third Parry: Yes N Contact Us :: 2601 Blair Stone Road. Tallahassee FL 32399 Phone: 850.487.1824 The State of Florida Is an AA/EEO employer. Ccovrlaht 2007-2013 State of Florida.:: Privacy Statement :: Accessibility Statement :: Refund Statement Under Florida law, email addresses are public records. U you do not want your e-mail address released In response to a public -records request, do not send electronic mall to this entity. Instead, contact the ofnce by phone or by traditional mail. If you have any questions, please contact 850.407.1395. *Pursuant to section 455.27S(l), Florida Statutes, effective October 1, 2012, licensees licensed under Chapter 4SS, F.S. must provide the Department with an email address If they have one. The emalls provided may be used for ofndal communication with the licensee. However email addresses are public record. If you do not wish to supply a personal address, please provide the Oepartmem with an email address which can be made available to the public To determine If you are a licensee under Chapter 45S, F.S., please dick her . Product Approval Accepts: Y W M Credit Card Sale httpsJ/www.floridabtdlding.org/pr/pr app dtl.aspxlparam=wGEVXO,vtOquk24AUC%2(EHMrNrkL4bysALEZSXMjsX5GEO%2f1CXZYpyxAak3d%3d 2/2 Certificate of Authorization No. 29824CREEK17520EdinburghDr Tampa, FL 33647 TECHNICAL SERVICES, LLC (813) 480-3421 EVALUATION REPORT FLORIDA BUILDING CODE 5r" EDITION (2014) Manufacturer: ALUMINUM COILS, INC. Issued August 27, 2015 5001 West Knox Street Tampa, FL 33634 813)249-9743 www.aluminumcoilsinc.com Manufacturing: Tampa, FL Quality Assurance: PRI Construction Materials Technologies (QUA9110) SCOPE Category: Panel Walls Subcategory: Soffits Code Sections: 1404.5.1, 1710.9.4 Properties: Wind Resistance REFERENCES En& Report No. Standard Year Certified Testing Laboratories (TST1577) CTLA 1847W AAMA 1402 1986 Certified Testing Laboratories (TST1577) CTLA 2076W AAMA 1402 1986 PRI Construction Materials Technologies (TST5878) ACIX-003-02-01 AAMA 1402 1986 PRI Construction Materials Technologies (TST5678) ACIX-003-02-02 AAMA 1402 1986 LIMITATIONS 1. This report Is not for use in the HVHZ. 2. Design wind loads shall be determined in. accordance with FBC Section 1710.9.4. 3. Soffits shall be labeled in accordance with FBC Section 1710.9.2 and 1710.9.3. 4. Installation of the evaluated products shall comply with this report, the FBC and the manufacturer s published application instructions. Where discrepancies exist between these sources, the more restrictive and FBC compliant installation detail shall prevail. S. Installations shall meet the minimum ventilation requirements of FBC section 1203.2. 6. Field fastener withdrawal may be required by the AHJ for confirmation of existing substrates. All data shall be reviewed by a qualified design professional to ensure the fastener withdrawal meets or exceeds the minimum load resistance for the project requirements. 7. All products listed in this report shall be manufactured under a quality assurance program in compliance with Rule 61G20-3. PRODUCT DESCRIPTIONS 3/8" F-Channel Preformed nominal 0.016-inch thick, 3105 1-1-14 aluminum F-channel. See Appendix D for dimension drawings. 318" J-Channel Preformed nominal 0.016-inch thick, 3105 H-14 aluminum J-channel. See Appendix D for dimension drawings. Fascia Preformed nominal 0.019-inch thick, 3105 H-14 aluminum fascia. See Appendix D for dimension drawings. ALCI5001 FL12194-R3 Page 1 of 3 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. G R E E K ALUMINUM COILS, INC Soffits TECHNICAL SERVICES, LLC PRODUCT DESCRIPTION 16" 04 Soffit Preformed nominal 0.0135-inch thick, 3105 H-14 aluminum soffit F,anels provided in 16- inch sections. The reported net free ventilation areas are 22.3 in Ain.ft for the 'full vent' configuration and 11.1 in2/lin.ft and for the 'center vent' configuration. See Appendix D for dimension drawings. 111' t 1 NMI tll' [Mlflf VFY 1a' S41m YIHF 12" T4 Soffit Preformed nominal 0.0135-inch thick, 3105 H-14 aluminum soffit anels provided in 12- inch sections. The reported net free ventilation areas are 12.5 In? /lin.ft for the 'full vent' configuration and 4.2 in2Ain.ft for the 'center vent' configuration. See Appendix D for dimension drawings. ALC15001 FL12194-R3 Page 2 of 3 This evaluation report Is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC COMPLIANCE STATEMENT ALUMINUM COILS, INC Soffits The products evaluated herein by Zachary R. Priest, P.E. have demonstrated compliance with the Florida Building Code 50 Edition (2014) as evidenced in the referenced documents submitted by the named manufacturer. C•E N R7FSi'iSR > '. No 74021 t — ccZ O'.. STATE OF CERTIFICATION OF INDEPENDENCE 2015.08.27 07:05:00 041001 Zachary R. Priest. P.E. Florida Registration No. 74021 Organization No. ANE9641 CREEK Technical Services, LLC does not have, nor will it acquire, a financial interest in any company manufacturing or distributing products under (his evaluation. CREEK Technical Services, LLC Is not owned, operated, or controlled by any company manufacturing or distributing products under this evaluation. Zachary R. Priest, P.E. does not have, nor will acquire, a financial interest In any company manufacturing or distributing products under this evaluation. Zachary R. Priest, P.E. does not have, nor will acquire, a financial interest in any other entity involved In the approval process of the product. APPENDICES 1) APPENDIX A — Approved Systems (7 pages) 2) APPENDIX B — Installation Drawings (12 pages) 3) APPENDIX C — Design Wind Loads(4 pages) 4) APPENDIX D — Dimension Drawings (4 pages) ALC15001 FL12194-R3 Page 3 of 3 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services. LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC APPROVED SYSTEMS ALUMINUM COILS, INC Soffits Appendix A The following notes shall be observed when using the assembly tables below. 1. Maximum Design Pressures (MDP) were calculated using a 1.5:1 margin of safety per FBC Section 1710.9.4. 2. Refer to LIMRATIONS and sections of this evaluation when using the table(s) below. 3. Refer to INSTALLATION section of this report for installation detail when the information is not explicitly stated for the selected assembly. 4. The on -center (o.c.) spacing given is the maximum allowable attachment spacing for the rated system. 5. Unless otherwise specified, the Wood substrate shall be minimum No. 2 SPF (S.G. = 0.42) 2x lumber. Substrate attachment shall be designed by others in accordance with FBC requirements to meet the minimum design requirements for the project. 6. Unless otherwise specified, the Masonry substrate shall conform to ASTM C 90. Substrate attachment shall be designed by others in accordance with FBC requirements to meet the minimum design requirements for the project. 7. Typical fastening details are as follows: a. 12" T4 Soffit —12-inch o.c. Fastener Fastener Location Location 1 1 b. 12" T4 Soffit— 44nch o.c. Fastener Fastener Fastener Fastener Location Location Location Location c. 16* Q4 Soffit —16-inch o.c. Fastener Fastener Location Location 1. 1 ALC15001 FL12194-R3 Page 1 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC d. 16" Q4 Soffit — 8-inch o.c. Fastener Lrw Atinn IF Fastener Fastener Location 11 ALUMINUM COILS, INC Soffits Approved System Numbers and Definitions ILFA Approved Systems for 124nch Overhang with F-Channel 12J-# Approved Systems for 124nch Overhang with J-Channel 16F-# Approved Systems for 164nch Overhang with F-Channel 16J-# Approved Systems for 164nch Overhang with J-Channel 24F-# Approved Systems for 244nch Overhang with F-Channel 24.14 Approved Systems for 244nch Overhang with J-Channel Appendix A Approved Systems for 12-inch overhang with F-Channel Wall Connection Eave Connection System Panel MDP No. Width psf) Substrate F-Channel Substrate Panel Attachment Fascia Cap Attachment Attachment Max' One (1) min. 3/8-inch head dia. nail. One (1) min. 318 x 3/8-inch One (1) min. 1 3/44nch long x 0.072-Inch dia. x min. 311612F-1 164nch Wood min. 1.25-inch embedment spaced Wood crown staple spaced 164nch inch head dia. trim nail 140.0 24-inch o.c. O.C. spaced 36-Inch o c. Max. Three (3) min. 3/44nch x 1/4-inch One (1) min 314-Inch x 1/4-inch One (1) min. 1 3/44nch long x 0.0724nch dia. x min. 1/flinch 4812F-2 164nch Wood crown staples in diamond pattern Wood crown staple spaced 8-inch o.c. head dia. trip nail spaced 48- 64.2spaced244ncho.c. and securing each panel lap inch o.c. 12F-3 Max Masonry One (1)14 ga. 5!8 lnch long T nail Wood One (1) min 3/4-inch x 1/44nch One (1) min. 1 3/44nch long x 0.0724nch dia. x min. 1/44nch 48 164nch spaced 8-inch o.c. crown staple spaced 8-inch o.c. head dia. trip nail spaced 48- 64.2 and securing each panel lap inch o.c. ALClS001 FL12194-R3 Page 2 of 7 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically. addressed herein. r CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 12-inch overhang with J-Channel Wall Connection Eave Connection System Panel MDP No. Width pso Substrate F-Channel Panel Attachment Substrate Panel Attachment Fascia Cap Attachment Attachment Three (3) min. 3/4- Inch x 1/4-Inch crown One (1) min. #8 x 1/24nch One (1) min 3/44nch x One (1) min. 1 3/44nch long x 12J -1 Mom' ooWd staples in diamond long x 3/8 inch head diameter Wood 1/4-inch crown staple 0.072 inch dia. x min. 1/4-inch 48 16-inch pattern spaced 24- screw spaced 164nch o.c. spaced 8 inch o.c.. head dia. trip nail spaced 48- 64.2 inch o.c. connecting soffit to J-channel Inch o.c. Approved Systems for 16-inch overhang with F-Channel Wall Connection Eave Connection System Panel MDP No. Width psf) Substrate F-Channel Substrate Panel Attachment Fascia Cap Attachment Attachment One (1)18 ga. 1/44nch crown x One (1) min. 1.75-inch x 16F-1 Max. Masonry One (1) 14 ga..5/84nch long T nail Wood 1-inch leg staples spaced max 0.072-inch diameter finishing nail with min. 3/16- 33.3 12-inch spaced max. 8-inch o.c. 4-inch o.c. and securing each inch head spaced panel lap 12-Inch o.c. One (1)18 ga. 1/4-inch crown x One (1) min. 1.75-inch x Max Three (3)18 ga.1/4-inch crown x 1- 1-Inch leg staples spaced max 0.072-inch diameter 16F-2 12-inch Wood inch leg staples in diamond pattern Wood 4 inch o.c. and securing each finishing nail with min. 3/16- 53.3 spaced 164nch o.c. panel lap inch head spaced 12-Inch o.c. Max One (1) 318-inchhead dia. nail, min. One (1) min 3/8-inch x 3/8-inch One (1) min. 1 3/44nch long x 0072 inch diax min 16F- 3 164nch Wood 1.25-inch embedment spaced 24- Wood crown staple spaced 16-inch 3/ 16-inch head dia. trim nail 25. 6 inch o.c. O.C. spaced 36-inch o.c. Three ( 3) min. 3/44nch x 1/4-inch One (1) min. 1 3/4-inch long 16F- 4 Max. Wood crown staples in diamond pattern Wood One ( 1) min 3/4-inch x 1/flinch x 0.0724nch dia. x min. 1/4- 27 164nch spaced 244nch o.c. crown staple spaced 84nch o.c. inch head dia. trip nail 36.1 spaced 484nch o.c. ALC15001 FL12194-113 Page 3 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G203. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. POW CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 16-inch overhang with F-Channel Wall Connection Eave Connection System Panel MDP No. Width psf) Substrate F-Channel Substrate Panel Attachment Fascia Cap Attachment Attachment One (1)18 ga 114-inch crown x One (1) min. 1.754nch x 16F-5 Max. Masonry One (1)14 ga. 5184nch long T nail Wood Wd 1-inch leg staples spaced 4- flinch ng diameter fininail with min. 3/16- finishing 343.3 164nch spaced 84nch o.c. inch o.c. and securing each inch head spaced panel lap 16-inch o.c. Three (3) 18 gaA/44nch crown x 1- One (1) 18 ga. 1/4-inch crown x One (1) min. 1.75-inch x 0.072- inch diameter 16F-6 Max. 16 inch Wood inch leg staples in diamond pattern Wood 1-inch leg staples spaced 4- inch o. c. and securing each finishing nail with min. 3/16- 343.3 spaced 16- inch o.c. panel lap inch head spaced 16-inch o.c. Approved Systems. for 16-inch overhang with J-Channel Wall Connection Eave Connection System Panel MDP No. Width psf) Substrate J- Channel Substrate Panel Attachment Fascia Cap Attachment Attachment Three (3) min. 3/4-inch x 1/44rich One (1) min. 1 3144nch 16.11 Max. Wood sown staples in diamond patternWood One (1) min 314-inch x 1/4-Inch long x 0.072-inch dia. x 23.6 16-inch spaced 244nch o. c. crown staple spaced 8-inch o.c. min. 1/4-inch head dia. trip 31.4 nail spaced 48- inch o.c. ALC15001 FL12194-R3 Page 4 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 244nch overhang with F-Channel Wall Connection Center Connection Eave Connection System Panel MDP No. Width psf) Substrate F-Channel Batten Panel Attachment Substrate Panel Attachment Fascia Cap Attachment Attachment One (1)18 ga.1/4-Inch Nominal 1x2 crown x 1-inch leg No.2 SYP staples spaced Three (3) 18 ga.t/4- anchored to 124nch o.c. securing One (1)18 ga. 1/4- One (1) min. 1.75-inch x Max inch crown x 14nch rafter with one each panel lap inch crown x 1-inch 0.0724nch diameter 24F-1 12-inch Wood leg staples in 1) min. 2.25- Wood leg staples spaced 8- finishing nail with min. 801-90 diamond pattern inch x 7d ring One (1) min. 1.75-lnch inch o.c. 3/16-inch head spaced spaced 164nch o.c. shank nail x 0.0724nch diameter 12-inch o.c. 24-inch o.c. finishing nail with min. 3116-inch head spaced 4-inch o.c. One (1)18 ga.1/4-inch crown x 1-inch leg Nominal. 1x2 staples spaced One (1) min. 1.5- No.2 SYP 124nch o.c. securing One (1)18 ga. 1/4- One (1) min. 1.75-inch x Max inch x 11 ga. anchored to each panel lap inch crown x 1-inch 0.0724nch diameter 80/ 24F-2 124nch Wood smooth shank rafter with one Wood leg staples spaced 8- finishing nail with min. 76.6 roofing nail spaced 1) 7d x 2.25- One (1) min. 1.75-inch inch o.c. 3/164nch head spaced 16-inch o.c. inch ring shank x 0.0724nch diameter 12-inch o.c. nail 24-inch o.c. finishing nail with min. 3/164nch head spaced 44rich o.c. One (1) 18 ga.1/4-inch crown x 14nch leg Nominal 1x2 staples spaced No.2 SYP 124rich ox, securing One (1) 18 ga. 1l4- One (1) min. 1.75-inch x Max One (1) 14 ga. 5/8- anchored to each panel lap inch crown x 1-inch 0.072-inch diameter 80/ 24F-3 12-inch Masonry inch long T nail rafter with one Wood leg staples spaced 8- finishing nail with min. 76.6spaced8-Inch o.c. 1) 7d x 2.25- One (1) min. 1.75-inch inch o.c. 31164nch head spaced inch ring shank x 0.072-inch diameter 12-inch o.c. nail 24-inch o.c. finishing nail with min. 3/164nch head spaced 44nch o.c. ALC15001 FL12194-R3 Page 5 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. 0 CREEKIm TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 244nch overhang with F-Channel Wall Connection Center Connection Eave Connection System Panel MDP No. Width ps() Substrate F-Channel Attachment Batten Panel Attachment Substrate Panel Attachment Fascia Cap Attachment One (1) 18 ga.1/4-inch Nominal 1x2 crown x 14nch leg No.2 SYP staples spaced Three (3)18 ga.1/4- anchored to 124nch o.c. securing One (1)18 ga. 1/4- One (1) min. 1.754nch x Max inch crown x Cinch rafter with one each panel lap inch crown x 1-inch 0.072-inch diameter 24F4 16- inch Wood leg staples in 1) min. 2.25- Wood leg staples spaced 8- finishing nail with min. 80/-60 diamond pattern i inchx 7d ring One (1) min. 1.754nch inch o.c. and securing 3/16-inch head spaced spaced 16-inch o.c shank nail x 0.0724nch diameter each panel lap 16-inch o.c. 24- inch o.c finishing nail with min. 3/ 164nch head spaced 44nch o.c. One ( 1)18 ga.1/44nch crown x 1-indh leg Nominal 1x2 staples spaced One ( 1) min. 1.5- No.2 SYP 124nch o.c. securing One (1)18 ga. 1/4- One (1) min. 1.75-inch x Max inch x 11 ga. anchored to each panel lap inch crown x 1-inch 0.072-inch diameter 24F- 5 16- inch Wood smooth shank rafter with one Wood leg staples spaced 8- finishing nail with min. 801-60 roofing nail spaced 1) 7d x 2.25- One (1) min. 1.754nch inch o.c. and securing 3/16-inch head spaced 164nch o.c. inch ring shank x 0.072-inch diameter each panel lap 16-inch o.c. nail 24-Inch o.c. finishing nail with min. 3/ 16-Inch head spaced 4- inch o.c. One ( 1)18 ga.1/44nch crown x 1-inch leg Nominal 1x2 staples spaced No. 2 SYP 124nch o c. socuring One (1)18 ga. 1/4- One (1) min. 1.75-inch x One ( 1)14 ga. 5/8- anchored to each panel lap Inch crown x 1-inch 0.072-inch diameter 24F- 6 166-inchMasonry inch long T nail rafter with one Wood leg staples spaced 8- finishing nail with min. 801-60 spaced 8-inch o.c. 1) 7d x 2.25- One (1) min. 1.75-inch Inch o.c. and securing 3/16-inch head spaced inch ring shank x 0.072-inch diameter each panel lap 16-inch o.c. nail 24- inch o.c. finishing nail with min. 3/16- inch head spaced 44nch o. c. ALCIS001 FL12194- R3 Page 6 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use. or other product attributes that are not specifically addressed herein. N- CREEK TECHNICAL SERVICES. LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 244nch overhang with J-Channel Wall Connection Center Connection Eave Connection System Panel MOP No. Width pso Batten J-Channel Batten Panel Attachment Substrate Panel Attachment Fascia Cap Attachment Attachment Nominal 1x2 No.2 SYP scabbed between rakers with one (1) min. 22Sinch x 7d One (1)18 ga.114-InchNominal1x2 ring shank nail crown x linch leg No.2 SYP anchored to Three (3)18 ga.1/4-inch crown stral ht-nalled through99 the raker into the and staples spaced 124nch o.c. securingg One (1) 18 ga. /.- One (1) min. 1.75-inch 24J-1 Max ratter with one x 1-inch leg of the taken rs two (2) each panel lap Wood inch crown x 1-inch x 0.072-inch diameter finishing nail with min. 260 12-inch 1) min. 2.25- staples in diamond min. 2.25-lnch x 7r One leg staples, spaced 3/16-Inch head spacedinchx7dringpatternpspaced16- ring shank nails toe- nailed on either side of fi 0. 72 ncmindiameter nchdiameter8-inch o.c. 12- inch o.c. shank nail inch o.c the batten at each hang finishingnail with min. 244nch o.c bakten at er 311661nch head spaced Intersection. Max. 4- inch o.c. raker spacing Is 244nch o.c. Nominal 1x2 No.2 SYP scabbed between rafter$ with one (1) into. 2 x 7d One (1)18 ga.1/4 inch Nominal1x2ring shank nknail crown x troth leg No. 2 SYP anchored to Three ( 3)18 9 a.1/4-inch crown strai ht-nalled through gthe rafter into the end staples spaced 124nch o.c. searing One ( 1) 18 ga. - inch crown x 1-inch One (1) min. 1.75-inch 24J- 2 Max rafter with one x 1-inCh leg of the batten or two (2) each panel la pWood leg staples spaced x 0.0724nch diameter finishing nail with min. 33.3 16-inch 1) min. 2.25- staples in diamond min. 2.25-Inch x 7d One (1) min.1.754nch 8-inch o.c. and 3/ 16-inch head spaced pinchx7dringpatternspaced16- Pa9 shank nails toe- x 0.072dnch diameter securing each anal gp164nch o.c. shanknailincho.c. nailed side of finishing nail with min. lap 24- inch o.c. batten thebattenat each battentrafter 3l164nch head spaced intersection. Max. 4-inch o.c. rafter spacing Is 244n6h o.c. ALC15001 FL12194-R3 Page 7 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC soffits Appendix B INSTALLATION Note - Refer to the APPRovEo SYSTEMS section of this report for additional installation details of a selected system and maximum design pressures limitations. System No. Installation Detail Min. 318' head die. nail vlth min. 1!:' engagamanWor we xi iubstrnta; or o1n. 9.097' din. T-nsil or atuo nail v,:h min. S!U' eagagenentr:or ca:crete oc- bla:k evu0tr*:w2. apacc•1 ae noted stove FASCIA SLIP BOARD FASCIA TRIM SOFFIT (OVERHANG WIDTH VARIES) 12F-1 & 12F-3\\—,.F" CHANNEL W=d, Concreto or sl:>`l Ws11 STAPLE SOFFIT TO FASCIA BOARD #T50 3/8" X 3/8" STAPLE 1.6" O.C. FASCIA LIP 1/4" PAINTED S.S. 1 3/4" TRIM NAIL MIN. 5 NAILS PER 12' PIECE SOFFIT & FASCIA DETAIL ALCIS001 FL12194-R3 Page 1 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. HCREEKTECHNICALSERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail n„ `, SOFFIT STAPLE OPEN RAFTER 3/4' x/a• DIAMOND PATTERN t I I DETAILCROWNSTAPLES , , USING A DIAMOND sr nts PATTERN FACIA BOARD FASCIA GAP 12F-2 3/4- X 1/4- CROWN FACIA BOARD B• 1-3/4• TRIM NAIL STAPLE ON CENTER 1-3/4' TRIM NAIL PAINTED S.S. F' CHANNEL CAN BE PAINTED S.S. 48' INSTALLED WITH THE fASCIA CAP O.C. UNG FLANGE UP OR 3/4• X 1/4• CROWN STAPLE gOFM- max. 12-inch span SOFFIT SUBSTRATE SOFFIT & FASCIA DETAIL ALC15001 FL12194-R3 Page 2 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREED{ TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail OPEN RAFTER SOFFIT STAPLE asr`DIAMOND I DETAIL PATTERN FACIA BOARD yr rrvm i srwatt 1 3/4' x 1/4' CROWN STAPLE -24 ON CENTER USINC A DIAMOND PATTERN FASCIA CAP 12J-1 3/4' X 1/4' CROWNJS.S. STAPLE 'S' ON CENTER 1 FACIA BOARD i—CHANNEL 1-3/4' TRIM NAIL Pacrexedtosoffit ith enst1i ee a PAINTED S.S. 48' FASCIA GAP 1/2" x3!C' head O.C. diameter screw, 3/4' X 1/4c.cCROWN STAPLESOFFIT—ma1c. 12-i^ch spanS WOOD OR BLOCK SOFFIT & FASCIA SUBSTRATE DETAIL ALC15001 FL12194-R3 Page 3 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20.3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail I {' TRIM NAIL FASCIA BOARD PAMMI S.S. FASCIA CAP SOFFIT 1-4- CROMN STAPLEIOPENRAFTER FASCIA BOARD Ii Ci JB' lil:E 16F-1 SOFFIT & FASCIA 16F-5 DETAIL FASEIA CAP: REFER TO SCFFIT t FASCIA DETAIL f' ENANMEI SDFFn: nAx. 16, SPAY I MASONRY J SUBSTRATE ALC15001 FL12194-R3 Page 4 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. 16F-3 CREEK TECHNICAL SERVICES, LLC No. I Installation Detail Wtn. 3/ql head dia. rail with min. 1%- sngaaomont(for wowl substrate) or Tin. 4.0971 dia. T-nail or s_u, nail with min. 5/a- sngagement(cor concrere or clock eubstratel, spaced as note! above. ASCIA SLIP BOARD FASCIA TRIM SOFFIT (OVERHANG WIDTH VARIES) F" CHANNEL Wood, on_v-une or 91ock W FASCIA LIP 1 /4" STAPLE SOFFIT TO ASCIA BOARD #T50 8" X 3/8" STAPLE 16" O.C. PAINTED S.S. 1 3/4" TRIM NAIL MIN. 5 NAILS PER 12' PIECE SOFFIT & FASCIA DETAIL ALUMINUM COILS, INC Soffits Appendix B ALC15001 FL12194-R3 Page 5 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail. n , SOFFIT STAPLE OPENRAFTER 1% DIAMOND PATTERN 3/4• x 1/4• DETAILCROWNSTAPLES1 USING A DIAMOND crvE l w.cssui PkTTIERN FACIA BOARD FASCIA CAP 16F- 4 3/ 4• X 1/4• CROWN FACIA BOARD 1- 3/4• TRIM NAIL 8. STAPLEON CENTER 1- 3/4• TRIM NAIL PAINTED S.S. 7—'F' CHANNEL CAN BE PAINTED S.S. 48• FASCIA CAP INSTALLEDWfmTHEO.C. NAILING FLANGE UP OR 3/4' X 1/4• DOWN CROWN STAPLE SOFFIT— 1— • 16-inch span WOOD SOFFIT SUBSTRATE SOFFIT & FASCIA D ETAI L IrALC15001 FL12194-113 Page 6 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES. LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail t I- TRIM NAIL FASCIA BOARD PAINTED SS. FASCIA CAP SOFFIT TQ CRO.1 STAPLE OPEN RAFTER FASCIA BOARD 1-4- CROWN STAPLES SOFFIT 8 FASCIA USDIC A DIAM0.'10 PATTERN: REFER TO DETAIL 16F-Z 81 SOFRT STAPLE 16F-6 DIAMOND PATTERN DETAIL CAP; REFER TOTO t FASCIA F' CHANNEL3 B DETAILAL SOFFIT; MAX IV j SPAN 1\ — x SUBSTRATE \ SOFFIT STAPLE DIAMOND PATTERN ALC15001 FL12194-R3 Page 7 of 12 This evaluation report is provided for State of Florida product approval under Rule 611320-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC System No. I Installation Detail 16J-1 3/4' X 1/4' CROWN STAPLE '24' ON CENTER USING A DIAMOND PATTERN WOOD OR BLOCK SUBSTRATE OPEN RAFTER 1-3/4' TRIM NAIL PAINTED S.S. 48' O.C. SOFFIT -max. 16-inch span ALUMINUM COILS, INC Soffits Appendix B W rTWNW- `, SOFFIT STAPLE DIAMOND PATTERNIr FACIA BOARD ' > Ac+Vam I DETAIL FASCIA CAP 3/4' X 1/4- CROWN4MMML,CIA BOARD STAPLE V ON CENTER 1PFASCIA CAP X1/4- WN STAPLE SOFFIT SOFFIT & FASCIA DETAIL ALClSO01 FL12194-R3 Page B of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail 1 I' IN" NAIL FASEN BOARD PAINTED S.S. I'.-' CROWN FASCIA CAP STAPLES SOFFIT USING A DIAMOND PATTERN; REFER CO r.l' CROWN SIAPLE SOFFIT STAPLE DIAMONC, PATTERN OETAII — 1 TRIM MAIL FASCIA BOARD PAINTED SS. DETAIL SOFFIT L FASCIA 24F-1 8 ' t 24FA rd- CROWN STAPLE - fASOA (A; REFER TO SOFFIT L FASCIA \ OETAII / Kamm lle's th & 7 f 3l8ABattenAnt.10re0 to SOFFIf; MAX 71.' f-[NAIINLI Ralttra riln ona 70 Ruy Shank Nal at tvtry Rafter / WOOD SUBSTRATE \ SOFFIT STAPLE DIAMOND PATTERN ALClSO01 FL12194-R3 Page 9 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. r= CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail T TRIM NAIL FASCIA BOARO 1 PAW1E0 iS. Lt' SMOOTN i44lI T I FASCIA CAP ROOF NAILS SOFRT 1'at' EROWN STAPLE 1 TRIM NAL FASCIA BOARO PAWTEO S.S. SOFFIT & FASCIA 24F-2 & I DETAIL 24F-5 r.t CROWN STAPLE FASCIA CAP; REFER TO SOFFIT S FASCIA DETAIL Noouoel 1'a2' SYP Batteo AoAwreO to SOFFIT; MAX. 24' F-CHANNEL Ranters rith om Ta Ring Shank Nab a1 awy Rafter MOOD SUBSTRATE ALC15W1 FL12194-R3 Page 10 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this repon.is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail 1 J' IRO1 NAIL FASCIA BOARD PAINTEO SS I"A i" T-RAILS l II FASCIA CAP SOFFIT V 1 r4' CROWN STAPLE I TRL-1 NAIL FASCIA BOARD PANTED SS. SOFFIT & FASCIA 24F-3 & DETAIL I I 24F-6 1-4- CROWN STAPLE FA CIA CAP: REFER 10 SOFFIT t FASM DETAIL Neff" Pet' SYP F•CNAN.4EL Batfen Authored to SOFFIT, MAX. 2t' Rafters .011 or.* TO Ain Shank f4I at every RafterMASONRY ALC15001 FL12194-R3 Page 11 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC soffits Appendix B System No. Installation Detail I }- TRIM MAIL, -FASCIA eOARO vAa1TED ss. I'la- CROWN ,-FASCIA CAP STAPLES SOFFIt- jUSAN6AOIAMOND PATTERN, REFER TD [ANnIEYEREO t-4- CROWN STAPLE SOFFIT STAPLE DIAPONO PATTERN RAf11:R OCTAL FASCIA BOARD SOFFIT & FASCIA I e TRIM MAL DETAILPAINTEDSS. 24J-1 & rq- CROWN STAPLE 24J-2 r FASCIA CAP: RUER TOL fASnA OETAft / \ twraan: 1-1 r s f P banana - anubeo ben»en ra'ets and SOFAI; rLA%. 24' NAN I stxunxi cat one (I) To tiny avant toa so mproaHaeo um" ft raft" Woo the enc I WOOD SUBSTRATE of the ba:kn" two Q) TO / ft span naOa toeaalac an \ — C@mt $ be 01 the Daften r. U" brYwtalW mstaecUDn / SOFFIT STAPLE DIAMOND PATTERN ALCIS001 FL12194-R3 Page 12 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. GREED TECHNICAL SERVICES, LLC DESIGN WIND LOADS ALUMINUM COILS, INC Soffits Appendix C The following tables provide design wind loads for components and cladding in accordance with Section 1609.1 of the FBC and ASCE 7-10 under the following provisions: 1. Wind speeds for risk category I, II, III, and IV buildings shall be as defined in Section 1609 of the FBC. 2. Exposure B. C. and D shall be as defined in section 1609 of the FBC. 3. Design wind loads are provided only for walls/soffits with a mean roof height less than or equal to 60-ft. 4. All calculations are based on an effective wind area of 10-ft2 or less. 5. Topographic factors such as escarpments or hills have been excluded from the analysis. 6. Wind directionality factor, Ka = 0.85 7. V,,,, is shown in the tables below. Design pressures are multiplied by 0.6 in accordance with Section 1610.9.4 of the FBC. 8. Projects with mean roof heights greater than 60-ft shall be evaluated by a licensed design professional. 9. Zones 4 and 5 shall be defined as shown below. Dimension "a" shall be 10% of the least horizontal dimension or (0.4 x Mean Roof Height), whichever is smaller, but not less than either 4%u of the least horizontal dimension or 3-ft. ALC15001 FL12194-113 Page 1 of 4 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix C Design Wind, Pressures for Soffits in Exposure B Building Type ', Zone Mean Roof Height ft Basic Wind Speed inph) 120, 130•. 140 150 160 170 180 19U 200 Enclosed 4 20 16.9 19.8 22.9 26.3 30.0 33.8 37.9 42.2 46S 25 16.9 19.8 22.9 26.3 30.0 33.8 37.9 42.2 46.8 30 16.9 19.8 22.9 26.3 30.0 33.8 37.9 42.2 46.8 40 18.3 21.5 24.9 28.6 32.5 36.7 41.2 45.9 50.8 50 5019.5 22.9 26.5 30.5 34.7 39.1 43.9 48.9 54.1 20. 5 24.0 27.8 32.0 36.4 41.1 46.0 51.3 56.8 Negative Loads) 5 20 20.8 24.4 28.3 32.5 37.0 41.7 46.8 52.1 57.8 25 20.8 24.4 28.3 32.5 37.0 41.7 46.8 52.1 57.8 30 20.8 24.4 28.3 32.5 37.0 41.7 1 -46.8 52.1 57.8 40 22.6 26.5 30.7 35:3 40.1 45.3 50.8 56.6 62.7 50 24.1 28.2 32.8 37.6 42.8 48.3 54.1 60.3 66.8 60 25.3 29.6 34.4 39.5 44.9 50.7 56.8 63.3 70.1 Enclosed 4 20 10.8 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 25 10.8 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 30 10.8 12.7 14.7 16.9 19.2 21.7 1 24.3 27.1 30.0 40 11.7 13.8 16.0 18.3 20.8 23.5 26A 29.4 32.5 50 5012.5 14.7 17.0 19.5 22.2 25.1 28.1 31.3 34.7 13. 1 15.4 17.8 20.5 23.3 26.3 29.5 32.9 36.4 Positive Loads) 5 20 10.8 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 25 10.8 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 30 10.8 12.7 14.7 16.9 19.2 21.7' 1 24.3 27.1 30.0 40 11.7 13.8 16.0 18.3 20.8 23.5 26.4 29.4 32.5 50 12.5 14.7 1 17.0 1 19.5 22.2 25.1 28.1 1 31.3 1 34.7 60 13.1 15.4 1 17.8 1 20.5 1 23.3 26.3 29.5 1 32.9 1 36.4 ALC15001 FL12194-R3 Page 2 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20.3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix C Design -Wind Pressures for Soffits. in Exposure C Building Type Zone Mean Roof Height ft Basic Wind Speed mph). 12Q 130 140 150 160 170 180 190 200 Enclosed 4 20 21.7 25.4 29.5 33.8 38.5 43.5 48.7 54.3 60.2 25 22.6 26.6 30.8 35.4 40.2 45.4 50.9 56.7 62.8 30 23.6 27.7 32.1 36.9 41.9 47.3 53.1 59.1 65.5 40 25.0 29.4 34.1 39.1 44.5 50.2 56.3 62.7 69.5 50 26.2 30.8 35.7 41.0 46.6 52.6 59.0 65.8 72.9 60 27.2 31.9 37.0 42.5 48.3 54.6 61.2 68.2 75.5 Negative Loads) 5 20 26.7 31.4 36.4 41.8 47.5 53.7 60.2 67.0 74.3 25 27.9 32.8 38.0 43.6 49.6 56.0 62.8 70.0 77.6 30 29.1 34.2 39.6 45.5 51.8 58.4 65.5 73.0 80.9 40 30.9 36.3 42.1 48.3 54.9 62.0 69.5 77.5 85.8 50 32.4 38.0 44.1 50.6 57.6 65.0 72.9 81.2 89.9 60 33.6 39.4 45.7 52.5 59.7 67.4 75.5 84.2 93.2 Enclosed 4 20 13.9 16.3 18.9 21.7 24.7 27.9 31.2 34.8 38.5 25 14.5 17.0 19.7 22.6 25.8 29.1 32.6 36.3 40.3 30 15.1 17.7 20.6 23.6 26.9 30.3 34.0 37.9 42.0 40 16.0 18.8 21.8 25.1 28.5 32.2 36.1 40.2 44.5 50 16.8 19.7 22.9 26.3 29.9 33.7 37.8 42.1 46.7 60 17.4 20.5 23.7 27.2 31.0 35.0 39.2 43.7 48.4 Positive Loads) 5 20 119 16.3 18.9 21.7 24.7 27.9 31.2 34.8 38.5 25 14.5 17.0 19.7 22.6 25.8 29.1 32.6 36.3 40.3 30 15.1 17.7 20.6 23.6 26.9 30.3 34.0 37.9 42.0 40 16.0 1 18.8 11 1.8 25.1 28.5 32.2 36.1 40.2 44.5 50 16.8 19.7 22.9 26.3 29.9 33.7 37.8 42.1 46.7 60 17.4 20.5 23.7 27.2 31.0 1 35.0 39.2 43.7 48.4 ALC15001 FL12194-113 Page 3 of 4 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix C Desi h'Wind Pressures for Soffits in Exposure D' Building_, Zone Mean Roof Height f Basic -Wind Speed mph) 120 30 150 170 190 200Type Enclosed 4 20 26.0 30.5 35.4 40.6 46.2 52.2 58.5 65.2 72.2 25 27.0 31.6 36.7 42.1 47.9 54.1 60.6 67.6 74.9 30 27.9 32.8 38.0 43.6 49.6 56.0 62.8 70.0 77.5 40 29.4 34.5 40.0 45.9 52.2 58.9 66.1 73.6 81.6 50 30.6 35.9 41.6 47.8 64.3 61.3 68.8 76.6 84.9 60 31.5 37.0 42.9 49.3 56.1 63.3 70.9 79.0 87.6 Negative Loads) 5 20 32.1 37.7 43.7 50.1 57.0 64.4 72.2 80.4 89.1 25 33.3 39.1 45.3 52.0 59.2 66.8 74.9 83.4 92.4 30 34.5 40.4 46.9 53.8 61.3 69.2 77.5 86.4 95.7 40 36.2 42.5 49.3 56.6 64.4 72.7 81.5 90.9 100.7 50 37.7 44.3 51.4 58.9 67.1 75.7 84.9 94.6 104.8 60 38.9 45.7 53.0 60.8 69.2 78.1 87.6 97.6 108.1 Enclosed 4 20 16.7 19.5 22.7 26.0 29.6 33.4 37.5 41.7 46.3 25 17.3 20.3 23.5 27.0 30.7 34.7 38.9 43.3 48.0 30 17.9 21.0 24.3 27.9 31.8 35.9 40.2 44.8 49.7 40 18.8 22.1 25.6 29.4 33.4 37.8 42.3 47.2 52.2 50 19.6 23.0 26.7 30.6 34.8 39.3 44.1 49.1 54.4 60 20.2 23.7 27.5 31.6 35.9 40.5 45.4 50.6 56.1 Positive Loads) 5 20 16.7 19.5 22.7 26.0 29.6 33.4 37.5 41.7 46.3 25 17.3 1 20.3 23.5 27.0 30.7 34.7 38.9 43.3 48.0 30 17.9 21.0 24.3 27.9 31.8 35.9 40.2 44.8 49.7 40 18.8 22.1 25.6 29.4 33.4 37.8 42.3 47.2 52.2 50 19.6 23.0 1 26.7 30.6 34.8 39.3 44.1 1 49.1 54.4 60 20.2 23.7 1 27.5 1 31.6 1 35.9 40.5 45.4 1 50.6 56.1 ALC15001 FL12194-113 Page 4 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC 3/8" F-Channel 3/8" J-Channel 3/8" 3/L" 1/8' HEM Tj- T 1 t 3/8' ISOMETRIC VIEW air PRof4E ISOMETRIC VIEW 3/C PROFILE ALUMINUM COILS, INC Soffits Appendix D ALC15001 FL12194-R3 Page 1 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. Fascia CREEK TECHNICAL SERVICES, LLC 3/4 7/8" 1/8" HEM 6'FASCIA T" BLANK ISOMETRIC VIEW ALUMINUM COILS, INC soffits Appendix D ALC15001 FL12194-R3 Page 2 of 4 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC 16" Q4 Soffit 18' BLANK 3 / 8 PROFILE 2.625 W. M rm. 25 7YP. 125 M. D DDDDD DDDDD DDDDDD DDDDD DDDDDD DDDDD pF fVMG VAfiFNN lF1 My F1 IDUvERS F0 120 M SAME pNECIION AS MBSi ALUMINUM COILS, INC Soffits Appendix D ALC15001 FL12194-R3 Page 3 of 4 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERviCES, LLC 12" T4 Soffit ALUMINUM COILS, INC Soffits Appendix D 31/8" 7/8" 1 31/8" 7/8" 1 31/8" 5/16" 1/2" 1/2" 1/2" 1/2" 1/2" 3/4" 1!8" 1/8" 3/8" 13.75" BLANK 3/8" PROFILE 2.625 REF. 50 71P. o 00000 DODDO, DDo00D 00000 0000D0 D0000 W OF L rA PAM" lR111 N n LOuvU6 FORMW DL S-ME DLtEM N AS FM) END OF REPORT ALC15001 FL12194-113 Page 4 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. Certificate of Authorization No. 29824CREEK17520EdinburghDr Tampa, FL 33647 TECHNICAL SERVICES, LLC (813) 480-3421 EVALUATION REPORT FLORIDA BUILDING CODE V EDITION (2014) Manufacturer: ALUMINUM COILS, INC. Issued August 27, 2015 5001 West Knox Street Tampa, FL 33634 813)249-9743 www.aluminumcollsinc.com Manufacturing: Tampa, FL Quality Assurance: PRI Construction Materials Technologies (QUA9110) SCOPE Category: Panel Walls Subcategory: Soffits Code Sections: 1404.5.1, 1710.9.4 Properties: Wind Resistance REFERENCES Entity Report No. Standard Year Certified Testing Laboratories (TST1577) CTLA 1847W AAMA 1402 1986 Certified Testing Laboratories (TST1577) CTLA 2076W AAMA 1402 1986 PRI Construction Materials Technologies (TST5878) ACIX-003-02-01 AAMA 1402 1986 PRI Construction Materials Technologies (TST5878) ACIX-003-02-02 AAMA 1402 1986 LIMITATIONS 1. This report Is not for use in the HVHZ. 2. Design wind loads shall be determined in accordance with FBC Section 1710.9.4. 3. Soffits shall be labeled in accordance with FBC Section 1710.9.2 and 1710.9.3. 4. Installation of the evaluated products shall comply with this report, the FBC and the manufacturer's published application Instructions. Where discrepancies exist between these sources, the more restrictive and FBC compliant installation detail shall prevail. S. Installations shall meet the minimum ventilation requirements of FBC section 1203.2. 6. Field fastener withdrawal may be required by the AHJ for confirmation of existing substrates. All data shall be reviewed by a qualified design professional to ensure the fastener withdrawal meets or exceeds the minimum'load resistance for the project requirements. 7. Ail products listed in this report shall be manufactured under a quality assurance program in compliance with Rule 61G20-3. PRODUCT DESCRIPTIONS 3/8" F-Channel Preformed nominal 0.016-Inch thick, 3105 H-14 aluminum F-channel. See Appendix D for dimension drawings. 3/8" J-Channel Preformed nominal 0.016-inch thick, 3105 H-14 aluminum J-channel. See Appendix D for dimension drawings. Fascia Preformed nominal 0.019-inch thick, 3105 H-14 aluminum fascia. See Appendix D for dimension drawings. ALC15001 FL12194-R3 Paae 1 of 3 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. c R E E (K ALUMINUM COILS, INC Soffitsim TECHNICAL SERVICES, LLC PROOUCT DESCRIPTION 16" 04 Soffit Preformed nominal 0.0135-inch thick, 3105 H-14 aluminum soffit P,anels provided in 16- inch sections. The reported net free ventllation areas are 22.3 in /lin.ft for the 'full vent' configuration and 11.1 in2/lin.ft and for the 'center vent' configuration. See Appendix D for dimension drawings. 16• SEM cur 12" T4 Soffit Preformed nominal 0.0135-inch thick, 3105 H-14 aluminum soffit P,anels provided in 12- inch sections. The reported net free ventilation areas are 12.5 in /lin.ft for the 'full vent' configuration and 4.2 in2Ain.ft for the 'center vent' configuration. See Appendix D for dimension drawings. ALC15001 FL12194-R3 Page 2 of 3 This evaluation report is provided for Stale of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Sorvicos, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICE$, LLC COMPLIANCE STATEMENT ALUMINUM COILS, INC Soffits The products evaluated herein by Zachary R. Priest, P.E. have demonstrated compliance with the Florida Building Code 5'" Edition (2014) as evidenced in the referenced documents submitted by the named manufacturer. 1 rtltrtrrrrr G PaY R .PA;F-,. 2015.08.27 No 74021 " 07:05:00 win........+-, a...., 04'00' 13 '. STATE OF 4U 0.' O R 10 NZachary R. Priest, P.E. FloridiS ONA; %% Organization ationNo. A E9641Registration No. 021 CERTIFICATION OF INDEPENDENCE CREEK Technical Services. LLC does not have, nor will it acquire, a financial interest In any company manufacturing or distributing products under this evaluation. CREEK Technical Services, LLC Is not owned, operated, or controlled by any company manufacturing or distributing products under this evaluation. Zachary R. Priest, P.E. does not have, nor will acquire, a financial Interest In any company manufacturing or distributing products under this evaluation. Zachary R. Priest, P.E. does not have, nor will acquire, a financial interest in any other entity involved in the approval process of the product. APPENDICES 1) APPENDIX A - Approved Systems (7 pages) 2) APPENDIX B - Installation Drawings (12 pages) 3) APPENDIX C - Design Wind Loads(4 pages) 4) APPENDIX D - Dimension Drawings (4 pages) ALC15001 FL12194- R3 Page 3 of 3 This evaluation report is provided for State of Florida product approval undor Rule 61G20-3. The manufacturer shall notify CREEK Technical Sorvices, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC APPROVED SYSTEMS ALUMINUM COILS. INC Soffits Appendix A The following notes shall be observed when using the assembly tables below. 1. Maximum Design Pressures (MDP) were calculated using a 1.5:1 margin of safety per FBC Section 1710.9.4. 2. Refer to LIMITATIONS and sections of this evaluation when using the table(s) below. 3. Refer to INSTALLATION section of this report for installation detail when the information is not explicitly stated for the selected assembly. 4. The on -center (o.c.) spacing given is the maximum allowable attachment spacing for the rated system. 5. Unless otherwise specified, the Wood substrate shall be minimum No. 2 SPF (S.G. = 0.42) 2x lumber. Substrate attachment shall be designed by others in accordance with FBC requirements to meet the minimum design requirements for the project 6. Unless otherwise specified, the Masonry substrate shall conform to ASTM C 90. Substrate attachment shall be designed by others in accordance with FBC requirements to meet the minimum design requirements for the project 7. Typical fastening details are as follows: a. 12" T4 Soffit— 12-inch o.c. Fastener Fastener Location Location 1 1 b. 12" T4 Soffit — 4-inch o.c. Fastener Fastener Fastener Fastener Location 1 Lo tion L tion Location 1 c. 16" 04 Soffit —16-inch o.c. Fastener Fastener Location Location f 4 ALC150D1 FL12194-R3 Page 1 of 7 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. Fes" CREEKIm TECHNICAL SERVICES, LLC d. 16" Q4 Soffit — 8-inch o.c. Fastener Lnration lr Fastener Fastener Location 1,'l ALUMINUM COILS, INC Soffits Approved System Numbers and Definitions 12F-# Approved Systems for 12-Inch Overhang with F-Channel 12J Approved Systems for 12-Inch Overhang with J-Channel 16F-# Approved Systems for 164nch Overhang with F-Channel 1 J-# Approved Systems for 164nch Overhang with J-Channel 24F Approved Systems for 244nch Overhang with F-Channel 24 Approved Systems for 24-inch Overhang with J-Channel 71 Appendix A Approved Systems for 12-inch overhang with F-Channel Wall Connection Eave Connection System Panel MDP No. Width psi) Substrate F-,Channel Substrate Panel Attachment Fascia Cap Attachment Attachment One (1) min. 3/8-inch head dia. nail, One (1) min. 318 x 3/8-inch One (1) min. 1 3/4-inch long x 12F-1 16-inch Wood min. 125 inch embedment spaced Wood crown staple spaced 1&inch 0.072-inch dia. x min. 3/16- 240.0 24-inch o.c. O.C. inch head dia. trim nail spaced 36-inch o.c. Max Three (3) min. 3/4-inch x 1/4-Inch One (1) min 3/44nch x 1/44nch One (1) min. 1 3/4-inch long x 12F-2 164nch Wood crown staples in diamond pattern Wood crown staple spaced 84nch o.c. 0.072-inch dia. x min. 1/4-inch 48 spaced 24-inch o.c. and securing each panel lap head dia. trip nail spaced 48- 64.2 inch o.c. 12F-3 Max. Masonry One (1) 14 ga. 5/8-inch long T Hall Wood One (1) min 3/44nch x 1/44nch One (1) min. 1 3/4-inch long x 0.0724nch dia. x min. 1/44nch 48 16-inch spaced 8-inch o.c. o.c. crown staple spaced nel head dia. trip nail spaced 48- 64.2 and securing each panel lapl inch o.c. ALC15001 FL12194-R3 Page 2 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC soffits Appendix A Approved Systems for 12-inch overhang with J-Channel Wall Connection Eave Connection System Panel MDP No. Width psf) Substrate F-Channel Attachment Panel Attachment Substrate Panel Attachment Fascia Cap Attachment Three (3) min. 3/4- inch x 1/4-inch crown One (1) min. #8 x 1/2-inch One (1) min 3n h x One (1) min. 1 3144nch long x 12J-1 Max. 16-inch Wood staples In diamond long x 3/8-inch head diameter y spaced 164nch o.c. Wood staplehcrownstaple1/4-inch 0.072-inch dia. x min. 1/4-inch head dia. trip nail spaced 48- 48 64.2 pattern spaced 24- connecting soffit to J-channel spaced 8-inch o.c.. spac Inch o.c. inch o.c Approved Systems for 164nch overhang with F-Channel Wall Connection Eave Connection System Panel MDP No. Width PSI) Substrate F-Channel Substrate Panel Attachment Fascia Cap Attachment Attachment One (1) 18 ga. 1/4 inch crown x One (1) min. 1.754nch x Ddiameter inch16F- 1 Max. Masonry One (1) 14 ga. 5/84nch long T nail Wood 1-inch leg staples spaced max. p finishing nailwithmin. 3/16- finishing 553.3 124nch spaced max. 84nch ox, 44nch o.c. and securing each inch head spaced panel lap 12-inch o.c. One (1) 18 ga. 1/4-Inch crown x One (1) min. 1.754nch x Max. Three ( 3)18 ga.1/4-inch crown x 1- 14nCh leg staples spaced max 0.072- inch diameter 16F-2 12 inch' Wood inch leg staples in diamond pattern Wood 4-Inch o.c. and securing each finishing nail with min. 3/16 53.3 spaced 164nch o.c. panel lap inch head spaced 12-inch o.c. Max. One ( 1) 3/84nchhead dia. nail, min. One (1) min 3 18-inch x 3/8-inch One (1) min. 1 314-inch long x 0. 072 inch dia. x min. 164nch Wood 1. 25-inch embedment spaced 24- Wood crown staple spaced 16-inch 3/16- inch head dia. trim nail t25.6 inch o. c. O.C. spaced 36-inch o.c. N Max. Three (3) min. 3/4-inch x 1/4-inch One (1) min 314-inch x 114-Inch One (1) min. 1 3/4-Inch long x 0. 072-inch dia. x min. 1/4- 27 16-inch Wood crow staples in diamond pattern n diamondndo.cyyppd crown staple spaced 84nch o.c. inch head dia. trip nail 36.1 spaced spaced 48-inch o.c. ALC15001 FL12194- R3 Page 3 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 16-inch overhang with F-Channef Wall Connection Eave Connection System Panel MDP No. Width psf) Substrate F-Channel Substrate Panel Attachment Fascia Cap Attachment Attachment One (1) 18 ga. 1/4 inch crown x One (1) min. 1.75-inch x 16F-5 Max. Masonry One (1)14 ga. 5/8-inch long T nail Wood 1-inch leg staples spaced 4- 0.072-inch diameter finishing nail with min. 3/16- 343.3 16-Inch spaced 8-inch o.c. inch o.c. and securing each inch head spaced panel lap 16-inch o.c. Three (3) 18 ga. 1/4-inch crown x 1- One (1) 18 ga. 114-inch crown x One (1) min. 1.75-inch x 0.072-inch diameter 16F-6 Max 16-inch Wood inch leg staples in diamond pattern Wood 1-inch leg staples spaced 4- inch o.c. and securing each finishing nail with min. 3116- 43.3 spaced 16-inch o.c. panel lap Inch head spaced 16-inch o.c. Approved Systems for 164nch overhang with J-Channel Wall Connection Eave Connection System Panel MDP No. Width psf) Substrate J-Channel Substrate Panel Attachment Fascia Cap Attachment Attachment Max. Three (3) min. 3/4-inch x 1/4-inch One (1) min 3/4-inch x 1/44nch One (1) min. 1 3/4-inch long x 0.072-inch dia. x 23.516.11 164nch Woodcrown staples in diamond pattern spaced 244nch o.c. Wood crown staple spaced 8-inch o.c. min. 1/4-inch head dia. trip 31.4 nail spaced 484nch o.c. ALC15001 FL12194-R3 Page 4 of 7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES- LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 24-inch overhang with F-Channel Wall Connection Center Connection Eave Connection System Panel MDP No. Width pso Substrate F-Channel Attachment Batten Panel Attachment Substrate Panel Attachment Fascia Cap Attachment One (1) 18 ga.1/4-Inch Nominal 1x2 crown x 1-inch leg No.2 SYP staples spaced Three (3) 18 ga.1/4- anchored to 12-Inch o.c. securing One (1)18 ga. 1/4- One (1) min. 1.754nch x Max. inch crown x 14nch rafter with one each panel lap inch crown x 1-inch 0.072-inch diameter 24F-1 12-inch Wood leg staples in min' 2.25- Wood leg staplesspaced 8- finishing nail with min. 801-90 diamond pattern I Inchx 7d ring nOne ( 1) min. 1.75-inch inch o.c. 3/ 16-inch head spaced spaced 16-inch o.c. shank nail x 0.072-inch diameter 12-inch o.c. 24- inch o.c. finishing nail with min. 3/ 16-inch head spaced 44nch o.c. One ( 1)18 ga.1/4-inch crown is 1-inch leg Nominal 1x2 staples spaced One ( 1) min. 1.5- No.2 SYP 124nch o.c. securing One (1) 18 ga. 1/4- One ( 1) min. 1.754nch x Max inch x 11 ga. anchored to each panel lap Inch crown x 1-inch 0. 072-inch diameter 80/ 24F- 2 12- inch Wood smooth shank rafter with one Wood leg staples spaced 8- finishing nail with min. 76 6 roofing nail spaced 1) 7d x 2.25- One (1) min. 1.754nch inch °'c' 3/ 164nch head spaced 164nch o.c. inch ring shank x 0.072-inch diameter 12-inch o.c. nail 24-inch o.c. finishing nail with min. 3/ 16-inch head spaced 4- inch o.c. One ( 1)18 ga.1/4-inch crown x 14nch leg Nominal 1x2 staples spaced No. 2 SYP 12-Inch o.c. securing One (1) 18 ga. 1/4- One ( 1) min. 1.75-inch x Max One (1) 14 ga. 5/8- anchored to each panel lap inch crown x 1-inch 0. 072-inch diameter 80/ 24F- 3 12- inch Masonry Inch long T nail rafter with one Wood leg staples spaced 8- spacedfinishing nail with min. 76.6 spaced 84nch o.c. 1) 7d x 2.25- One (1) min. 1.75-inch inch 3/ 164nch head spaced inch ring shank x 0.072-inch diameter 12-inch o.c. nail 244nch o.c. finishing nail with min. 3/ 16-inch head spaced 44nch o.c. ALC15001 FL12194-R3 5of7 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 24-inch overhang with F-Channel Wall Connection Center Connection Eave Connection System Panel MDP No. Width psf) Substrate F-Channel Batten Panel Attachment Substrate Panel Attachment Fascia Cap Attachment Attachment One (1)18 ga.1/4-inch Nominal 1x2 crown x 14nch leg No.2 SYP staples spaced Three (3) 18 ga.1/4- anchored to 124nch o.c. securing One (1) 18 ga. 1/4- One (1) min. 1.75-inch x Max. inch crown x 14nch rafter with one each panel lap inch crown x 1-inch 0.072-inch diameter 24F-4 16-inch Wood leg staples in 1) min. 2'25- Wood leg staples spaced 8- finishing nail with min. 801-60 diamond pattern inch x 7d ring One (1) min. 1.754nch inch o.c. and securing 3/16-inch head spaced spaced 164nch o.c. shank nail x 0.0724nch diameter each panel lap 16-inch o.c. 24-inch o.0 finishing nail with min. 3116-inch head spaced 4-inch o.c. One (1)18 ga. 1/4-inch crown x 14nch leg Nominal 1x2 staples spaced One (1) min. 1.5- No.2 SYP 124nch o.c. securing One (1)18 ga. 1/4- One (1) min. 1.75-inch x Max inch x 11 ga. anchored to each panel lap inch crown x 1-inch 0.072-inch diameter 24F-5 16-inch Wood smooth shank rafter with one Wood leg staples spaced 8- finishing nail with min. 801-60 roofing nail spaced 1) 7d x 2.25- One (1) min. 1.754nch inch o.c. and securing 3/16-inch head spaced 16-inch o.c. inch ring shank x 0.0724nch diameter each panel lap 16-inch o.c. nail 24-inch o.c. finishing nail with min. 3/16-inch head spaced 4-inch o.c. One (1)18 ga.1/4-inch crown x 1-inch leg Nominal 1x2 staples spaced No.2 SYP 124nch o.c. securing One (1)18 ga. 1/4- One (1) min. 1.75-inch x Max. One (1) 14 ga. 5/8- anchored to each panel lap inch crown x 1-Inch 0.072-inch diameter 24F-6 16-inch Masonry inch long T nail rafter with one Wood leg staples spaced 8- finishing nail with min. 801.60 spaced 8-inch o.c. 1) 7d x 2.25- One (1) min. 1.754nch inch o.c. and securing 3/16-inch head spaced inch ring shank x 0.072-inch diameter each panel lap 16-inch o.c. nail 24-inch o.c. finishing nail with min. 3/164nch head spaced 4-inch o.c. ALC15001 FL12194-R3 Page 6 of 7 This evaluation report is provided for Slate of Florida product approval under Rule 61 G20.3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREED TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix A Approved Systems for 244nch overhang with J-Channel Wall Connection Center Connection Eave Connection System Panel MDP No. Width Psi Batten J-Channel Batten Panel Attachment Substrate Panel Attachment Fascia Cap Attachment Attachment Nominal 1x2 No.2 SYP scabbed between rafters with one (1) One (1) 18 ga.1/44nch Nominal 1X2Norm min. 2.2SInch x 7d d shank nail crown x 1-inch leg SYP anchored to Three 3 18 ga.1/4-inch crown atraight-nailed through the Into the end staples spaced 12 each open securing One (1) 18 ga. ''Y One (1) min. 1.754nch 24J_1 Max rafter with one x 1-inch leg rafter of the batten or two (2) each panel lap Wood inch crown x 1-inch x 0.072 Inch diameter finishing nail with min. i60 124nch 1) min. 2.25- staples in diamond min. 2.2SIncn x 7d One (1) min.1.7Sinch leg staples spaced 3/16-inch head spaced inch x 7d ring pattern spaced 16- ring shank nails toe- tt 0.0724nch diameter 8-inch o.c. 12-inch o.c. shank nail inch o.c. nailed on either side of finishing nail with min. 244nch O.C. the batten at each batteNrefter 3/164nch head spaced Intersection. Max. 4-inch o.c. rafter spacing Is 24-inch o.c. Nominal 1x2 No.2 SYP scabbed between rafters with one (1) One (1) 18 ga.t/flinch Nominal 1 x2 min. 22SInch x 7tl ring shank nail crown x 14nch leg No.2 SYP Three 3 18 straight -nailed through staples spaced One 1 18 a. %.- g One 1 min. 1.754nch anchored to ga.1/4-inch crown the rafter into the and 124nch o.c. securing Pesch panel lap inch crown x 1-inch x 0.072-inch diameter 2q.1-p Max rafter with one x 1-inch leg of the batten or two (2) Wood leg staples spaced finishing nail with min. 53.3 16-inch 1) min. 2.25 staples in diamond min. 22Sinch x 7d One (1) min. 1.7SInch 8-inch o.c. and 3/16-inch head spaced inch x 7d ring pattern spaced 16- ring shank nails toe x 0.072411ch diameter securing each panel 164nch o.c. shank nail inch o.c. nailed on either sWe of finishing nail with min lap 24inch o.c. the batten at each batten/refter 31164neh head spaced intersection. Max. 4-inch o.c. rafter spacing is 244neh o.c. ALCIS001 FL12194-R3 Page 7 of 7 This evaluation report is provided for State of Florida product approval under Rule 614320-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. L / V1 E E K TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B INSTALLATION Note - Refer to the APPROVED SYSTEMS section of this report for additional installation details of a selected system and maximum design pressures limitations. 12F-1 & 12F-3 No. I Installation Detail Min. 3/6• h"el dia. nail with min. !,o an3a9emtnt(for woo: suLctrata) or min. 9.0971 dia. T-n>il ar stub nail 2 _h min. 5/8' angegamant(for=ri_reta or.tl..:k eubstra:u). spaesd as uotud ASCIA SLIP BOARD ASCIA TRIM SOFFIT (OVERHANG WIDTH VARIES) FASCIA LIP 1 /4 MIN STAPLE SOFFIT TO FASCIA BOARD #T50 3/8" X 3/8'' STAPLE 16" 0. C. L-PAINTED S.S. 1 3/4" TRIM NAIL 5 NAILS PER 12' PIECE SOFFIT & FASCIA DETAIL ALC15001 FL12194-R3 Page 1 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC soffits Appendix B System No. Installation Detail n SOFFIT STAPLE OPEN RAFTER ,` DIAMOND PATTERN CROWN ST,Pt I I ' ; DETAIL USING A DIAMOND Sr ats PATTERN FACIA BOARD \ le FASCIA CAP 12F-2 3/4- X 1/4- CROWN FACIA BOARD 1-3/4- TRIM NAIL B' STAPLE ON CENTER 1-3/4' TRIM NAIL PAINTED S.S. F" CHANNEL CAN 8E PAINTED S.S. 48" FASCIA CAP INSTALLED WITH THE O.C. C NAILING FLANGE UP OR 3/4' X 1/4' DOWN CROWN STAPLE SOFFIT- mar.. 32- span SOFFITSUBSTRATE SOFFIT & FASCIA DETAIL ALC15001 FL12194-R3 Page 2 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. 12J-1 CREEK TECHNICAL SERVICES, LLC No. I Installation Detail OPEN RAFTER 3/4- X 1/4- CROWN STAPLE '24- ON CENTER USING A DIAMOND PATTERN u i J—CHANNEL 1-3/4- TRIM NAIL ocr4ued to coffit pUMEO S.S. 48' with oae(1) 58 a 1!2" r 3/8• head O.C. diameter screi:, 16` C.C. SOFFIT —max. 12-inch span WOOD OR BLOCK SUBSTRATE ALUMINUM COILS, INC Soffits Appendix B nKr.MM % SOFFIT STAPLE 1 L DIAMOND PATTERN DETAIL FACIA BOARD % ErvmMr sr n.ts i ASOA CAP 3/4- X 1/4- CROWN 1-3/4' TRIM NAIL NACU BOARD STAPLE '8" ON CENTER PAINTED S.S. FASCIA CAP 3/4' X 1/4' CROWN STAPLE Tfj;131 SOFFIT & FASCIA DETAIL ALC15001 FL12194-R3 Page 3 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES. LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail qY It TRIM MALL A ,,---FASCIA BOARD PALNfED S.S. rr fASCLk CAP SOFFIT 1`4- CROWN STAPLE OPEN RAFTER FASCM BOARD q 6! Is NI:t 16F-1 SOFFIT 8 FASCIA 16F-5 DETAIL 44C14 UPI REFER TO SOFFIT t FASCIA DETAIL f' CNANhEI SOFFIT: MAX It' SPAN MASONRY SUBSTRATE ALC15001 FL12194-R3 Page 4 of 12 This evaluation report is provided for State of Florida product approval under Rule 611320-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC 16F-3 No. I Installation Detail Min. 3/S" head Alt. ne11 with min. 1!:" on,a,jamenctfor %nod substrate? or min. 0.057' dia.'T-nail or sttib nail with min. 5%3': 6nca•3emenc(for cgncrata or block substrate). spaced As nocad above. ASCIA SUP BOARD FASCIA TRIM SOFFIT (OVERHANG WIDTH VARIES) CHANNEL Wood, Concrete or Block Nall FASCIA LIP 1 /4" STAPLE SOFFIT TO FASCIA BOARD #T50 3/8" X 3/8" STAPLE 16" 0. C. L-PAINTED S.S. 1 3/4" TRIM NAIL MIN. 5 NAILS PER 12' PIECE SOFFIT & FASCIA DETAIL ALUMINUM COILS, INC Soffits Appendix B ALC15001 FL12194-R3 Page 5 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail j r w n , SOFFIT STAPLE OPEN RAFTER DIAMOND PATTERN 3/4' x 1/4' DETAILCROWNSTAPLES1r USING A DIAMOND -- STAPLES PATTERN FACU BOARD FASCIA CAP 16F-4 3/4- X 1/4- CROWN FACIA BOARD 8" 1-3/4' TRIM NAIL STAPLE ON CENTER 1-3/4' TRIM NAIL PAINTED S.S. T—'F' CHANNEL -CAN BE PAINTED S.S. 48' FASCIA CAPINSTALLEDWITHTHEOC. NAILING FLANGE UP OR 3/4" X 1/4' DOWN CROWN STAPLE SOFFIT —max. 16--inch spar+. WOOD SOFFIT SUBSTRATE SOFFIT &FASCIA DETAIL ALC15001 FL12194-R3 Page 6 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notiy CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. M CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail I I- TRIM NAIL FASCIA BOARD PAINTED SS FASCIA CAP I SOfFIi 1' CROWN STAPLE OPEN RAFTER FASCIA BOARD t'I}' CROWN STAPLES SOFFIT 8 FASCIA USNO A DIAMOND 16F-2 & PATTERN- REFER TO DETAIL SOFRT STAPLE 16F-6 DIAMOND PATTERN DETAIL L S OF REFER 10 10 SOFFIT11 & FASCIA F' CHANNEL DETAIL 6- 3,8 1 SOFFIT; MAX. 16' SPAN MOOD SOBSTRATE SOFFIT STAPLE DIAMOND PATTERN ALC15001 FL12194-R3 Page 7 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES. LLC System No. I Installation Detail 16J-1 3/4' x 1/4' CROWN STAPLE '24' ON CENTER USING A DIAMOND PATTERN WOOD OR BLOCK SUBSTRATE 1-3/4- TRIM PAINTED S.S. O.C. SOFFrr—max. ALUMINUM COILS, INC Soffits Appendix B OPEN RAFTER • — y sr' " ; SOFFIT STAPLE Dlsr + ' DIAMOND PATTERNI ' FACIA BOARD DETAIL tit -I i FASCIA CAP 3/4' X 1/4' CROWN FACIA BOARD STAPLE '8- ON CENTER 1-3/4' TRIM NAIL NN_L PAINTED S.S. FASCIA CAP 3/4- X 1/4- CROWN STAPLE 16-inch scan SOFFIT SOFFIT & FASCIA DETAIL ALC15001 FL12194-R3 Page 8 of 12 This evaluation report is provided for State of Florida product approval under Rule 611320-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail 1 P NTE NAIL FASCIA BOARD PANTED S.S. r I STAPLES FASCIA CAP USOtG A DUNOND SOifIT PATTERN: REFER TO ra (iDXN STAPLE SOME STAPLE OWTOSO PATTERN 1 OE f AIL I 1 1 TRIM NAIL FASCIA BOARD III PAINTED S.S. SOFFIT FASCIA DETAIL 24F-1 & t ` 24F-4 rd' CROWN STAPLE FASCIA CAP; REFER TO SOFFIT t FASCIA DETAIL He" r,T SrP 3rejjBattenMM:ored to SOFFIT: HAIL TA' F-CHANNEL Rafters WJh me Td — — Rlry Shank NaB at every Ratter l MOOD SUBS111AiE \ / SOFFIT STAPLE DIAMOND PATTERN ALC15001 FL12194-R3 Page 9 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are riot specifically addressed herein. HCREEKTECHNICALSERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail 1 f - TRIM NAIL FASCIA BOARO 14- SMOOTH SMA%R PAINTED S.S. I.,,—FASUA CAP ROOF NABS SOffll Ir. I CROWN STAPLE 1 1 t- TRIM NAIL FASCIA BOARD PANTED $S. SOFFIT & FASCIA 24F-2 & DETAIL 24F-5 1'at' CROWN SIAPIE FASCIA CAP; FERRE 10 SOFFIT I FASCIA DETA0. Noamal 1-12- SYP Batten AnthoreO to SOFFIT. MAX 24- F•C1UNNE Ratters rdh we t0 Ring Shank Nail at a+ery Ratter WOOD SUBSTRATE ALC15001 FL12194-R3 Page 10 of 12 This evaluation report is provided for State of Florida product approval under Rule 611320-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail 1 }- 1RIM MAR. FASCIA BOARD PANTED S.S. / KEA T-NAILS I FASCIA CAP SOFFIT rej- CROWN STAPLE 1 1 l!• TRW NAIL FASCIA BOARDPAINTEDS.S. SOFFIT L FASCIA 24F-3 & DETAIL 24F-6 re' CROWN STAPLE FASOA UPS REFER i0 SOFFIT i FASCIA I DETAIL NavW 1'e2• STPac F-CNAMMEL Batten Anthoreo to SOFFIT: MAX. 24• Rallers -4h me Id RMq Shank Man at every Rafter MASONRY ALCIS001 FL12194-R3 Page 11 of 12 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. M CREED TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix B System No. Installation Detail I f' tRM NAIL FASEtA BOARD PAINTED SS. I-q' CROWN FASCIA CAP STAPLES uSCNG A OIAXOIIO SOFFIT [ ANTRiVEREOPAIIERN:REFER 10 f - CROWN STAPLE SOFFIT STAPLE OtANOI10 PATTERN RAFTER DETAIL FASCIA BOARD I TRIM UAL SOFFIT & FASCIA PAINTED S.S. DETAIL 24J-1 CROWN ST1'' APLE 24J-2 FASCIA CAP: REFER \ SFTO SOFFIT A FASCIA DETAIL NOMAU11- sisYPoftmf snooeto: ren lam O;r.t 3/B 1-[XANREI fp9n Oe (I) 70IN moot f]I fNBY;InAIOAeo 1 IvouSn 19t rifler the en WOOD SUBSTRATE orX in cc wo(2 ring qua nts eeAwK en - enhei sift at the Oin" a In* oatwteln ntenecim / SOFFIT. STAPLE DIAMOND PATTERN ALClSO01 FL12194-R3 Page 12 of 12 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC DESIGN WIND LOADS ALUMINUM COILS, INC soffits Appendix C The following tables provide design wind loads for components and cladding in accordance with Section 1609.1 of the FBC and ASCE 7-10 under the following provisions: 1. Wind speeds for risk category I, II, III, and IV buildings shall be as defined in Section 1609 of the FBC. 2. Exposure B, C, and D shall be as defined in section 1609 of the FBC. 3. Design wind loads are provided only for walls/soffits with a mean roof height less than or equal to 60-ft. 4. All calculations are based on an effective wind area of 10-ft2 or less. 5. Topographic factors such as escarpments or hills have been excluded from the analysis. 6. Wind directionality factor, Ka = 0.85 7. V„h is shown in the tables below. Design pressures are multiplied by 0.6 in accordance with Section 1610.9.4 of the FBC. 8. Projects with mean roof heights greater than 60-ft shall be evaluated by a licensed design professional. 9. Zones 4 and 5 shall be defined as shown below. Dimension "a" shall be 10% of the least horizontal dimension or (0.4 x Mean Roof Height), whichever is smaller, but not less than either 4% of the least horizontal dimension or 3-ft. ALC15001 FL12194-R3 Page 1 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. GREED TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix C Design Wind,Fressures for Soffits in Exposure B Building Type Zone Mean-: Roof _ Height ft Basic Wind Speed mph) 120 130 140 150 160 170 180 . 190 200 Enclosed 4 20 16.9 19.8 22.9 26:3 30.0 33.8 37.9 42.2 46.8 25 16.9 19.8 22.9 26.3 30.0 33.8 37.9 42.2 46.8 30 16.9 19.8 22.9 26.3 30.0 33.8 37.9 42.2 46.8 40 18.3 2.1.5 24.9 28.6 32.5 36.7 41.2 45.9 50.8 50 19.5 22.9 26.5 30.5 34.7 39.1 43.9 48.9 54.1 60 20.5 24.0 27.8 32.0 36.4 41.1 46.0 51.3 56.8 Negative Loads) 5 20 20.8 24.4 28.3 32.5 37.0 41.7 46.8 52.1 57.8 25 20.8 24.4 28.3 32.5 37.0 41.7 46.8 52.1 57.8 30 20.8 24.4 28.3 32.5 37.0 41.7 46.8 52.1 57.8 40 22.6 1 -26.5 30.7 35.3 40.1 45.3 1 -50.8 56.6 62.7 50 24.1 28.2 32.8 37.6 42.8 48.3 54.1 60.3 66.8 60 25.3 29.6 34.4 39.5 44.9 50.7 56.8 63.3 70.1 Enclosed 4 20 10.8 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 25 10.8 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 30 10.8 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 40 11.7 13.8 16.0 18.3 20.8 23.5 1 26.4 29.4 32.5 50 12.5 14.7 17.0 19.5 22.2 25.1 28.1 31.3 34.7 60 13.1 15.4 17.8 20.5 23.3 26.3 29.5 32.9 36.4 Positive Loads) 5 20 10.8 12.7 1 14.7 16.9 19.2 21.7 24.3 27.1 30.0 25 10.8 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 30 10.8 1 12.7 14.7 16.9 19.2 21.7 24.3 27.1 30.0 40 11.7 13.8 16.0 18.3 20.8 23.5 1 26.4 32.5 50 12.5 14.7 17.0 19.5 22.2 25.1 28.1 34.7 60 13.1 15.4 17.8 20.5 23.3 26.3 29.536.4IM ALCIS001 FL12194-R3 Page 2 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix C Design Wind'Pressures for S6ffits.in Ex ostlre C Building Type Zone Mean Roof Height ft Basic Wind Speed mph) 120 ' 136 140 1.50 - 160 170 180 190 200 . Enclosed 4 20 21.7 25.4 29.5 33.8 38.5 43.5 48.7 54.3 60.2 25 22.6 26.6 30.8 35.4 40.2 45.4 50.9 56.7 62.8 30 23.6 27.7 32.1 36.9 41.9 47.3 53.1 59.1 65.5 40 25.0 29.4 34.1 39.1 44.5 50.2 56.3 62.7 69.5 50 26.2 30.8 35.7 41.0 46.6 52.6 59.0 65.8 72.9 60 27.2 31.9 37.0 42.5 48.3 54.6 61.2 68.2 75.5Negative Loads) 5 20 26.7 31.4 36.4 41.8 47.5 53.7 60.2 67.0 74.3 25 27.9 32.8 38.0 43.6 49.6 56.0 62.8 70.0 77.6 30 29.1 34.2 39.6 45.5 51.8 58.4 65.5 73.0 80.9 40 30.9 36.3 42.1 48.3 54.9 62.0 1 -69.5 77.5 85.8 50 32.4 38.0 44.1 50.6 57.6 65.0 72.9 81.2 89.9 60 33.6 39.4 45.7 5.5 59.7 67.4 75.5 84.2 93.2 Enclosed 4 20 13.9 16.3 18.9 21.7 24.7 27.9 31.2 34.8 38.5 25 14.5 17.0 19.7 22.6 25.8 29.1 32.6 36.3 40.3 30 15.1 17.7 20.6 23.6 26.9 30.3 34.0 37.9 42.0 40 16.0 18.8 21.8 25.1 28.5 32.2 1 36.1 40.2 44.5 50 16.8 19.7 22.9 26.3 29.9 33.7 37.8 42.1 46.7 60 17.4 20.5 23.7 27.2 31.0 35.0 39.2 43.7 48.4Positive Loads) 5 20 13.9 16.3 18.9 21.7 24.7 27.9 31.2 34.8 38.5 25 14.5 17.0 19.7 22.6 25.8 29.1 32.6 36.3 40.3 30 15.1 17.7 20.6 23.6 26.9 30.3 34.0 37.9 42.0 40 16.0 18.8 21.8 25.1 28.5 32.2 36.1 40.2 44.5 50 16.8 19.7 22.9 26.3 29.9 33.7 37.8 42.1 46.7 60 17.4 20.5 1 23.7 1 27.2 1 31.0 35.0 39.2 43.7 48.4 ALC15001 FL12194-R3 Page 3 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC ALUMINUM COILS, INC Soffits Appendix C Design Wind Pressures for Soffits in, Exposure D Building Type Zone Mean' Roof Height ft Basic Wind Speed mph) 120 130 146 150 160 170 180 190 200 Enclosed 4 20 26.0 30.5 35.4 40.6 46.2 52.2 58.5 65.2 72.2 25 27.0 31.6 36.7 42.1 47.9 54.1 60.6 67.6 74.9 30 27.9 32.8 38.0 43.6 49.6 56.0 62.8 70.0 77.5 40 29.4 34.5 40.0 45.9 52.2 58.9 66.1 73.6 81.6 50 30:6 35.9 41.6 47.8 54.3 61.3 68.8 76.6 84.9 60 31.5 37.0 42.9 49.3 56.1 63.3 70.9 79.0 87.6 Negative Loads) 5 20 32.1 37.7 43.7 50.1 57.0 64.4 72.2 80.4 89.1 25 33.3 39.1 45.3 52.0 59.2 66.8 74.9 83.4 92.4 30 34.5 40.4 46.9 53.8 61.3 69.2 77.5 86.4 95.7 40 36.2 42.5 49.3 56.6 64.4 72.7 81.5 90.9 100.7 50 37.7 A4.3 51.4 58.9 67.1 75.7 84.9 94.6 104.8 60 38.9 45.7 53.0 60.8 69.2 78.1 87.6 97.6 108.1 Enclosed 4 20 16.7 19.5 22.7 26.0 29.6 33.4 37.5 41.7 46.3 25 17.3 20.3 23.5 27.0 30.7 34.7 38.9 43.3 48.0 30 17.9 21.0 24.3 27.9 31.8 35.9 40.2 44.8 49.7 40 18.8 22.1 25.6 29.4 33.4 37.8 42.3 47.2 52.2 50 19.6 23.0 26.7 30.6 34.8 39.3 44.1 49.1 54.4 60 20.2 23.7 27.5 31.6 35.9 40.5 45.4 50.6 56.1 Positive Loads) 5 20 16.7 19.5 22.7 26.0 29.6 33.4 37.5 1 41.7 46.3 25 17.3 20.3 23.5 27.0 30.7 34.7 38.9 43.3 48.0 30 17.9 21.0 24.3 27.9 31.8 35.9 40.2 44.8 49.7 40 18.8 22.1 25.6 29.4 33.4 37.8 42.3 47.2 52.2 50 19.6 23.0 26.7 30.6 34.8 39.3 44.1 49.1 54.4 60 20.2 23.7 27.5 31.6 35.9 40.5 45.4 50.6 1 56.1 ALC15001 FL12194-R3 Page 4 of 4 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK kv TECHNICAL SERVICES, LLC 3/8" F-Channel 3/8" J-Channel 3/8" 3/4" — r t/8' HEM i 518" 1 T 3/4- 3/8' ISOMETRIC VIEW 3/C PROFILE ISOMETRIC vIEW 3/0- PROFILE ALUMINUM COILS, INC Soffits Appendix D ALC15001 FL12194-R3 Page 1 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. Fascia CREEK TECHNICAL SERVICES, LLC S 3/4" 1/8" HEM 6"FASCIA 7" BLANK 1/4" ISOMETRIC VIEW ALUMINUM COILS, INC Soffits Appendix D ALC15001 FL12194-R3 Page 2 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20.3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC 16" 04 Soffit W;Ik,-j 18' BLANK 3 / 8 PROFILE D oD000 ooDDD— OD00D0 DDDOD DDDDDO DDDDD MIf M.W;k PATrMN In", V fl rlZWM PURM D " S.-W Dmcr" AS -er, ALUMINUM COILS, INC Soffits Appendix D ALC15001 FL12194-R3 Page 3 of 4 This evaluation report is provided for State of Florida product approval under Rule 61 G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. CREEK TECHNICAL SERVICES, LLC 12" T4 Soffit ALUMINUM COILS, INC Soffits Appendix D vu r.o v0 rig vv S/16" \ 1/2" 3/8' 13.75" BLANK 3/8" PROFILE 2.625 REF. 50 TP. 2° TP. Q125 M. DDODD D0000, 000UD0 O.ODOD m 0 D 0 0 0 D0D0D or I&Nyt PArrMN frelI Mon LOWERS FORMED IN &WE D1R[Cn0N AS IE9S) END OF REPORT ALC15001 FL12194-R3 Page 4 of 4 This evaluation report is provided for State of Florida product approval under Rule 61G20-3. The manufacturer shall notify CREEK Technical Services, LLC of any product changes or quality assurance changes throughout the duration for which this report is valid. This evaluation report does not express nor imply warranty, installation, recommended use, or other product attributes that are not specifically addressed herein. 4/28I2017 Florida Building Code Online v tll vJJ:(it?a`i:i,•/r•Mr+. as f lL, t. 3 i r..-_.. r..` ..-s's._.__._. ._,.., /' ".$i ••u tl 1'3•f..{• t'l • CPi 1'•tnC+:t3; eeis Home I Log in I user Registration I Hoc r°pia I summit surcharge I stars a Facts I PuNcations I FeC staff ; SCIS Site Map I Link I search Htk' il:l r uctApproval Public User Product Approval Menu > Prp[hut pr AotNlcaUon Search > Application List > Application Oetail FL It FL13192-R4 Application Type Revision Code Version 2014 Application Status Approved Comments Archived Product Manufacturer James Hardie Building Products, Inc. Address/ Phone/Email 26300 La Alameda Ste. 2S0 Mission Viejo, CA 92691 909) 349-2927 pingsheng. zhu@jameshardle.com Authorized Signature Pingsheng Zhu pingsheng. zhu@jameshardie.com Technical Representative Pingsheng Zhu Address/ Phone/Email 10901 Elm Ave. Fontana, CA 92337 909) 349-2927 pingsheng. zhu@jameshardle.com Quality Assurance Representative Pingsheng Zhu Address/ Phone/Email 10901 Elm Ave. Fontana, CA 92337 909) 349-2927 pingsheng. zhu@jameshardle.com Category Panel Walls Subcategory Siding Compliance Method Evaluation Report from a Florida Registered Architect or a Licensed Florida Professional Engineer kt Evaluation Report - Hardcopy Received Florida Engineer or Architect Name who developed Ronald I. Ogawa the Evaluation Report Florida License PE-24121 Quality Assurance Entity Intertek Testing Services NA, Inc. Quality Assurance Contract Expiration Date 01/01/2018 Validated By John Southard, P.E. e: Validation Checklist - Hardcopy Received Certificate of Independence FL13192 R4 COI RIO - Certificate of Indeoendence.PDF Referenced Standard and Year (of Standard) Standard ASTM C1186 ASTM E330 Year 2007 2002 Equivalence of Product Standards Certified By Florida Licensed Professional Engineer or Architect FL13192 R4 Eauiv ASTM C1186 Eauivalencv Slaned.odf https• 1/www.0oridabuilding.orgfpr/pr app dtl.aspx9parain=wGEVXOwtDglsk%2bGnUu47ogxmaHRnHIID4CXwhKRgKDf7RrxWwZsbgMlo3d%3d 1/3 4/28/2017 Florida Building Code Online Sections from the Code Product Approval Method Method 1 Option 0 Date Submitted 08/17/2015 Date Validated 08/26/2015 Date Pending FBC Approval 09/07/201S Date Approved 1.0/16/2015 iummamof Protlucts ?' _r.. . ----- U` .:>>.,.... _.:i:'__ . ._.:: ._. ter:. :__._.. _ _ _. `:. .... . FL # — Model, Number or Name - De'scrlption . 13192.1 Cemplank Lap Siding fiber -cement lap siding Limits of Use Installation Instructions — Approved for use in HVHZ: Yes FL13192 R4 lI ER RIO-2553-LS Plank metal wood.odf Approved for use outside HVHZ: Yes FL13192 R4 II ER RIO-2SS7-15 Plank Shingle CMU.odf Impact Resistant: N/A FL13192 R4 II ER RIO-2577-15 Plank to WSP Sheathina.odf Design Pressure: N/A FL13192 R4 II Install CemPlank Sldino.odf Other: For use In HVHZ Install In accordance with NOA 1S- FL13192 R4 It NOA 15-0122.04.odf 0122.04. Verified By: Ronald I. Ogawa 24121 Created by Independent Third Party: No Evaluation Reports FL13192 R4 AE ER 11I0-2553-15 Plank metal wood.odf FL13192 R4 AE ER RIO-2S57-1S Plank Shlnale CMU.odf FL13192 R4 AE ER RIO-2577-15 Plank to WSP Sheathino.odf FL13192 R4 AE NOA 15-0122.04.odf Created by Independent Third Party: Yes 13192.2 IlardleP.lank Lap Siding Hber-cement lap •slding Limits'of Use, ' Installation Instructions .. Approved -for use•in HVHZ: Yes Approved for use outside HVHZi Yes 3192 R4- tl ER RIO-2553-15 Plank metal wood.odf' 13i92 R4' [t 'ER 1110=2SS7-I5'Plank Shingle CMU.odf Impact Resistant: N/A .. FL13192: R4 II ER RIO-2577-IS Plank to WSP Sheathinu.ndf' FL13192 -R4' II -:Install HardlePlank`•Sldina.odfDesignPressure:•N/A Other:::F,or'use,in HVHZ Install in accordance.with NOA 15-' : FL13192 R4 •11-NOA.15-0122.04.pdf'- 0122.04.`; ': ' ,,• :. " ; :. Verified'By:,Intertek.Testing Services NA Ltd.: Created by[ndependent•ThiFd Party:'No ."• ••• 1. ••, ._. Eva _ . uatio.Reports 01.42 •R4 AE ER 11I6-2553-15 Plank metal wood:odf'. . FL13192 R4'•AE-ER•1110-2557.15 PlanWShlnole CMU.odf F1.0142 R4 AE•'ER RIO-2S77-IS Plank to'WSP Sheathina.odf FL•1319'NOA•15-0122.04: od2R4'AE f Create ' d by Indeperideni Third Party: Yes' ; 13192.3 HardleShingle Individual Shingles fiber -cement individual cladding shingles Limits of Use Installation Instructions Approved for use In HVHZ: No FL13192 R4 11 ER RIO-25SS-IS Shingle metal wood.odf Approved for use outside HVHZ: Yes FL13192 R4 If Install HardieShinale Sidino.odf Impact Resistant: N/A Verified By: Intertek Testing Services NA Ltd. Design Pressure: N/A Created by Independent Third Party: No Other: Evaluation Reports FL13192 R4 AE ER RIO-25SS-IS Shingle metal wood.odf Created by Independent Third Party: Yes 13192.4 Hardie5fiingle Panel staggered flber-cement' notched,shingle•panels (Walght`edg*. edge, half round' edge)' Limits of Use .' Installation Instructions Approved foe%ise'in•H%iHZ: No' vf113192• R4' I[ ER•RIO-2555-15 Shlnale metal wood.odf Approved.for use outside•HVHZ:,Yes FL13192 R4-•II-ER RIO-2SS7-IS'Plank'Shlnole CMU.odf•: ' Impaet.Resistant: IV/A' .; FL13192 R4 lI Install HardleShlnole SWino.odf-: Design Pressure: N%A Verlfled:By:, Intertek Testing Services NA Ltd. Created by: [ridependerit Thlyd;Party: No Evaluatiori•Repods ' EL13192'R4 AE ER R[O-25SS-LS•Shingle metal wood.odf FL13192 .114 AE ER'RIO-2557=15 Plank Shingle CMU.odfi'•. Created by Indepoderit Third Party: -Yes 13192.S Prevail Lap Siding fiber -cement lap siding Limits of Use Installation Instructions Approved for use in HVHZ: Yes . F113192 R4 II ER RIO-2553-15 Plank metal wood.gdf httpsJhvww.floridabuilding.org/pr/pr app dtl.espx?param=wGEVXOwtDgtsk%2bGnUu47ogxlnaHRnHIID4CXwWRgKDf7RrxWwZsbgMlo3d%3d 2/3 4/28/2017 Florida Building Code Online Approved for use outside HVHZ: Yes Impact Resistant: N/A Design Pressure: N/A Other: For use In HVHZ Install In accordance with NOA 15- 0122.04. FL13192 R4 It ER RIO-2557-IS Plank Shingle CMU.odf FL13192 R4 H ER RIO-2577-15 Plank to WSP Sheathlno.odf FL13192 R4 11 Install Prevail Lao Slding.odf FL13192 R4 If NOA 15-0122.04.odf Verified By: Intertek Testing Services NA Ltd. Created by Independent Third Party: No Evaluation Reports FL13192 R4 AE ER RIO-2553-IS Plank metal wood.odf FL13192 R4 AE ER RIO-2557-15 Plank Shingle CMU.odf FL13192 R4 AE ER RIO-2577-15 Plank to WSP Sheathing.odf FL13192 R4 AE NOA 1S-0122.04.odf Created by Independent Third Party: Yes Nllx Contact Us :: 2601 Blair Stone (toad. Tallahassee FL 32399 Phone: M-487-1924 The State of Florida Is an AA/EEO employer. Caovnaht 2007.2013 State of Florida.:: Privacy Statement :: Accessibility Statement :: Refund Statement Under Florida law, email addresses are pudic records. If you do not want your a -mall address released In response to a public -records request, do not send electronic mall to this entity. Instead, contact the office by phone or by traditional mall. If you have any questlons, please contact 11S0.487.139S. *Pursuant to Section 4SS.275(t), Florida Statutes, effective October 1, 2012. licensees licensed under Chapter 45S, F.S. must provide the Department with an email address If they have one. The emalls provided may be used for ofnddl communication with the licensee. However email addresses are public record. If you do not wish to supply a personal address, please provide the Department with an email address which can be made available to the pudic. To determine If you are a licensee under Chapter 4SS, F.S., please dick b=. Product Approval Accepts: IM Z ® -La Credit Card Sale https://www.(loridabtrilding.org/pr/pr app dU.aspx?param=wGEVXOwtOgtsk%2bGnUu47ogxmaHRnH1104CXwhKRgKOf7RrxWwZsbgA%3d%3d 3/3 Florida Product Approval HardiePlank° Lap Siding For use inside HVHZ: o HardiePlank Lap Siding fastener types, fastening schedule, and installation shall be in accordance with the Miami -Dade County Florida NOA 15- 0122.04. Consult the HardiePlank product installation instructions on the follow pages for all other installation requirements. For use outside of HVHZ, o HardiePlank Lap Siding fastener types, fastening schedule; and installation shall be in accordance with Engineering Evaluation Reports RIO-2553-15 or RIO-2557-15. Consult the HardiePlank product installation instructions on the follow pages for all other installation requirements. 0 HardiePlank° A >o Lap Siding JamesHardie EFFECTIVE SEPTEMBER 2013 INSTALLATION REQUIREMENTS - PRIMED & COLORPLUV PRODUCTS VsIt Hy I nwJxaJe.can for (he most recent version. SELECT CEDARMIW • SMOOTH • CUSTOM COLONIAL" SMOOTH • CUSTOM COLONIAL'" ROUGHSAWN CUSTOM BEADED CEDARMILO • CUSTOM BEADED SMOOTH • STRAIGHT -EDGE SHINGLE PLANK IMPORTANT: FAILURE TO INSTALL AND FINISH THIS PRODUCT IN ACCORDANCE WITH APPLICABLE BUILDING CODES AND JAMES HARDIE WRITTEN APPLICATION INSTRUCTIONS MAY LEAD TO PERSONAL INJURY, AFFECT SYSTEM PERFORMANCE, VIOLATE LOCAL BUILDING CODES, AND VOID THE PRODUCT ONLY WARRANTY. BEFORE INSTALLATION, CONFIRM THATYOU ARE USING THE CORRECT HARDIEZONr PRODUCT INSTRUCTIONS. INSTALLATION OF HZ100 PRODUCTS OUTSIDE AN HZ100 LOCATION WILL VOID YOUR WARRANTY. TO DETERMINE WHICH HARDIEZONE` APPLIES TO YOUR LOCATION, VISIT WWW.HARDIEZONE.COM OWCALL 1-866-942-7343 (866 9HARDIE) STORAGE & HANDLING: Store Oat and keep dry and covered prior to installation. InstallIng siding wet or saturated may result in shrinkage at btdl iotms. Garry planks on edge. Protect edges and corners from breakage. James Hardie is not responsible for damage caused by improper storage and handling of the product. CUTTING INST 0UrD00RS INDOORS 1. Pr alion ctRdng station so hit windwll bbw drat away from user 1. Cut only using scare and snap, or shears (mih nual, electric or pneumtic). and others i1 worldnnyy area. 2. Position cutting station In we i- n:Jated area 2 use Sure of the (dloxlr 0 meltoCs a Best: I. Sane and strap II. Shears QmrarR, eloclrc or pnarmatc) - NEVER use a WAer saw Indoors b. Bettor: L Dust redwing dreutr saw e(fNpod With a - NEVER use a Gavle saw blade that does oil carry the Hrrdie3ade saw blade trademark HaideOlade• saw bade and HEPA tfldnan extraction NEVER dry sweep — Use wet suppression or HEPA'Acuum G Good. L Dust molixi g cirakr saw with a Hardt lathe saw bade only tdr. for bm In tloderat" adtiug) ImportantNotf. fixmaodmr) rroMdion 40van retpiabfe dust .LM ttudle recommends afvraA IL lhg'Bmr4eelcutting methods where basible. N109N- epprmed resplrateis can be used In car*Wlon with above cutting practices to further reduce dust expostms. Adnlitlonal coposure Ird rmatian is available at ~. bmeshardle.can to help you delemtre the most appropriate a" method for lorrlob requirements. If concern still exists about exposure awals or pu do not wnpfy with III afwae p radim. tou Shatnlrl nMTp consult a quaYred mdurU4il hyglen(st or contact Janes Hardie for further information, GENERAL REQUIREMENTS: HardiePlank' lap siding can be installed over braced wood or steel studs spaced a maximum of 24" o.c. or directly to minimum 7/16" thick OSB sheathing. See general fastening requirernetlts. Irregularities in framing and sheathing can mirror through the finished application. Information on Installhtg James Hardie products over foam can be located In JH Tech Bulletin 19 at wvnv. lamehardle.com A water -resistive barrier is required In accordance with local building code requirements. The water-reslstive barrier must be appropriately installed with penetration and junction flashing in accordance with local building code requirements. James Hardie will assume no responsibility for water infiltration. James Hardie does manufacture HardieWrap` Weather Barrier, a non -woven non -perforated housewrap', which complies with building code requirements. When installing James Hardie products all clearance details in figs. 3-14 must be followed. Adjacent finished grade must slope away from the building in accordance with local building codes - typically a minimum of 6' in the first'l0'. Figure 1 Double Wall Single Wall Do not use HardiePlank lap siding In fascia or trim applications. Construction Construction Do riot install James Hardie products, such that they may remain In contact with standing water water esiswe banter w-In bracing HardiePlank lap sIding may be Installed on Flat vertical wall applications only, ppyw" a 24• o c.ma". For larger projects, including commercial and multi -family projects, where the span of the 03BsheatMng wall is significant In length, the designer and/or architect should take Into consideration the r z coefficient of thermal expansion and moisture movement of the product In tftelr design. Z These values can be found in the Technical Bulletin "Expansion Characteristics of James Hardie" Siding Products' at www.JaniesHardie.com. I I 00NOTusestain, oil/alkyd base pallet, or powder coating on James Handle® Products. A INSTALLATION: JOINTTREATMENT One or more of the following joint treatment opUonts are required by code (as rehererred 20091RC R703. 3.2) A. Joint Flashing (James Hardie recommended) ' B. Caulking' (Caulking Is not recommended _,yr for ColorPlus for aesthetic reasons as the am Caulking and ColorPlus will weather nt y differently. For the same reason, fmshkv ' do riot caulk nail heads on ColorPlus prddircts.) Ha C.' H" jointer cover Figure 2 Rat line (a nail line Is rot present place \ % ' ..:. Wiener \ betwem Y4" 8 I -from top ' 00 \ u• --— dmg \' : moo \ o a ,• fiSlaner d o 6 Instal a 1 1/4- Slane( strip to InSW plankS N ° o ordtro a artsWent plank angle moderate apnul at bus pots \ tCawd ap>trbpttttegap rotweenprattle and via, Unetn copal^' Note: Feld palming aver cau0dro may produce a sheen difference when compared to the field painted PdmePkus. 'Refer to Caulking sedan m these Instructions. For additional informalion on Hardiftap`Weather Basler, consult James Hardle at 1-866.411ardle or www.tiaralewrap.cnm WARNING: AVOID BREATHING SILICA DUST pones Hardie" products cenlaln tesphable cryelatine ellca, which is known to the State of Catfornb to cause Grrroer and Is considered try NIG and NOSI to be a cause of Greer from somo axupalloral sour. m. Breathing excessive amounts of respirable s@ce dust can also canoe a disaWng and potentially fatal lung dlsettee called s10cosb. and has been linked w th other diseases. Some studies atggesl sinokigmaylncransethese rdm During instlWinnorh,•rdling:0)wtukinathltwrareas Win arrynlpirmlitdian,(2)aserihammnlslntarslarrnnlbgor. r4wrenot feadhia,use aHenflelllMe'saw hgtb and dust-mdudng cicumr sms attached to a HEPA sewn; (3) warn alters In the iturox alearea; (4) wear a properly -fluted. NOSH-mlofined dust mask or aspirator (e.g. N-05) In aecordana with applicable governmontregublfansandin facturerinstr Wrstofwdnrlindlraspimbbdicaeap oswm Dunugci® n-up. use HEPAwacvutusorwet cleanup noMods-naverdry awbep. ForfuMorilornnatienjefor b our tataeatul iswctioro aP.d Material Satery Data goer amiable at www,(ameshardle.can or by aRrtg 1.80D-OHAnDIE (1-800.942-7343)• FALl1RE TO ADHEnE TO OUR WARNINGS. MSOS, AND INSTALLATION INSTFUCTIONS MAY LEAD TO SERIOUS PERSONAL IWURY OR DEATH. WAIM IIS11110-Pt/4 6/13 AMj 19 4 0 E CLEARANCE AND FLASHING REQUIREMENTS Figure 3 Figure 4 Figure 5 Figure 6 Roof to Wall Horizontal Flashing lOckout Flashing Slabs, Path, Steps to Siding Z-Flashing As T "codelyIR 11 411 X r 41' Min. V 4 Do not caulk in -I -2 Figure 7 Figure 8 Figure 9 Figure 10 Figure 11 Deck to Wall Ground to Siding Gutter to Siding Sheltered Areas Mortar/Masonry Figure 12 Drip Edge Y Z'flash14.-- ash In 5 MI 6. y Figure 13 Figure 14 Block Penetration Valley/Shingle Extension P A510 5 fro r - C FASTENER REQUIREMENTS " Blind Naling Is the preferred method of installation for HardiePlank* lop siding products. Face nailing should only be used where required by code for high wind areas and must not be used in conjunction with Blind nailing (Please see JH Tech bulletin 17 for exemption when doing a repair). Pin -backed corners may be done for aesthetic purposes Only. Pin -backs shall be done with finish nails only, and are not a substitute for blind or face nailing. BLIND NAILING Nails - Wood Framing Siding nap (0.09" shank x 0.221" HID x 2' long) 1 Iga. roofing nail (0.1 21'shank x 0.371'HD x 1.25' long) Screws - Steel Framing Ribbed Wafer -head or equivalent (No. 8 x 1 1/4" long x 0.375" HD) Screws must penetrate 3 threads Into inetal framing. Nails - Steel Framing ET & F Parielfast" nails or equivalent (0.10" shank x 0.313" HD x 1- 1/2" long) Nails must penetrate minimum 1/4' into metal framing. 0S8 minimum 7116" I Iga. roofing nail (0.121" shank x 0.371' HID x 1.75' long) Ribbed Wafer -head or equlvilent (No. 8 x 15/8' long x 0.375" HO). 0. c !4. -Xm, Figure 15 m _71 - FACE NAILING Nails - Wood Framing 6d (0. 113" shank x 0.967' HO x 2" long) Siding nail (0.09* shank x 0.221" HD x 2" long) Screws - Steel Framing Ribbod Bugle -head or equivalent (No. 8-18 x 1-9/8" long x 0.323' HID) Screws must penetrate 3 threads Into metal framing. Nails - Steel Framing ET & F pin or equivalent (0. 10' shank x 0.25" HD x 1-1/2" long) Nails must penetrate minimum 1/4" Into metal framing. OS8 minimum 7/1611 Siding nail (0.09* shank x 0.221" HD x 1-1/2" long)' Figure 16 24' — O.C. max. Minimum overlap 1/4'n for Both Face 1 overlap and Blind Nailing Nal Lhe TrL- BlInd Nafl 314% V min. 1 114" overlap l (ace net Water 11000va Fwater- cesladve 1114'( fth. I Baffle( - barrier Laminate sheet to be removed Immediately after installation of each course for ColorPlus* products. When face nailing to OSB, planks must he no greater than 9 1/4" wide and fasteners must be 12" o.c. or less. Also see General FasAenlng Rerfulrenientq: and when considering ahernative fastening options refer to James Hardie's Technical Bulletin USTB 17 - Fastening Tlps for Har(RePlane Lap.Sloing. HS1II194) 414 6/13 GENERAL FASTENING REQUIREMENTS Fasteners must be corrosion resistant, galvanized, or stainless steel. Electro-galvanized are acceptable but may exhibit premature corrosion. James Hardie recommends the use of quality, hot dipped galvanized nails. James Hardie is not responsible for the corrosion resistance of fasteners. Stainless steel fasteners are recommended when Installing James Hardiez products near the ocean, large bodies of water, or in very humid climates. Manufacturers of ACO and CA preservative -treated wood recommend spacer materials or other physical ban iors to prevent direct contact of ACO or CA preservative -treated wood and aluminum products. Fasteners used to attach HardleTrim Tabs to preservative -treated wood shall be of hot dipped zinc -coaled galvanized steel or stainless steel and in accordance to 2009 IRC R317.3 or 2009 IBC 2304.9.5. Consult applicable product evaluation or listing for correct fasteners type and placement to achieve specified design wind loads.. NOTE: Published wind loads may not be applicable to all areas where Local Building Codes have specific jurisdiction. Consult James Hardie Technical Services 9 your are unsure of applicable compliance documentation. Drive fasteners perpendicular to siding and framing. Fastener (leads should fit snug against siding (no air space). (fig. A) Do not over -drive roil heads or drive nails at an angle. If nail is countersunk, fill nail hole and add a roil. (fig. 8) For wood framing, under driven nails should be hit flush to the plank with a hammer (For steel framing, remove and replace nai0• NOTE: Whenever a structural member is present, HardlePlank should be fastened with even spacing to the structural member. The tables allowing direct to OSB or plyvmd should only be used when traditional framing b not available. Do not use aluminum fasteners, staples, or clipped head nails. y ro PNEUMATIC FASTENING James Hardie products can be hand nailed or fastened with a pneunatic tool. Pneumatic fastening Is highly recommended. Set air pressure so that the fastener is driven snug with the surface of the siding. A flush mount attachment on the pneumatic tool Is recommended. This will help control the depth the nail is driven. If setting the nail depth proves difficult, choose a setting that under drives the nail. (Drive under driven nails snug with a smoogt faced hammer - Doors not apply for installation to steel framing). countersunk, till &add nail snug flush ff,J DO NOT DO NOT FigureA I Figure B I under drive nails staple PAINTING 00 NOT use stain, oll/alkyd base paint, or powder coating on James Hardie° Products. James Hardie products must be painted within 180 days for printed product and 90 days for unprimed. 100% acrylic topcoats are recommended. Do riot paint when wet. For application rates refer to paint manufacturers specifications. Back -rolling is recommended if the siding is sprayed. CUT EDGE TREATMENT Caulk, paint or prime all field cut edges. James Hardie touch-up kits are required to touch-up ColorPlus products. CAULKING For lest results use an Elastomedc Joint Sealant complying with ASTM C920 Grade NS, Class 25 or -higher or a Latex Joint Sealant complying with ASTM C834. Caulking/Sealant must be applied in accordance with the caulking/sealant manufacturer's written Instructions. Note: OSI Quad as well as some other caulking manufacturers do not allow tooling. COLORPLUSO TECHNOLOGY CAULKING, TOUCH-UP & LAMINATE Care should he taken when handling and cutting James Hardie® ColorPlus® products. During installation use a wet soft cloth or soft brush to gently wipe off any residue or construction dust left on the product, then rinse with a garden hose. Touch up nicks, scrapes and nail heads using the ColorPlus, Technology lotuch-up applicator. Touch-up should he used sparingly. If large areas require touch-up, replace the damaged area with new HardePlank• lap siding with ColorPlus Technology. Laminate sheet must be removed immediately after installation of each course. Terminate non -factory cut edges into tdm where possible, and caulk. Color matched caulks are available from your ColorPlus, product dealer. Treat all other non -factory cut edges using the ColorPlus Technology edge coaters, available from your ColorPlus product dealer. Note: James Hardie does not warrant the usage of third party touch-up or paints toed as touch-up on .lames Hardie ColorPlus products. Problems with appearance or performance arising from use of third party touch-up paints or paints used as touch-up that are not James Hard6e touch -tip will not be covered under the James Hardie ColorPlus Limited Finish Warranty. PAINTING JAMES HARDIE" SIDING AND TRIM PRODUCTS WITH COLORPLUS11 TECHNOLOGY When repainting tblorPlus products, James Hardie recommends the following regarding surface preparation and topcoat application: Ensure the surface Is clean, dry, and free of any dust, dot, or mildew Repfiining Is normally not necessary 100% acrylic topcoats are recommended 00 NOT use stain, oiValkyd base paint, or powder coating on James Hard& Products. Apply finish coat fit accordance with paint manufacturers written instructions regarding coverage, application methods, and application temperature 00 NOT caulk nail heads when using ColorPlus products, refer to the ColorPlus touch-up section HS11119-P3r4 6113 COVERAGE CHART/ESTIMATING GUIDE Number of 12' planks, does not include waste COVERAGE AREA LESS OPENINGS HARDIEPLANV LAP SIDING WIDTH SQ 5114 61/4 7114 71f2 8 8114 9114 9112 12 p s0 = too sq (t.) exposure) 4 5 6 6114 6 314 7 8 8114 10 3/4 1 25 20 17 16 15 14 13 13 9 2 50 40 33 32 30 29 25 25 19 3 75 60 50 48 44 43 38 38 28 4 100 80 67 64 59 57 50 50 37 5 125 100 83 80 74 71 63 63 47 6 150 120 100 96 89 86 75 15 56 7 175 140 117 112 104 100 68 88 85 8 200 160 133 128 119 114 100 100 74 9 225 180 150 144 133 129 113 113 84 10 250 200 167 160 148 143 125 125 93 11 275 220 183 176 163 157 138 138 102 12 300 240 200 192 178 171 150 150 112 13 325 260 217 208 193 186 163 163 121 14 350 280 233 224 207 200 175 175 130 15 375 300 250 240 222 214 188 188 140 16 400 320 267 256 237 229 200 200 149 17 425 340 283 272 252 243 213 213 158 18 450 360 300 288 267 257 225 225 167 19 475 380 317 304 281 271 238 238 177 20 500 400 333 320 296 286 250 250 186 This coverage chart Is meant as a guide. Actual usage Is subject to variables such as building design. James Hardie does not assume fesporlsibUlty for over or under ordenng of product. IRECOGNITION: In ae ordance uA1h IC"S Ealualon Report ESR•2280, HatdlePmn * lap slang b recognized as a sultahle allemam to thal spedled irk the 20oG,2009 r.20121Mernatlanal Residential Code (a Ono - and Two-famly Deje fts. and the 2006, 2009. 8 2012 Inlemallond NWkg Code.. HardePlank tap tdd'ag is dso mcognhed for applatim (a the to": Cty or Los NWfes Research Report No. 24882, Slam of Florida hbg F10889, fade Cowry, Florida NOA No.02-0729 02, U.S. Dept. of HUD Mated* Release I Me, Teams Department of Insurance Product Evaluation EC.23. City of New Yak MEA 223.9341, and Cerdmia DSA PA-01 & These deamants should also be aoraulled (or awikanal Infona6en cmremoV the ailabi0y of Orris product for specificapplications. 02013 James Hardie Bulldog Products. Ali dghb reserved. TM, Shl and 9 denote trademarks or registered tademarks of James Hardie Tedmoke Umted.11 is a registered trademark of James Hardie Todmology Lkmted. Pand( asl is a rMisteted trademark of ET&F Fasmrarg Systems, inc. Additional Installation Information, Warranties, and Warnings are available at JamesHardie 1YIMN.JameSha(dIe.00m HSIMO1 P4/4 6N3 MIAMI•DADE MIAMI:-DADS COUNTY PRODUCT CONTROL SECTION 11805 SW 26 Street, Room 208 DEPARTMENT OF REGULATORY AND ECONOMIC RESOURCES (RER) Miami, Florida 33175-2474 BOARD AND CODE ADMINISTRATION DIVISION T (786) 315-2590 F (786) 315-2599 NOTICE OF ACCEPTANCE (NOM www.miamidade.eov/economy James Hardie Building Product, Irre. 10901 Elm- Avenue' Fontana, CA 92337 SCOPE: This NOA is'being issued under the applicable roles and regulations governing the use of construction materials. The documentation submitted has been reviewed and accepted by Miami -Dade County RER-Product Control Section to be used in Miami Dade County and other areas where allowed by the Authority Having Jurisdiction (AHJ). This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Section In Miami Dade County) and/or the AHJ (in areas other titan Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perform in the accepted manner, the manufacturer will incur the expense of such testing and the AHJ may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. RER reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Section that this product or material fails to meet the requirements of the applicable building code. This product is approved as described heroin, and has been designed to comply with the Florida Building Code, including the High Velocity Hurricane Zone. DESCRIPTION: "Hardie", "Cem" and "Prevail" Planks and Panels Fiber Cement Siding and Soffit APPROVAL DOCUMENT: Drawing No. PNL, PLK & SOFF, titled "HardiePanel, CemPanel, Prevail Panel; HardioPlank, CemPlank Prevail Lap Siding; HardieSoffit, CemSofftt Panel; Installation Details Wood/Metal Stud Construction", sheets 1 through 12 of l2, dated 04/24/2013, prepared by the manufacturer, signed and sealed by Ronald I.Ogawa, P.E., beating the Miami -Dade County Product Control revision stamp with the Notice of Acceptance number and expiration date by the Miami -Dade County Product Control Section. MISSILE IMPACT RATING: Large'Rud Small Missile Impact Resistant LABELING: A permanent label with the mamifacturer's name or logo, Plant City, Florida, and the following statements: "ASTM C 1186 Type A compliant" and "Miami -Dade County Product Control Approved" is to be located on each siding plank or panel and per FBC 1.710.9.2 and 1710.9.3 on soffit panels. RENEWAL of this NOA shall be considered after a renewal application has been ruled and there has been no change in the applicable building code negatively affecting the performance of this product. TERMINATION of this NOA will occur after the expiration date or if there has been a revision or change in thi materials, use, and/or manufacture of the product or process. Misuse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause for termination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed by the expiration date may be displayed in advertising literaturo. If any portion of the NOA is displayed, then it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall be provided -to the user by the manufacturer or its distributors and shall be available for inspection at the joh site at the request of the Building Official. This NOA revises NOA 013-0311.07 and consists of this page I and evidence page E-I, as well as approval document mentioned above. The submitted documentation was reviewed by Carlos M. Utrera, P.E. NOA No. 15-6122.04 M1AM1.1lA0ECOUNTY Expiration Date: May 1,2017 Approval Date: April 9, 2015 03 f301 1 S psg I James I•Iardie Building Products, Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED A. DRAWINGS "Submitted under NOA # 13-0311.07" I. Drawing No. PNL, PLK & SOFF, titled "HardiePanel, CemPanel, Prevail Panel; HardiePlank, CemPlank Prevail Lap Siding; HardieSoffit, CemSoffit Panel; Installation Details Wood/Metal Stud Construction", sheets I through 12 of 12, dated 04/24/2013, prepared by the manufacturer, signed and sealed by Ronald I. Ogawa, P.E. B. TESTS "Submitted under NOA # 13-0311.07" 1. Test reports on 1) Uniform Static Air Pressure Test, Loading per FBC TAS 202-94 2) Cyclic Wind Pressure Loading per FBC, TAS 203-94 along with marked -tip drawings and installation diagram of HardiePlank, HardieSoffit and HatdiePanel, prepared by Intertek Testing Services NA LTD, Test Report No. 100733361COQ-004, dated 08/24/2012, with revision l dated 04/25/2013, signed and sealed by Rick Curkeet, P.E. Submitted rotifer NOA # 02-0729.02" Laboratory Report Test Date Signature 2. ATI-16423-1 PA 202 & 203 03/18/96 A. N. Reeves P.E. 3.. ATI 16423-2 PA 202 & 203 03/18/96 A. N. Reeves P.E. 4. ATI 16423-3 PA 202 & 203 03/18/96 A. N. Reeves P.E. C. CALCULATIONS 1. None. D. QUALITY ASSURANCE 1. Miami -Dade Department of Regulatory and Economic Resources (RER) E. MATERIAL CERTIFICATIONS 1. None. F. STATEMENTS 1. Statement letter of code conformance to the 51" edition (2014). FBC issued by Ronald I. Ogawa & Associates, Inc., dated 10/26/2014, signed and sealed by Ronald I. Ogawa, P.E. O3/3olZo l5 Carlos M._ Uhrcra, P.E. Product Control Exaininer KOA No. 15-0122.04 Expiration Date: May I, 2017 Approval Date: April 9, 2015 1v - 1 WALL WALL LENGTF Saud Spacing at 1E' O.C. ate_ r I r BF= Nails at 16" O.C. (typ.) 3/8" Minimum Edge Distance PET&I[LA Stwat}yng fastener, as described in Note 1 Panel fastener, as described in Note 2 D6" ` s>! flair \ HardiePanel, Cempanel, Prevail Panel Siding r . er CaridL j Water -resistive barrier per Florida Building Code Section 14D42 ply APA rated she fastened in accordance with Florida Building Code Section 2322 3 2" X 4" S-P-F Wood Studs the wag and soffit frames are to be designed by the Architect or Engineer of Record in compliance with the Florida Building Code. SEE DETAIL A T" 518- sridc 15 ply APA meted ph -wood sheathing in acoodance with Florida StMog Code Section 23" Nlfat1!MeSiS&e barrier per Florida Bulding Code Sedron 1404.2 rx a-s-P-F Liwood studs HardiePanet, zEL(C-DQf B-B Cemnpanel. Prevail Panel Siding PRODUCT DESCRI_PT10N Hard-ePanel®, Cemnpane—W* & PrevariM Panel Sidmg materials are nonasbestos fiber -cement Products tested in accordance with ASTM C1186 Grade II, Type A and mating the requirements of the Florida Building Code. PA QIMENSIOfIS width length Thickness 4 8,9,10' 5116* D$lGi PRES_S_l1RERATING_ Installation Design Pressure Wood Impact Resistant - planks installed over W thick 15 PIy APA rated p"od sheathing LIgRDIEPANEL,CQVIPANEL, PREVAIL PANEL S1DiNG INSA4 -NDETAILS AU instialiation shall be done in conformance with this Notice of Acceptance, the manufacturer'sinstallationrecommendations, and the applicable sekdions of the Florida Building Code. Wood studs where HardmePanel, Cempanel, Prevail Panel Siding will be installed shall bedesignedbyanEngineerorArchitectPertheFloridaBuildingCodeandtherequirements of this KOANOW 1) 518" thick / 5 ply APA rated pywood sheathing shall be attached to the studs in accordance with Florida Budding Code S_•c5w 2322.3 APA rated plywood sheathing supPortec' The siding panels shall be installed over SIT thick 15 ply by a minimum of 2"X r S-P-F wood studs spaced a mna;d-num of 16. O.C. Notre 21 The siding panel fastener shall be a 2' long, 0.223- head diameter. 0.092" shankdiameter, corrosion resistant siding nail; the fasteners shall be spaced at 6" O.C. at panel edgesandintermediatestuds; the fasteners shaU be driver through fhe 5J8- thick 15 ply APA rated plywood sheaMing into wood studs located at 1S- O.GFastenersshallhaveaminimumedgedistanceof301 and a minimum clearance of 2" from comers. 1-IARDIEPANEL, CFMPANEL, PREVAIL PANEL INSTALLATION DETAILS WOOD STUD CONSTRUCTION Jaynes Hardie Building Products, Inc. 10901 Elm Avenue Fontana. CA 92337 No Mr. No - ( Rr v A I , PNL-PLKSOF'F Creator. E Gonzales SCALE 1r' = i*r I Date: 40242o13 ISHEET 1 OF 12 Fastener Spacing per Florida Building Code Section 2322.3 III 1. e ao yiag" ' the •i1+Aa 5 l trr 14odiat Gonad MO,DUCT>EVISM- as o,avvf;mg WA ac Fk ds BUDAW rto 1a-t lJ, 47 M7, f- f 17 I rca Clads-ing Framing I I • I SheathingFastenerSpa^ing per Florida Building Code Section 2322.3 I I•I to I -off : STA f l trRQNfING NOMINAL 2" X 4" S-P-F WOOD STUDS 1S' O.C. FASTENED WITH 3-12" 16d COMMON NAILS (2 PER TOP AND BOTTOM CONNECTION) THE WALLAND SOFFIT FRAMESARE TO BE DESIGNED BY THE ARCHITECT OR ENGINEER OF RECORD IN COMPLIANCE WITH THE FLORIDA BUILDING CODE 3HFAT•II,NG • NOMINAL 51W THICK / 5 PLY APA RATED PLYWOOD SHEATHING FASTENED IN ACCORDANCE WITH FLORIDA BUILDNG CODE SECTION 2322.3 THE PANEL IS FASTENED VAT H Y LONG, 0.2V HEAD DIAMETER, 0.092" SHANK DIAMETER, CORROSION RESISTANT SIDING NAILS, PLACE NAILS S" O.C. AT PANEL EDGES AND INTERMEDIATE STUDS FOR METAL AND WOOD STUDS, PROVISIONS FOR DIAPHRAGM ACTION AND GRAVITY LOAD ARE NOT PART OF THIS APPROVAL (MUST PROVIDE ALTERNATE PROVISIONS FOR THESE LOADS) HARDIEPANEL, CEMPANEL, PREVAIL PANEL INSTALLATION DETAILS WOOD STUD CONSTRUCTION tames Hardie Building Products, Ina 10901 Elm Avenue Fontana, CA 92337 Phone:903356-6300 Sam FSCYN0 MGNo Fax 909-427-0634 A PNL-PLK.SOFF Creator E. Gonzales 1s5 u 1" = r-0• Da*:42412013 4ZrT 2 OF 12 1 i I WALL . B ALL LENGTH Stud Spacing at 15' O.C. SEE DETAILA T 5V thick 15 ply APA rated fplywood sheathing fastened to metal studs as desa bed in Note 1 a4 Y httieFtarida `w virJ NO. i 3y+ '' -o ' . STATE Q I SF,C?JON& 3/8" Minimum Edge Distance Nails at 6" O.C. (typ.) Water4esative barrier per Florida Building Code Section 14042 209a, 3S/8" X l-&8' Metal Cstud HardiePanel, Cempanel, Prevail Panel Siding HardlePanele, Cempanelm, & PhavailO Panel Sing materials are nonasbestos fiber -moment products tested in accordance vrith ASTM C1186 Grade It, Type A and meeting the requirements of the Florida Budding Code. EMAIL DLMEN_S_IO_LJ_S. Width Length Thickness 4' 8,9,10' 5/16" QESIGbl-l!9 S_S_U_RE RAT_lNG Installation Design Pressure Metal Studs -104 psf Impact Resistant — Panel installed over 5V thlck / 5 ply APA rated plywood sheathing HAPD Epi41 E11CF,MPANELi,Ek _ LL PANFI SIOII G f1 SJJ L_L,E TIO_N_DETAILS AU instauation shalt be done in conformance with this Notice of Acceptance, the manufacturer's QE tl,lg installation recommendations, and the applicable sections of the Florida Building Code. Metal studs where HwdiePaneL Cempanel. Prevail Panel Siding will be installed shall be Sheathing fastener, as designed by an Engineer or Architect per -the Florida Building Code and the requirements of this desonbed in Note 1. Rom \ N.OA Note 11 5/8" thick / 5 ply APA rated plywood sheathing shall be attached to metal studs at 6"0c t1°"8 °•F at panel edges and all intermediate supports using a No.B-18, 0.315" head diameter x 1-1/4' longylCovePanelfastener, as described in bugle head screwgNote2Thesidingpanels shall be installed over 5/8" thiak / 5 ply APA rated plywood sheathingc I supported by a minimum 20ga, Nominal 35V X 1-518" Metal Cads spaced a maximum of 16"• Carr I O.C. Note 2] The siding panel fastener shall be a minimum No. 8-18, 0.315" head diameter X 1,WHardiePanelOSidinglong' ribbed bugle head screw ('or screw shall have at least 3 full threads penetrating metal framing); the fasteners shall be spaced at 6" O.C. at panel edges and intenned`ate studs; the k fasteners shall be driven through the 5/8" thick 15 ply APA rated plywood sheathing into metal VJater-resistive barrier per studs located at 16" O.C. Florida Building Code Section Fasteners shall have a minimum edge distance of 3/8" and a minimum clearance of 2" from 1404.2 comers. HARDIEPANEL, CEMPANEL, PREVAIL PANEL SW thick15 ply APA rated INSTALLATION DETAILS METAL STUD CONSTRUCTION plywood sheathing fastened James Hardie Building Products, Inc, to metal studs as described 10901 Elm Avenue in Note 1. Fontana, CA 92337 209a, 35/8" X 1%1 i8" Metal C-stud Phone: 909456-63M FSQU N° VAG "o REV The wall and soffit frames are to be designed Fax 909-427-0634 A PNL-PLK-SOFF m by the A c?fftct or Engineer of Record in compliance with the Florida Building Code. Creator. E. Gonzales SCALE' 1l2' =1r-0' Dare: 42arzo13 sn 3 OF 12 6.00h + - 1 I II I' I I II I 6 00in. a cmwbi ag ewatltFbasdn Peoeoct cneud L' FRAMING. NOMINAL 20 GAUGE 3-SI8" X 1-SJ8° STEEL STUDS 16" O.C. FASTENED tMTH SW WAFER HEAD SCREWS (2 PER TOP AND BOTTOM CONNECTION) THE WALL AND SOFFIT FRAMES ARE TO BE DESIGNED BY THE ARCHITECT OR ENGINEER OF RECORD IN COMPLIANCE WITH THE FLORIDA BUILDING CODE S_H E.A ini tJG_ NOMINAL 5/8" THICK 15 PLY APA RATED PLYWOODSHEATH114GTOMETALSTUDSAT6' OC AT PANEL EDGES AND ALL INTERMEDIATE SUPPORTS USING A NO.8-18, 0.315" HEAD DIAMETER X 1-114' LONG BUGLE HEAD -SCREW CLADDING THE PANEL IS FASTENED WITH No. 8-18, 0.315' HEAD DIAMETER 1-5/8' LONG CORROSION RESISTANT RIBBED BUGLE HEAD SCREWS (SCREW SHALL HAVE AT LEAST 3 FULL THREADS PENETRATING THE METAL FRAMING), PLACE SCREWS 6° O.C. AT PANEL EDGES AND INTERMEDIATE STUDS Cladding Framing II I- I Sheatfiing II ICI II II I I,I I.I 1 I I it OGA 121 I • STAMOF :4 I'l I I =• FLOFIOP.=. SI0NA\- FOR METAL AND WOOD STUDS, PROVISIONS FOR DIAPHRAGM ACTION AND GRAVITY LOAD ARENOTPARTOF7HSAPPROVAL (MUST PROVIDE ALTERNATE PROVISIONS FOR THESE LOADS) HARDIEPANEL, C£MPANEL, PREVAIL PANEL INSTAL ATION DETAILS METAL STUD CONSTRUCTION James Hardie Building Products. Inc' IM Elm Avenue 0 Fontana, CA 92337 Phone: 909.356s300 Stm FSCM NO anQ No PNL-PLK-SOFF Fax 909-427-0634 A Creator. E Gonzales 4&412013 4 OF 12 scue 1•=1'-0° D s"` 1 T i WALL HEIGHT L. LENGT Stud Spacing at 16" O.C. 1 I . i i t li as 1 ; I i I rrSissp ace A nR Caotrd H. t 1 ~ =cry `--:.;•F-• .-' =- - SSIO 3/4"Minimum Edge Distance Nails at 16 O.C. (typ.) D -Sheathing fastener, as described in Note 1 Siding fastener, as described in Note 2 wide Florida S HardiePlanK CemplanK Prevail u Lap Siding La n Gsrid I Water -resistive barrier per Florida Building J Code Section 1404.2 li 5/8" thick / 5 ply APA rated plywood sheathing fastened in accordance with Florida Building Code Section 2322.3 2" X 4" S-P-F Wood Studs The wall and soffit frames are to be designed by the Architect or Engineer of Record in oomoGancewith the Florida Building Code. SEE DETAIL A PRODUCT DESCRIi'—ON HardiePlank®, Cemplanksl, & Prevail& Plank lap Siding materials 5/g" thick / 5 ply APA are nonasbestos fiber -cementproductstestedinaccordance withratedplywoodASTMC1186Gradeit, Type A and st>eathing m accordance meeting the requirements of thevAthFloridaBuildingCode. Florida Bu0eng Code Section2327-3 PAkr=LPjM NS_ONS Water Width Length Thickness barrier per Florida 59-1/Y 12' 5/16' Building Cade Section 14042 DEIGN PI_ESSURE_R_ATI, *- 2-X 4-S-P-F Ir -Wation Design Pressure Wood Strada Wood Studs -92 psf Lap Siding Impact Reslstant- Planks installed over 5/8" thick / 5 ply 1-1/4'taB X 5/16" APA rated plywood sheathing thick starter strip H2D!)ZP_LAIJC}illil lA IKLP EYA_.4LAe_S.IDl S.+A-T-L2N DfAfL S AD installation shaD bs done in corrionnance with this Notice of Acceptance, the manutacturer+s installation raiteclpe mendations, and the applicable sections of the Florida Building CodeWoodstudsreHardiePlank, Cemp'ank, Prevail Lap Siding will be installed shall be designed by an Engineer or r thenFlorida Buik1•ing Code and the requiremerrts of this N.OA M 13 5/8' / 5 ply APA rated plywood sheathing shall be attached to the studs in accordance with Florida Building Code Section 2322.3- Planks shall be applied horizontally commencing from the bottom course of the wall with 1-1/4 widelapsatthetopoftheplanksuchthattheexposureareaofeachplankiss8-1W vertically. Note 21 The siding fastener shall be a 2-1/Y long, 0.223" head diameter, 0.092" shank diameter, corrosion -resistant siding nail; The skiing is fastened S &1/4" O.C. vertically and 1O.C.o izon Y. fasteners are driven into wood studs through 518 thick 15 ply APA rated plywoodsheathing, are placed in the overlapping area approximately 3/4' from the bottom edge of the overtapping plank Vertical joints shad be placed over studs. The planks shall be installed over SW thick 15 ply APA rated plywood sheathing supported by aminimumof2"X4" S-P-F wood studs spaced a maximum of 16" O.C. Fasteners shall have a minimum edge distance of 3/8". HARDIEPLANK, CEMPLANK, PREVAIL LAP SIDING INSTALLATION DETAILS WOOD STUD CONSTRUCTION James Hardie Building Products. me 10901 Elm Avenue Fontana, CA 92337 M1 A I I PNL-PLK-SOFF Creator. E Gonzales sc 1/2" = t'-0" Date: 4/24/2013 , sr1eR 5 OF 12 Fas:ene. Spacing per Florida Building Code Section 2322.3 0.75n s'd25in. 16 in. OC-• . Cladding Framing IFastener Spacing per Florida Sheathing Building Code Section 23223 I • I I / as wmpl ig.i&.dwnwas Bm7ev fob E ,Nc NOMINAL 2" X 4" S•P-F WOOD STUDS IV O.C. FASTENED WITH 3-1/2' 16d COMMON NAILS (2 PER TOP AND BOTTOM CONNECTION) THE WALL AND SOFFIT FRAMES ARE TO BE DESIGNED BY THE ARCHITECT OR ENGINEER OF RECORD )N COMPLIANCE WITH THE FLORIDA BUILDING CODE SHE,4TH1N NOMINAL SW THICK / 5 PLY APA RATED PLYWOOD SHEATHING'FASTENED IN ACCORDANCE WITH FLORIDA BUILDING CODE SECTION 2322.3 C_LAMINQ PLANKS.OVERLAP 1-1/4" THE D(POSURE IS s8.1/4" THE PLANKS ARE FACE NAILED WITH 2-1/r LONG, O?=' HEAD DIAMETER, 0.092" SHANK DIAMETER, CORROSION RESISTANT SIDING NAILS, -PLACED 3/4" UP FROM THE BOTTOM EDGE OF THE PLANK AT EACH STUD LOCAT10IN de media. j • II iNo. 21 Z STATE OF 4NAL ,, FOR METAL AND WOOD STUDS, PROVISIONS FOR DIAPHRAGM ACTION ND LOAD ARE NOT PART OF THIS APPROVAL (MUST PROVIDE ALTERNATE PROVISIONS FOR THESE LOADS) HARDIEPLANK, CEMPLANK, PREVAIL LAP SIDING INSTALLATION DETAILS WOOD STUD CONSTRUCTION James Hardie Building Products, InG 10901 Elm Avenue e _ Fontana, CA 92337 Phone: 909-356.6300 sm Fsr44 N° DV s NO Fax 909-427-0634 A I PNL-PLK-SOFFT Creator. E Gonzales SCAIS 1' =1'-0" Dale: 4/242013 SHM 6 OF 12 I VlLLL LENG SEE P_'ODUC? DESCR1PTiOh Stud Spacing at 15' O,C. JD E TA:JLA HardiePlankO, Cemplank®, and 5/9"Jtick/5 Al APAPrevail® Plank Lap Siding materials Y_ _--- ---__ T ____._ ._ _ . __—___.rl.._ _.— r rated plywood are nonasbestos fiber -cement products tested in accordance withfigfastenedASTMC1186GradeII, Type A and V*astudsto asnlewdescribedinNote 1 meeting the requirements of the Florida Building Code. AJ'1;02 W ALL I bartier per da PLA K OL1 ENSLONS HEIGHT i e i i i D j{ i F- 2 Building Code Width Length Thickness l I i t.i t I i Section 14042 5 9-1/2' 12' 5/161• i Y i4odaetCoems! s! 20ga, 3-5WX 1-5J8" DESIGN P SU E RATING I Metal Cad i Installation Design PressureF ` iiardiePlank Metal Studs -92 psf B E--- cemplanK Prevail sS/4NAL - G , C Q tap Siding Impact Resistant - 3/4" Minimum Edge Distance Nails at 16" O.C. (typ•) ''. g g 1-1v4• to X 5n6• Planks installed over 5/8"thick / 5 ply thick starter strip APA rated plywood sheathing AIL @ HARDIEPLANI CEMPLANK PRi11/}11L Lls`P $101NG_WS_TAu kT.QiJ DETAIItS All installation shall be done in conformance with this Notice of Acceptance, the manufacturer's installation Sheathing fastener, as recommendations, and the applicable sections of the Florida Building Code. described in Note 1 Metal studs where HardiePlank, Cemplank, Prevail Lap Siding will be installed shall be designed by an PRQtX)Cr R NUM Engineer or Architect per the Florida Building Code and the requirements of this N,OA gboq#1*8 Wilh AW PWift Note 1] 5/8" thick 15 ply APA rated plywood sheathing shall be attached to metal studs at 6•oc at panel Ao eyt S• Siding fastener, as edges and all intermediate supports using a No.8-18, 0.315• head drameterx 1-1/4' long bugle head screw Planks shall be applied horizontally commencing from the bottom Course of the wall with 1-1W wide laps att \ described in Note 2 the top of the plank such that the exposure area of each plank is:5 8-114" vertically. sly ICoo+ INote 23 The siding fastener shall be a minimum No. 8-18, 0.315" head diameter X 24W long+ bugle head least full metal framing); The siding isirf>ai , screw over metal studs (•or screw shall have at 3 threads penetrating HardiePlank, fastened s 8-1/4" O.C. vertically and 16. O.C. horizontally, fasteners are driven into metal studs through M" Cemplank, thick 16 ply APA rated plywood sheathing, fasteners are placed in the overlapping area approximately 3/4" Prevail Lap Siding from the bottom edge of the overlapping plank, a Vertical joints shall be placed over studs. The planks shall be installed over SO thick / 5 ply APA rated plywood sheathing supported by a minimumWater4tsistive' 20ga CNominal3-SW X 1-5a' Metal 4tids spaced a maximum of 16" O.C. harrier per Florida Fasteners shall have a minimum edge distance of 318 . Building Code Section 1404.2 HARDIEPLANI(, CEMPLANlt;, PREVAIL LAP SIDING 5B" thick! 5 ply APA rated INSTALLATION DETAILS METAL STUD CONSTRUCTION plywood sheathing fastened to James Hardie Building Products, Inc, metal studs as described in ' 10901 Om Avenue Note 1 Fontana, CA 92337 20ga, 3-5W X 1-SW Metal 0-stud Phone: 909,356-6300 No o'"O NO ReV The wall and soffit frames are to be designed Fax 909-427-OS34 A PNL-PLK-SOFF 1 by the Architect or Engineer of Record in compliance with the Florida Balding Code. Creator. E. Gonzales SCALE 12" =1W Date: 4242013 SHEEr 7 OF 12 maomplyiwSw& ef1crime soubec°°` t i311.07wacge Nu n Prot NOMINAL 20 GAUGE 3-5/8" X 1-W' STEEL STUDS 18 O.C. FASTENED WITH SW LONG RIBBED BUGLE HEAD SCREWS (2 PER TOP AND BOTTOM CONNECTION) THE WALL AND SOFFIT FRAMES ARE TO BE DESIGNED BY THE ARCHITECT OR ENGINEER OF RECORD IN COMPLIANCE WITH THE FLORIDA BUILDING CODE S-- NOMINAL SWTHICK 15 PLY APA RATED PLYWOOD SHEATHING TO METAL STUDS AT 8" OC AT -PANEL EDGES AND ALL INTERMEDIATE SUPPORTS USING A NO.6-18, 0.315' HEAD DIAMETER X 1-1W LONG BUGLE HEAD SCREW CLADQINIG- PLANKS OVERLAP 1-19! THE EXPOSURE IS 58-1W THE PLANKS ARE FASTENED WITH NO. 648, 0.315` HEAD DIAMETER X 2-1/4• LONG CORROSION- RESIS-iANT RIBBED BUGLE HEAD SCREWS (SCREW SHALL HAVE AT LEAST 3 FULL THREADS PENETRATING THE METAL FRAMING), PLACED 3/4" UP FROM THE BOTTOM EDGE OF THE PLANK AT EACH STUD LOCATION in. OC-1 / Cladding I' Framing II I I 6 OOin OC I• I I Sheathing I I fidbAt>k 121 a -o- TATE OF Oc. ORIOP=``.` i s. Oh'A E t' FOR METAL AND WOOD STUDS, PROVISIONS FOR DIAPHRAGM ACTION AND GRAVITY LOAD ARE NOT PART OF THIS APPROVAL (MUST PROVIDE ALTERNATE PROVISIONS FOR THESE LOADS) HARDIEPLANK, CEMPLANK, PREVAIL LAP SIDING INSTALLATION DETAILS METAL STUD CONSTRUCTION James Hardie Building Products,.lna 10901 Elm Avenue Fontana, CA 92337 Fax 909-427-0634 1 n I PNL-PLK-SOFF I 1 Creator. E. Gonzales IstLE 1- = 11-0• Date 424n013 s+eET a OF 12 WALL i RUAJL A 1 i WALL LENGTH Stud Spacing at 1S" O.C. e -- 1 1 , SEE DETAIL A 2" X 4" S-P-F wood Studs HardieSof iit, Ael Cemsofft E&O_-LLQLDESCR(aLC N HardieSofTitS & Cemsoffit® materials are nonasbestos fiber -cement products tested in accordance with ASTM C1186 Grade 11, Type A and meeting the requirements of the Florida Building Code. OF_F_CT_DtMENSIONS Width Length Thickness 4' 8' 1/4" AYSIGN P1ZkSSUI;Ej2A--UMA Installation Design Pressure Wood Studs 70 psf i _.I AEcJJQN e PRODUCT REVI= Nails at4"O.C.(typ.ap REVIS D-,mepie. 3/8" Minimum Edge Distance as om#yke **h ro Fin;& Eug • Codt as"" CO& ggo av, rbt3! 1vt °` gr Product c Soffrt•fastener, as described in Note 1 HardieSoffit, Cemsoffit Minimum 2" X 4" S-P-F Wood Studs The wall and soffit frames are to be designed by the Archftect or Engineer of Record In compliance with the Florida Building Code. t i,.0,"If ,- M6RDIEs-OEM.BEM.S_o_EF M-19.F,L-(!LSTALLA- jPN DE --TA- "i. AD installation shall be done in oonformance with this Notice of Acceptance, the manufacturers installation recommendations, and the appricable sections of the Florida Building Code. Wood studs where HardieSoffit, Cemsoffd will be installed shall be designed by an Engineer or Architect per the Florida Building Code and the requirements of th's N.OA The soffit shall be installed over minimum ZX4" S-P-F wood studs spaced a maximum of 1V O.C. Note 11 The soffit fastener shall be a 2' long, 0.223" head diameter, 0.097 shank diameter, corrosion resistant siding nail the fasteners shall be spaced at 4" O.C. at panel edges and intermediate studs; the fasteners shall be driven into wood studs located at 16" O.C. Fasteners shall have a minimum edge distance of 3/8" and a minimum clearance of 2" from comers. HARDIESOFFIT, CEMSOFFIT PANEL INSTALLATION DETAILS WOOD STUD CONSTRUCTION James Hardie Building Products, Ina 10901 Elm Avenue Fontana, CA 92337 o%G NO PNL-PLK-SOFF Creator E.Gonzales Iscus 1R"=t:0• I Date:4aV2M IsH=rT 9OF12 a.00 n+ 6.vvin Cladding Framing, 4 1-1.1 All ta fry Bi+•liam i)aee?ioPoesCoeroi STATE OF SS/ONA\- r F MLCt NOMINAL Z X 4" S-P-F WOOD STUDS 16" O.C. FASTENED WITH 3.12' 16d COMMON NAILS (2 PER TOP AND BOTTOM FOR METALAND WOOD STUDS, PROVISIONS FOR DIAPHRAGM ACTION AND GRAVITY LOAD ARE CONNECTION) ' NOT PART OF THIS APPROVAL (MUST PROVIDE ALTERNATE PROVISIONS FOR THESE LOADS) THE WALL AND SOFFIT FRAMES ARE TO BE DESIGNED BY THE ARCHITECT OR ENGINEER OF RECORD IN COMPLIANCE WITH THE FLORIDA BUILDING CODE CLADDING THE SOFFIT IS FASTENED WITH 2- LONG, 022T HEAD HARDIESOFFIT, CEMSOFFIT PANEL DIAMETER 0.092" SHANK DIAMETER, CORROSION INSTALLATION DETAILS WOOD STUD CONSTRUCTION RESISTANT SIDING NAILS, PLACE NAILS 4" O.C. AT PANEL EDGES AND INTERMEDIATE— STUDS James Hardie Building Products, Ina 10901 Elm Avenue o Fontana, CA 92337. Phone:909-356-MO SIZE FSCM NO DWSNO R Fax 909-427-0634 A PNL-PLK-SOFF Creator. E. Gonz?Jes SLUE V =1'-0" Date: 41242013 s r 10 OF 12 WALL LENGT'ri I SEE PP-10AUfr-T-DESCRtULQIJ Stud Spading at 16" O.C. HardieSoffit® & CemsoffiS materials DETAIL A are nonasbestos fiber -cement products tested in accordance vhth ASTM C1186 r-- r-=-=----:-- i --- --- - ; 1 Grade 11, Type A and meeting the J2019pa, rements of the Florida Building 3- 5l8" X 1-5/8" SO-FF-LT_DLM9 NSL0W WALL i i i j j Metal C-sa,d Width Length Thickness fEIGHT' j `! j I'I 8' YV s• j ! HardieSoffit, CDESIGN Pg.ESSUR RAT[NG emsofft Installation Design Pressure Metal Studs '` Um i JzGAC- 111 PRODUCT REviSED Mails at V. O.C. (tyP•) PRa'DER't REV", as a•aplyisw wilb tbrtlatiQr+ 31W Minimum Edge Distance I fastener, as ribed in Note 1 HardieSoffit, Cemsoffit E 1 20ga, 35/ 8" 4 1-51W Metal C-stud LThe wall and soffit frames are to be designed by the Architect or Engineer of Record in compliance with the Florida Building Code. 0 t! clloni a N1 13' a? 1.41 U. 721 wompae twe! - d gyp: S- FATEOF comer+ F1 c4. roa L_4Rp[ F,SO_FFQCE.MSOF LT_P_AN[EINS LLATIONj,D_TgQS -NAL E`1 r rr i All installation shall be done in conformance with this Notice ofAcceptai: , i , Shulad uees instatiation recommendations, and the applicable sections of the Florida Building Code. Metal studs where HardieSoffit, Cemsoffit will be installed shall be designed by an Engineer or Architect per the Florida Building Code and the requirements of this N.O k The soffit shall be installed over minimum 20ga, Nominal 3-5/8" X 1-51T Metal C-studs spaced a maximum of 1ti O.C. INot 11 The soffit fastener shall be a minimum No. 8-18, 0.315" head diameter X 1-1/4' long" ribbed bugle head strew (*or screw shall have at least 3 full threads penetrating metal framing) -,the fasteners shall be spaced at 6" O.C. at panel edges and internediaee studs; the fasteners shall be driven into metal studs located at 1W O.C. Fasteners stroll have a minimum edge distance of 3/8" and a minimum clearance of 2" from corners. mpHARDIESOFFIT, CEMSOFFIT PANEL INSTALLATION DETAILS METALSMI) CONSTRUCTION James Hardie Building Products, In 10901 Om Avenue Fontana, CA 92337 Phone: 909. 356.6300 SIZE FSur No W4 No RN Fax 909427- 0834 A PNL-PL KSOFF 1- Creator E.- Gonzales. eau: 1!2' = 1-0" Date: 4/24/2013 11 OF 12 Cladding Framing 10-in. I REVK7 ri111beFbliis PRODl Cigk 7lsED . 6 dfrlR s i - 7 w NO A9' FLOR P'-C? sSIONA FRAM G iiiiiii//// NOMINAL 20 GAUGE 3•5/8" X 1-5V STEEL STUDS 16" O,C. i FASTENED WITH&r WAFER HEAD SCREWS (2 PER TOP FOR METAL AND WOOD STUDS, PROVISIONS FOR DIAPHRAGM ACTION AND GRAVITY LOAD ARE AND BOTTOM CONNECTION) . NOT PART OF THIS APPROVAL (MUST PROVIDE ALTERNATE PROVISIONS FOR THESE LOADS) THE WALL AND SOFFIT FRAMES ARE TO BE DESIGNED BY THE ARCHITECT OR ENGINEER OF RECORD IN COMPLIANCE WITH THE FLORIDA BUILDING CODE CUJ DQ1NG_ HARDIESOFFIT, CEMSOFFIT PANEL THE SOFFIT IS FASTENED WITH NO. 8-18, 0.315" HEAD INSTALLATION DETAILS METAL STUD CONSTRUCTION DIAMETER X 1-1/4 • LONG CORROSION RESISTANTRIBBED BUGLE HEAD SCREWS (SCREW SHALL HAVE AT LEAST 3 James Hartle Building Products, Ina FULL THREADS PENETRATING THE METAL FRAMING), PLACE 10901 Elm Avenue SCREWS W O.C. AT PANEL EDGES AND INTERMEDIATE - p - STUDS Fontana, CA92337 Phone: 909-356-6300 F=M NO °Na No Fax 909-427-0634 A PNL-PLK-SOFF 1 Creator. I-GonzalesSCAL 1"=1,-V Date. 4/24=13 w1m 12 OF 12 Florida Building Code Online Page i of 2 lit Business & Professional Regulation r f101 DpMT*M4 BUS Nome I top to i user Registration I Hot Topics i Submit Surcharge I Stats a Facts I Publications I FaC scan i SCrs Site Map 1 Links I Search Busines ProductsProfessiRaiRegulation Product Approval Menu > Product or Aopllutlen Search > Aoolkadon List > Application Detail FL ## FL19715 Application Type New Code Version 2014 Application Status Applied For Comments Archlved Product Manufacturer Address/ Phone/Emall 1 Authorized Signature Technical Representative Address/ Phone/Email Quality Assurance Representative Address/ Phone/Email Category Subcategory Compliance Method Certification Agency Validated By Referenced Standard and Year (of Standard) Equivalence of Product Standards Certified By Product Approval Method Date Submitted Date Validated Silverline Building Products Corp. One Silverline Drive North Brunswick, NJ 08902 800) 234-4228 Ext 4644 Jonberrian® slbp.com Jon Berrlan Jonberrian@slbp. com Windows Single Hung Certification Mark or Usting Window and Door Manufacturers Association Window and Door Manufacturers Association Standard AAMA/ WDMA/CSA 101/1.S.2/A440 AAMA/ WDMA/CSA 101/i.S.2/A440 Method 1 Option A 02/ 16/2016 FL * I Model, Number or Name I Description Year 2011 2008 http:// www.floridabuilding.org/pr/pr app_dtl.aspx?parani=wGEVXQwtDgtvA%2bxmzkl... 2/19/2016 Florida Building Code Online Page 2 of 2 19715.1 1 Series 2900/4900 Limits of use Approved for use in HVH2: No Approved for use outside HVH2: Yes Impact Resistant: No Design Pressure: N/A Other: See Installation Instructions, SWD002, and Product Evaluation Report, PER3947, for design pressures and Installation requirements. Extruded Vinyl Single Hung Window Certification Agency Certificate FL19715 RO C CAC 2-4-16 CCL-_Ist.odf Quality Assurance Contract Expiration Date 12/16/2016 Installation Instructions FL19715 RO Il SWD002 SS 2016.02-03.odf Verified By: Hermes F. Norero, P.E. Florida P.E. 73778 Created by Independent Third Party: Yes Evaluation Reports FL19715 RO AE PER3947 SS 2016-02-12.odf Created by Independent Third Party: Yes Contact Us :: 1940 North Monroe Street Tallahassee FL 32399 Phone: 850-487,1824 The State of Florida Is an AA/EEO employer. CatmlaM 2007-2013 State of Florida.:: Privacy Statement :: Accessibility Statement :: Refund statement Under Florida taw, emell addresses are public records. If you do not want your e-mail address released In response to a pub8o4tmords request do not send electronic mall to this entity. Instead, contact the o81ce by phone or by traditional mail. If you have any quasdons, please contact 850.487.1395. 'Pursuant to Section 4S5.275(1), Florida Statutes, a ftective October 1, 2012, Ibex licensed under Chapter 455, F.S. mutt provide ft Department with an erraa address If they have one. The entails provided may be used for official communication with the peensee. However anall addresses are public record. tf you do not wish to supply a personal address, please provide One Department with an email address which can be made available to the public To determine If you are a licensee under Chapter 45S, F.s., please dick Qom. Product Approval Accepts: M Cr e t,r. IA --. SAFE http://www.floridabuildinL7.org i) r app_dtl.aspx?param=wGEVXQwtDgtvA%2bxmzkl... 2/19/2016 XNSTALLATXON NOTES: 1. ONE (1) INSTALLATION ANCHOR G REQUIRED AT EACH ANCHOR LOCATION SHOWN. Z. THE NUMBER OF INSTALLATION ANCHORS DEPICTED IS THE MINIMUM NUMBER OF ANCHORS TO BE USED FOR PRODUCT INSTALLATION OF THE MAXIMUM SISE LISTED. 3. INSTALL INDIVIDUAL INSTALLATION ANCHORS WITHIN A TOLERANCE OF tul INCH THE DEPICTED LOCATION 6 SPACING IN THE ANCHOR LAYOUT DETAILS LE, Wm IOUr CONSIDERATION OF TOLERANCES). TOLERANCES ARE NOT CUMULATIVE FROM ONE INSTALLATION ANCHOR TO T14E NEXT. 4. SHIM AS REQUIRED AT EACH INSTALLATION ANCHOR WITH LOAD BEARING SHIMS. MAXIMUM ALLOWABLE SHIM STACK TO BE 3A INCH. SHIM WHERE SPACE OF U16 INCH OR GREATER OCCURS. SHIMS) SHALLBE CONSTRUCTED OF HIGH DENSITY PLASTIC OR BETTER. S. FIN INSTALLATION: FOR INSTALLATION INTO WOOD FRAMING USE RB WOOD SCREWS OR 11 GAUGE ROOFING NAILS OR 10d COMMON NAILS OF SUFFICIENT LENGTH TO ACHIEVE I-V2 INCH MINIMUM EMBEDMENT INTO WOOD SUBSTRATE INSTALLATION SHALL MAINTAIN MIN. 3/B' EDGE DISTANCE. L FIN INSTALLATION: FOR INSTALLATION INTO METAL STUD USE BR SEIFTgPPING'CR OF $UFHCENT IENZ TO ACHIEVE A MINIMUM OF 3 fH1Ei6ENEr N BEYOND METAL WALL INSTALLATION SHALL MAINTAIN MIN. 3/B' EDGE OLSTANCL 7. THROUGH FRAME INSTALLATION: FOR INSTALLATION INTO WOOD FRAMING USE910 WOOD SCREWS OF SUFFICIENT LENGTH TO ACHIEVE 1-I/21NCH MINIMUM MBEOMENT INTO WOOD SULsmATE. L THROUGH FRAME INSTALLATION: FOR INSTALLATION THROUGH LX BUCK TO CONCRELE/MASONRY, OR DIRECTLY INTO CONCRETE/MASONRY, USE 3/16INCH DIAMETER ITW TA CONS OF SUFFICIENT LENGTH TO ACHIEVE 1.1/4 INCH MINIMUM EMBEDMENT. INSTALLATION STALL MAINTAIN MIN. 1 3/4' EDGE DISTANCE. 9. THROUGH FRAME INSTALLATION: FOR INSTALLATION INTO METAL STUD USE RIO SELFTAPPING SCREENS OF SUFFICIENT LENGTH TO ACHIEVE A MINIMUM F N ON BEYOND METAL WALL 10. MINIMUM EMBEDMENTAND EDGE DISTANCE EXCLUDE WALL FINISHES, INCLUDING BUT NOT LIMITED TO STUCCO, FOAM, BRICK VENEEIL AND SIDING. 11. INSTALLATION ANCHORS AND ASSOCIATED HARDWARE MUST BE MADE OF CORROSION RESISTANT MATERIAL OR HAVE A CORROSION RESISTANT COATING. SILVER LINE BUILDING PRODUCTS SERIES 290014900 EXTRUDED VINYL SINGLE HUNG WINDOW NON -IMPACT) GENERAL NOTES: L THE PRODUCT SHOWN HEREIN IS DESIGNED AND MANUFACTURED TO COMPLY WITH THE STH EDITION 20141 FLORIDA BUILDING CODE (FBCL EXCLUDING HVHZ AND HAS BEEN EVALUATED ACCORDING TO THE FOLLOWING: AAMA/WDM1A/CSA 101/IS2/A44048/11 2. ADEQUACY OF THE EXISTING STRUCTURAL CONCRETE/MASONRY, DK FRAMING, AND METAL FRAMING AS A MAIN WIND FORCE RESISTING SYSTEM CAPABLE OF WITHSTANDING AND TRANSFERRING APPLIED PRODUCT LOADS TO THE FOUNDATION IS THE RESPONSIBILITY OF THE ENGINEER OR ARCHITECT OF RECORD FOR THE PROJECT OF INSTALLATION. 3. IX AND ZX BUCKS (WHEN USED) SHALL BE OESIGNEO AND ANCHORED AS SPECIFIED HEREIN. REFER TO SHEET 6 FOR FURTHER DETAILS OF BUCK INSTALLATION. A. THE INSTALLATION DETAILS DESCRIBED HEREIN ARE GENERIC AND MAY NOT REFLECT ACTUAL CONDmONS FOR ASPECFICSITE IF SITE CONDITIONS CAUSE INSTALLATION TO DEVIATE FROM THE REQUIREMENTS DETAILED HEREIN, A LICENSED ENGINEER OR ARCHITECT SMALL PREPARE SITE SPECIFIC OOCUMENTS FOR USE WITH THIS DOCUMENT IN NON-MVHZ AREAS. IN HVHR AREAS, ONE TIME PRODUCT APPROVAL TO BE OBTAINED FROM MONO-0ADE RER OR ANI. S. APPROVED IMPACT PROTECTIVE SYSTEM IS REQUIRED ON THIS PRODUCT IN AREAS REQUIRING IMPACT RESISTANCE L WINDOW FRAME MATERIAL PVC 12. FOR HOLLOW B1OCC AND GROUT RUED BLOC(, DO NOT INSTALL 7, IN ACCORDANCE WITH THE STH EDITION FBC, WOODINSTALLATIONANCHORSINTOMORTARIOINTS. EDGE DISTANCE B MEASURED COMPONENTS SWELL HAVE BEEN PRESERVATIVE TREATEDFROMFREEEDGEOFBLOCKOREDGEOFMORTARJOINTINTOFACESHELLOFORSMALLBEOFADURABLESPECIESASDEFINEDINBLOCK CHAPTER 23. L3. INSTALLATION ANCHORS SHALL BE INSTALLED IN ACCORDANCE WITH ANCHOR L GLASS MEETS THE REQUIREMENTS OF ASTM E 1300MANUFACTURER'S INSTALLATION INSTRUCTIONS, AND ANCHORS SHALL NOT BE GLASS CHARTS. SEE SHEET 6 FOR GLAZING OETARS, USED IN SUBSTRATES WITH STRENGTHS HISS THAN THE MINIMUM STRENGTH SPECIFIED BY THE ANCHOR MANUFACTURER 14. INSTALLATION ANCHOR CAPACITIES FOR PRODUCTS HEREIN ARE CASED ON SUBSTRATE MATERIALS WITH THE FOLLOWING PROPERTIES; A. WOOD -MINIMUM SPECIFIC GRAVITY OFO.SS. L CONCRETE -MINIMUM COMPRESSIVE STRENGTH OF 3OW PSI. C. GROUT-FRLEO CMU- UNIT STRENGTH CONFORMS TO ASTM C90 WITH MINIMUM COMPRESSIVE STRENGTH OF 20M PSI AND GROUT CONFORMS TO ASTM C 476, MINIMUM GROUT COMPRESSIVE STRENGTH OF 2000 PSI. 0. HOLLOW BLOCK CMU -UNIT STRENGTH CONFORMS TO ASTM C90 WITH MINIMUM COMPRESSIVE STRENGTH OF 200o PSI. L STEEL -MINIMUM YIELD STRENGTH OF 33 KSL MINIMUM WALL THICKNESS OF 474 MIL (0.0476' or LS GAUGE). MIN. I/2• EDGE DISTANCE. F. ALUMINUM- MINIMUM ALLOY 6063-TS. MINIMUM WALL THICKNESS OF 1/16•. MIN. In- EDGE OISrma. TABLE OF CONTENTS SHEET REVISION SHEET DESCRLPTTON I INSTALLATECAJ 6 GENERAL NOTES 2 ELEVATION 3 ANCHOR LAYOUTS 4 VERTICAL 6 HORTLOMAL 5ECTIONS (NAIL FIN) 5 VERTICAL 6 HORIZONTAL SECTIONS 0MOU6H FRAME) 6 HORIZONTAL SECTIONS, BUCK INSTALLATLON, 6 GLA=* DETAII. MAX OVERALL SIRE NNEtG' DESIGN PRESSURE MESSRE IMPACTRATINGWIDTHHE76HT 36• 64' O/X 35 / -35 PSF NON IMPACT 33• 66• O/X 50 / -50 PSF NON IMPACT 38• 74• O/X 50 / -50 PSF NON IMPACT 3B' 7T O/X 35 / -35 PSF NON rMACT 44' 62• O/X 50 / .50 PSF NON IMPACT 4B• 72• O/X 35 / -35 P3F NON IMPACT 48' 64' O/X 20 / •20 PSF NON EAIPACT 52• 72' O/X 25 / .25 PSF NON EMPACT 36' 63.75• O/X (ORIH.) 35 / -35 PSF NON IMPACT 4B• 96• O/% (ORIEL) 20 / -20 PSF NON IMPACT 72• 626 O/XO/X 35 /.35 P5F NON IMPACT 72• Be O/XO/X 35/.35PSF NON IMPACT TV 62• O/X-O/X 50 / -50 PSF NON LYPACT 76' 72• OA_= 50 / -50 PSF NON EMPACT 76' 7T O/XO/X 1 45 / -25 PSF NON EMPACT BO' 74• O/XO/X 35 / •35 PSF NON LAIPACT 96' 74' O/XO/X 30 / .30 PSF NON LVPACT lob' 6T O/X-0/XO/X 50 / •50 PSF NON IMPACT LOB' 72• O/X-O/X-O/X 50/.50PSF NON EMPACT LOB• 64• O/X-O/X-O/X 25 / 45 PSF NON IMPACT Digitally signed by Hermes F Norero, P.E. Reason: I am approving this document FL#: FL19715 Date: 2016.02.03 09.40:44 -05'00' SilverLine byAndersen rleoerf•000u Q! 34YDILRE WIYf NI1f7M wo+srtc'C NDdg1 FlepYlapyNppe Z m . 3 M W 1 TT 2 i F S O Oin mt Uj N Fd W ca v4a a CK m } o. FWG SW0002 4EET: 1 OF 6 MAX. FRAME MAX FRAME SilwrLine WIDTH 48• WIDTH 48' byArtdE.rsln F,l i E 8 E 4 4 y r eeeva.eeeet a 54hNLDE OmE wen ew/awr HTeaso rro 07=1 au om F pc y y o 4 4 4 1 r O rZ N ON,: p 5 J iH1 MAX. HEZ' FRAME MAX FRAME _ w e < QUALIFIED CONFIGURATIONS%• HEIGHT Lu W W a ARCH TOP CONFIGURATIONS FOR ALL 29014MI K m w < X. RATINGS. SINGLE UNIT CONFIGURATIONS . X. N W a m 0 n w A D A D p 4 S 4 S Tae ELEVATION ELEVATION ZSINGLEHUNGWINDOW SINGLE HUNG ORIEL W WDOW O H o H MAX. FRAME MAX. FRAME > c°Ci WIDTH 96• 0 E WIDTH L08• W w s QUALIFIED CONFIGURATIONS e E GC p 4 s ARCH TOP CONFIGURATIONS FOR ALL 2902-4902 -r— RATINGS, TWIN UNITCONFIGURATIONS F y y F qR0' 9 ` `O` `O` 2 ii 4 7 7 1 MAX. FRAME — HEIGHT 74• X. 'x' MAX FRAME X. HEIGHT 84` A 0 <N Z Yf vz ELEVATION 40 ELEVATION DWG TWIN SINGLE HUNG WINDOW TRIPLE SINGLE HUNG WINDOW 5 W p 00 2 SHEET. 2 OF 6 2• MAX FROM - CORNERS it, MAX. O.C. II' MAX. O.C. 2' MAX --{ 4 1!2' MAK CORNERSI O.C. 41/ 2• Oj AAX. l 7 L MAX T MAX T FROM CORNERS T— NOME AA•A et BIITS AraSOY} 9WL SE AN04MO WNI 6°6C AT W-te, IAMB, ANY SEL 2' MAX, FROM J CORNERS ANCHOR LAYOUT NAIL FIN - SINGLE HUNG WINDOW 41/ 2• MAX O. C. ANCHOR LAYOUT NAIL FIN -TWIN SINGLE HUNG WINDOW 1' MAX FROM CORNERS 0 Ir- 6' M 0. 4 I" MAX FROM CORNERS I I 6' MAX. O. 0 ANCHOR LAYOUT NAIL FIN -TRIPLE SINGLE HUNG WINDOW 6' MAX. FROM F— 20'MAX CORNERS I O.C. 6' MAX. 12' MAX 6' MAX. FROM O. C. FROM I- r 12 3/4• MAX CORNERS CORNERS O.C..====I 20, O. C. L 6' MAX FROM CORNERS} T I ANCHOR LAYOUT THROUGH FRAME - ANGLE HUNG WINDOW 16 L rr INN I 6' MA FROM CORNERS 16 LM2' MAX O. C. L ANCWORSTRAP SHEET 6FROM j ANCHORSTRAP P/N'95 2 CORNERS P/N 50-2995-2 SEE SHEET 5 FOR DETAIIS SEE SHEET 5 FOR DETAILS ANCHOR LAYOUT ANCHOR LAYOUT THROUGH FRAME -TWIN SINGLE HUNG WINDOW THROUGH FRAME - TRIPLE SINGLE HUNG WINDOW SilverLino byAndersm w. eowt •coos ONE SILVOL" 04VE IN uruwrCLwo m ntM43$- O Lm 11 3 ~" k VMS T z Of 2&e 15 m ; IZt i 2 & W G J Lu LuccF g d0 t mM T mVV)$) m JV) N J Y V Z 0 W6 #: SWD002 FEET: 3 OF 6 CONCRETE/ MASONRY BY OTHERS CAULK BETWEEN CONCRETE/ MASONRY 6 2X WOOD BUCK BY OTHERS 2X WOOD BUCK BY OTHERS SEE SHEET 6 FOR CONNECTION DETAILS 8 WOOD SCREW INSTALLATION ANCHOR EXTERIOR FINISH BY OTHERS PERIMETER SEALANT o.A BY OTHERS UNIT HEIGHT EXTERIOR I O.A. UNIT HEIGHT SEEGLAZING DETAIL, SHEET 6 1 1/2, MIN. EMBEDMENT 1\ / INTERIOR VERTICAL SECTION J HEAD - vc WOOD BUCK NAIL RN SEE GLAZING _\ TT DETAIL, SHEET 6 EXTERIOR INTERIOR 3/ 8' MIN. EDGE GIST. v4" MAX V4' MAX. SHIM SPACE SHIM SPACE SASH REINFORCWG SEE SHEET 6 FOR REQUIREMENTS SEE GL Al M DETAIL SHEET65 INTERIORPERIMETER / 1 SEALANT BY OTHERS \ 1/4' MAX EXTERIOR FINISH SHIM SPACE BY OTHERS 8 WOOD SCREW INSTALLATION ANCHOR-.3/8" MIN ZX WOOD BUCK BY OTHERS EDGE GIST. SEE SHEET 6 FO CONNECTION DETAILS , a CAULK BETWEEN b~ .•• CONCRETE/MASONRY CONCRETE/ MASONRY d 2X 1 MIN. BY OTHERS WOOD BUCK BY OTHERS EMBEDMENT q VERTICAL SECTION 4 SILL - Ix WOODBuOc NAIL FIN MIN. 3/8' EDGE DISTANCE MIN. 3 THREADS PENETRATION BEYOND METAL STRUCTURE 8 GIRL 5 SELF-TAPPD46 SCREW INSTALLATION ANCHOR METAL STUD BY OTHERS, SEE SHEET 1 INSTALLATION NOTE M EXTERIOR FINISH BY OTHERS EXTERIOR • • PERIMETER SEALANT BY OTHERS O. A. UNIT WIDTH HORIZONTAL SECTION 4 JAMB - MErAL STUD NAIL FIN SilverUne gAndersen w" oew•0000• aramveua w wem uvwracw oent ne: tnn usme um i 0. 12 0'e WzJaG Zmv O4< jmN m M Z < mazR 040 W 01 T110 fn Z 00 i W W C t0, c 0 i y c PfL0"0 WG m tn N YQ t<iZ ov %vn) 0 DW& 4 SWD002 SHEET. 4 of 6 10 WOOD SCREW INSTALLATION ANCHORCONCRETE/MASONRY BY OTHERS ' CAULK BETWEEN ° CONCRETE/MASONRY BY OTHERS PERIMETER SEALANT - BY OTHERS / O.A. EXTERIOR / UNIT / HEIGHT SEE GLAW* DETAIL, SHEET 6 3/4' MM EDGE DISTANCE 2X WOOD BUCK/STUD BY OTHERS SEE SHEET 6 FOR 1/4' MAX CONNECTION DETAILS SHIM SPACE SEE SHEET 6 FOR REQUIREMENTS SASH SEE 6LAZ3NG 11/2" MIN. DETAIL SHEET 6 EMBEDMENT INTERIOR 1/4" MAX. 5HIM SPACE INTERIOR VERTICAL SECTION 5 HEAD -2XWOOD BUCK THROUGHFRAME SEE GLAZING DETAIL, SHEET 6 EXTERIOR IIJTERIOR ANCHOR STRAP, AT TWIN 6 TRIPLE CONFIG. ONLY. SEE PLAN VIEW -ANCHOR STRAP UUI HEEIGGHT ( RI/644T FOR INSTALL, REQ. T 1/ 4" MAX PERIMETER SEALANT r SHIM SPA BY OTHERS I SPACE EXTERIOR FINISH BY OTHERS i.. PRECAST SILL 4 e BY OTHERS 3/ 1V rrw TAPCON o- e I DLLJSTAATIONANCHOR13/ 4' MM• ° EDGE DISTANCE SECTION TVERTICAL StLL-CONCEIE/MASONRY THROUGH FRAME MIN. 3 THREADS PENETRATION BEYOND METAL STRUCTURE MIN.112" EDGE DISTANCE 10 GR. SELF -TAPPING SCREW INSTALLATION ANCHOR METAL TUBE/ STUD OR APPROVED MULLION BY OTHERS, SEE SHEET I INSTALLATION NOTE14 PERIMETER SEALANT EXTERIOR BY OTHERS O.A. UNIT WIDTH HORIZONTAL SECTION 5 JAMB- METALTUBE/STVD OR APPROVEDMUWON THROUGH FRAME 5) #14 PANCAKE HEAD SCREWS FROM STRAP TO FRAME, HOLES PROVIDED 4.0000 4.0000 TO ACCOMODATE #14 DLA. i r 2.0000- 2.0000 0.0620 0.500012) f 0. 7500(2)f--3.0000(2) 1 6.0000FROM INSTALLATION AANCHOR NCHORS 11/4' MIN. PLAN VIEW -ANCHOR STRAP (P/N 50.2995-2) TO OPENING. SEE ANCHOR EMBEDMENT REQUIREMENTS BELOW. ANCHOR STRAP ANCHORING REQUIREMENTS: A. FOR INSTALLATION TO CONCRETE/MASONRY, USE (4) 3/16' ITW TAPCONS PER STRAP, MIN. 1-1/4- EMBEDMENT, MM 1-3/4- EDGE DISTANCE. B. FOR INSTALLATION TO METAL STUD, USE (4) #10 SELF-DRAlIN6 SCREWS, 6R. 5, PER STRAP. MIN. 3 THREADS PENETRATION, MM 3/4' EDGE DISTANCE. C. FOR INSTALLATION TO WOOD, USE (4) #10 WOOD SCREWS PER STRAP. MIX 1-t/2' EMBEDMENT, MIN.1' EDGE DISTANCE. Sil tiersen e ark aain+ a o.eve aonu uuruwux w ano: rw .uioro Q Q z qqN Sg orecW V Vi m gym Sp a m I dama 1 T { r- & Z C F 0 F ii h' • 4c PR AAO oar 2 o a DW6 #: 5WD002 SHEET. 5 of 6 EXTERIOR VERTICAL SECTION 6 MEE71NGSTIIE INTERIOR INTERIOR SMALL' FRAME4k 'LARGE' FRAME REINFORCING EXTERIOR REINFORCING SEE BELOW FOR REINF. SEE BELOW FOR REINF REQUIREMENTS REQUIREMENTS. jj' HORIZONTAL SECTION 6 INTERMEDIATE FRAME MULLION I- ALUMINUM SASH REINFORCING IS REQUIRED FOR THE FOLLOWING SIZE/RATINGS: 48 X 72, (O/X), DESIGN PRESSURE •/- 35 PSF 36 X 64, (O/X), DESIGN PRESSURE •/- 35 PSF 38 X 74, (O/X), DESIGN PRESSURE •/- 50 PSF 38 X 77, (O/X), DESIGN PRESSURE ./• 35 P5F 72 X 84, (O/X•O/X), DESIGN PRESSURE •/- 35 P5F 76 X 72, (O/X-OM, DE516N PRESSURE •/- 50 PSF 108 X 62, (O/X-O/X-O/X), DESIGN PRESSURE 4-50 PSF 108 X 72, (O/X-O/X-O/X). DESIGN PRESSURE •/-50 PSF C- STEEL INTERMEDIATE FRAME 'LARGE' REINFORCING IS NOT REQUIRED FOR THE FOLLOWING SIZE/RATINGS: 76 X 62, (O/X-O/X), DESIGN PRESSURE •/- 35 PSF 0 - STEEL INTERMEDIATE FRAME'SMALL' REINFORCING IS NOT REQUIRED FOR THE FOLLOWING SIZE/RATINGS: 76 X 62, (O/X-O/X), DESIGN PRESSURE •/- 35 PSF NOTE. ALLGLAZING CONFIGURATIONS SHALL COMPLY WITH SAFETY GLAZING REQUIREMENTS OUTLINED IN CURRENT FBC AND A5TM E 1300 GLASS LOAD RESISTANCE. 5/8' O.A. I.6 GLASS EXTERIOR \\\ INTERIOR Q MIN. GLASS t p 61 SITE 1/2• vs• SETTING BLOCK GLAZING DETAIL 1 NOTE: 1. LOCATION OF BUCK OR WINDOW ANCHORS MAY BE ADJUSTED TO MAINTAIN 1' MIN. CENTER TO CENTER SPACING BETWEEN ANCHORS SUCH THAT MAX. O.C. SPACING SPECIFIED IS NOT EXCEEDED. 2. BUCK MAY BE FLUSH WITH FACE OF THE BLOCK. 1/4' ITW TAPCON ANCHOR 4' FROM CORNERS 16• MAX O.C. THEREAFTER 2X WOOD BUCK OF SUFFICIENT DEPTH TO FULLY SUPPORT WINDOW FRAME. BY OTHERS 11/4• MIN, .. EMBEDMENT 11/2• MIN. EDGE DISTANCE 2' MIN. EDGE DISTANCE CONCRETE/ MASONRY BY OTHERS BUCK INSTALLATION DETAIL SilverLine byMdeFsEn g r eoew.eeeu ow iuveozm arm Ne"H enmsvwc w orm M0ep•aono C gr Y^ A 3 N P1 pqqqy y! d NA .' C a 1 d a j U W p < 2 -2 N< W V x o(2mc. Lu T p y< p U, kZ<i kq a p o : ie Z1 1 zG f old, •• m p ZpgcLZih DWG #: 5WD002 SHEET. 6 OF 6 WINDOW & DOOR MANUFACTURERS ASSOCIATION IEWDMAConformance Hallmark® Certificate of and License CCL lit > Silver Line Building Products Mfr ID: 440 One Silver Line Drive For more Information visit www.amscert.com North Brunswick, NJ 08902 Website: TEL: 800-234-4228 ext 4644 AMs, INC. A°m`°`w'°```YM°°°g`m"" syu"ns, Ine. Product No. Product Name Standard Rating Wide High Test Report # CertDate ExpDate 440-H-023.09 2800/2803-2804 3 Panel Horizontal Slider 101/I.S.2/A440-11 Class R-PG30; Size Tested 2286mm 1219mm E7251.01-109-47 5/2l/2015 5/26/2025 2286mm x 1219mm (90 x 48)' Type-HS; DP +3000 psf; Water Test Press 220Pa 4.59psf) 440-H-025.36 2900/4900170 Series 101/I.S.2/A440-08 Class•R-PG35; Size -tested '914mm 2127mm B9241.01-109-47 7/17/2012 3/8/2017 914x2127mm (36x84in}H' 440-H-025.38 2900/4900 70 Series ASTM E-1996-05 / Wind Zone 3, Missile level D, 914mm 1930mm NCTL-110-15665-2 6/72013 12/19/2016 ASTM E-1886-05 Cycle Pressure = +/-50 psf 440-H-025.39 2900/4900 70 Series 101/I.S.2/A440-08 Class R-PG50, Size tested 1219mm 1676mm NCTL-110-15664-1 5/22/2013 4/32017 1219x1676 mm (48x66 in}H 440-H-025.40 2900/4900 70 Series 101/I.S.2/A440-08 Class R-PG50; Size tested 914mm 1930mm NCTL-110-15665-1 5/242013 4/32017 9141930 mm (36x76 in)-H 440-H-025.41 2900/4900 Impact 70 Series ASTM E-1996-05 / Wind Zone 3, Missile Level D. 1219mm 1676mm NCTL-110-15664-2 72013 1220/2016 ASTM E-1886-05 Cycle Pressure = +/-50psf 440-H-025.42 2901/4901 101/I.S.2/A440-08 Class LC-PG25; Size tested 1118mm 1905mm C7074.01 7112013 5112017 1118x1905mm (44x75in}Type H; Positive Design Pressure DP)=1200Pa (25psf); Negative Design Pressure DP) = 1200Pa (25psf); Water Penetration Resistance Test Pressure = 180Pa (3.76psf) 440-H-025.4S 290//4901 101/I.S.21A440-08 Class LC-PG50; Size tested 965mm 1676mm, C7074.01 7/12013 5/12017 9650676mm' (38x66in'}Type H; Positive'Design Pressure DP):= 2400Pa (50psf); Negative Design Pressure DP) = 2400Pa (50psQ; Water Penetration Resistance Test Pressure = 360Pa (7.52psf) WD-20 10114109 Friday, May 13, 2016 Page 7 M WINDOW wmu cTu SASSOCIAMN 1MWDMA Hallmark® Certificate of Conformance and License (CCL) litAMS, Silver Line Building Products Mfr ID: 440 One Silver Line Drive For more Information visit www.amscert.com North Brunswick, NJ 08902 Website: TEL: 800-234-4228 ext 4644 INC. VIMA°m'°'""" Product No. Product Name Standard Rating Wide High Test Report # CertDate ExpDate 440-H-025.44 2901/4901 101/I.S.2/A440-08 Class LC-PG50: Size tested 1118mm 1575mm, C7074.01 7/12013 5/1/2017 1118x1575mW (44x62in')- Type H; Positive Design Pressure (DP) = 2400Pa 50psQ; Negative Design, Pressure (DP) = 2400Pa 5QpsQ: Water Penetration Resistance Test Pressure = 360Pa (7.52psQ 440-H-025.45 2901 101/I.S.2/A440-08 Class R-PG50: Size tested 1016mm 1829mm NCTL-110-16178-1 7/1/2013 5/1/2017 1016x1829mmm (40x72in) - Type H; DP = 2400Pa (50psf); DP =-2400Pa (-50psf); Water Penetration Resistance Test Pressure 360Pa (7.50psf) 440-H-025.46 2901 101/I.S.2/A440-08 Class R-PG50: Size tested 1016mm 1829mm NCTL-110-16178-1 7/1/2013 5/1/2017 1016x1829mmm (40x72in) - Type H; DP = 2400Pa (50psf); DP =-2400Pa (-50psQ 440-H-025.47 29001mpact ASTM E-1996 12/ASTM Class R-PG50: Size tested 1016mm 1829mm NCTL-110-16178-2 7/1/2013 5/1/2017 E-1886-05 1016x1829mmm (40x72in) - Type H; DP = 2400Pa (50psf); DP =-2400Pa (-50psf) 440-H-025.49 2900/4900 101/I.S.2/A440-08 Class R-PG35; Size tested 1219mm 1829mm C9979.01-109-47 9/24/2013 7/22/2017 1219x1829mm (48x72in}H; DP+30/-30; Water Pen. Rsisl Test Pressure = 360Pa 7.52psQ 440 H-025.50 2901/4901' 101/1.S.21A440-08 Class LC-PG50; Size Tested 965mm 1880mm D7075.01-109-47 1/14/2014, 2/24/2017 965mm x 1880mm • (38 x 74in') Type-H; DP +50/-50 pst Water Test Press 360Pa 7.52psQ 440-H-025.52 2901/4901 Impact TAS 201/202/203-94 DP & Cycle Pressure +501-50 52in 73in NCTL-110-16675-1 3/5J2014 2/20/2018 PSI 440-H-025.53 2901/4901 Impact TAS 201/2021203-94 DP & Cycle Pressure +50/-50 38in 62in NCTL-110-16675-1 3152014 2120/2018 psi 440-H-025.55 2901/4901 Impact 1011l.S.2/A440-11 Class R-PG50; Size Tested 1321 mm 1854mm NCTL-110-16675-3 3/5/2014 12/12/2017 1321 x 1854mm (-52 x 73 in.) Type-H WD-20 10114109 Friday, May 13, 2016 Page 8 WINDOW 8 DOOR i_i MANUFACTURERS ASSOCIATION Hallmark® Certificate of AMs, INC. WDMA Conformance and License CCL C A .% I=. Mmagemeni Silver Line Building Products Mfr ID: 440 One Silver Line Drive For more Information visit www.amscert.com North Brunswick, NJ 08902 Website: TEL: 800-234-4228 ext 4644 Product No. Product Name Standard Rating Wide High Test Report # CertDate ExpDate 440-H-025.57 2901/4901 Impact 101/I.S.2/A440-11 Class R-PG50; Size Tested 965mm 1575mm NCTL-110-16675-3 3/5/2014 12/1212017 965 x 1575mm (-38 x 62 in.) Type-H 440-H-025.59 2901/4901 Impact ASTM E-1996 121ASTM DP+50/-50 psf, Missile D, 1321mm 1854mm NCTL-110-16675-2 315/2014 2/20/2018 E-1886-05 Wind Zone 4 440-H-025.60 2901/4901 Impact ASTM E-1996 12/ASTM DP +50/-50 psf, Missile D, 965mm 1575mm NCTL-110-16675-2 3/5/2014 2/20/2018 E-1886-05 Wind Zone 4 440-1-11-025.61 29004900 Series/29014901 Single Hung Window 101/1.S.2/A44a11 Class R-PG20; Size Tested 1219mm 2134mm D9957.01-10947 10/92014 8l6/2018 1219mm x 2134mm (48 x 84), Type-H; DP +20/-20 psf; Water Test Press 150Pa (3.13psf) 44061-1-025.62 29004900 Series/29014901 Single Hung Window_ 101/I.S.2/A440-11 Class R-PG25; Size Tested 1321mm 1829mm 10/9/2014 8/6r2018 1321 mm x 1829mm (52 x 72) Type-H; DP +25/-25 psf; Water Test Press 180Pa (3.76psf) 440-H-025.63 29004900 Series/29014901 Single Hung Window 101/I.S.2/A440-11 Class LC-PG30; Size Tested 1219mm 1956mm D9359.01-109-47 1/28/2015 712/2024 1219mm x 1956mm (48 x 77) Type-H; DP +30/-30 psf; Water Test Press 260Pa (5.43psf) 440-H-025.64 29004900 Series/29014901 Single Hung Window 101/I.S.2/A440-11 Class LC-PG35; Size Tested 1219mm 1829mm D9964.01-109-47 1/29/2015 8142024 1219mm x 1829mm (48 x 72) • Type-H; DP +35/-35 psf; Water Test Press 260Pa (5.43psf) 440-H-025.65 29004900 Series29014901 Single Hung Window 101/I.S.2/A440-11 Class LC-PG35; Size Tested 965mm 1956mm D9964.01-109-47 1/29/2015 8/42024 965mm x 1956mm (38 x 77) Type-H; DP +35/-35 psf; Water Test Press 260Pa (5.43psf) 440-H-025.66 29004900 Series2901/4901 Oriel Single Hung 101/I.S.2/A440-11 Class R-PG20; Size Tested 1219mm 2438mm E5610.01 3/16/2015 4/132025 1219mm x 2438mm (48 x 96) Type-H; DP +20/-20 psf; Water Test Press 150Pa (3.13psf) 440-H-025.67 29004900 Series2901/4901 Single Hung 101/I.S.2/A440-11 Class R-PG50; Size Tested 965mm 1676mm E5611.01-109-47 3/16/2015 7/22024 965mm x 1676mm (38 x 66)• Type-H; DP +50/-50 psi; Water Test Press 360Pa (7.52psf) 440-H-025.68 29004900 Series29014901 Single Hung 101/I.S.2/A440-11 Class LC-PG50; Size Tested 965mm 1880mm E5612.01-109A7 6112015 9/82025 965mm x 1880mm •(38 x 74) Type-H; DP +50/-50 psf; Water Test Press 360Pa (7.52psi) WD-2010114109 Friday, May 13, 2016 Page 9 WINDOW R DOOR MANUFACTURERS ASSOCIATION Hallmark® Certificate of ' Conformance and License CCL } C L L `WDMA lit Silver Line Building Products Mfr ID: 440 One Silver Line Drive For more Information visit www.amscert.com North Brunswick, NJ 08902 Website: TEL: 800-234-4228 ext 4644 AMS,INC. mmA°n"°` yumj "'°°s`"" Inc. s ysuyna, Product No. Product Name Standard Rating Wide High Test Report # CertDate ExpDate 440-H-025.69 2900-4900 Series/2901-4901 Single Hung 101/I.S.2/A440-11 Class LC-PG50; Size Tested 965mm 1676mm E5611.01-109-47-rl 8/21/2015 2/25/2025 965mm x 1676mm (38 x 66)' Type-H; DP +50/-50 psi; Water Test Press 360Pa (7.52ps() 440-H-025.70 2900-4900/2901-4901 Single Hung 101/I.S.2/A440-11 Class LC-PG50; Size Tested 1118mm, E9219.01-10947 1/15/2016 2/8/2026 1118mm x 1575mm (44 x 62)' 11575mm Type-H; DP +50/-50 psi; Water Test Press 360Pa (7.52psi) 440-H-027.19 2907TW/4907TW 101/I.S.21A440-08 Class R-PG15; Size tested 2032mm 2134mm C1050.01-109-47 12/2812012 8/9/2016 2032x2134mm (80x84 in}H 440-H-027.20 2907TW/4907TW 101/I.S.21A440-08 Class R-PG15: Size tested 2286mm 1880mm C4709.01-109-47 1/31/2013 12/1312016 2286x1880 mm(90x74 in)-H 440-H-027.21 2900/4900 101/1.S.2/A440-08 Class R-PG35; Size tested 1829mm 2134mm; C9952.01-109-07, 9/24/2013 7/24/2017 1829x2134mm' (72x84in')-H; DP+35/-35; Water Pen. Resist. Test Pressure = 260Pa 5.43pso 440-H-027.22 2902/4902 101/I.S.2/A440-08 Class R-PG50; Size tested 1994mm 1524mm C7070.01-109-47 9124/2013 7/22/2017 1994x1524mm• (79x60in')-H; DP+501-50; Water Pen. Rsist. Test Pressure = 360Pa 7.52psQ 440-1-1-027.23 2902/4902 Twin Single Hung Window 101/I.S.2/A440-11 Class R-PG35; Size Tested 2032mm 1880mm C0328.01-109-47 2/5/2014 9/19/2017 2032mm x 1880mm (80x74in) Type-H; DP +35/-35 psi; Water Test Press 260Pa (5.43psi) 440-H-027.24 2902/4902 Twin Single Hung Window, 101/I.S.2/A440-11 Class R-PG50; Size Tested 1918mm 1575mm C0328.01-109-47 2/5/2014 9/19/2017 1918mm x 1575mm (76x62in) Type-H; DP +50/-50 psi; Water Test Press 360Pa (7.52psf) 440-H-027.25 2902/4902 Twin Single Hung Window 101/1.S.2/A440-08 Class R-PG30; Size Tested 2426mm 1880 mm C0375.01-109-47 3/5/2014 1/18/2017 2426 x 1880 mm (-96 x 74 in.) Type-H 440-H-027.26 2902/4902 Twin Single Hung Window 101/I.S.2/A440-11 Class R-PG35; Size Tested 1829 mm 1575 mm D9358.01-109-47 1/27/2015 8/6/2024 1829 mm x 1575 mm (72 x 62), Type-H; DP +35/-35 psf; Water Test Press 260Pa 5.43psf) WD-20 10114109 Friday, May 13, 2016 Page 10 WINDOW 8 DOOR MANUFACTURERS ASSOCIATION Hallmark® Certificate of 1MWDMAConformance and License CCL Silver Line Building Products Mfr ID: 440 One Silver Line Drive For more Information visit www.amscert.com North Brunswick, NJ 08902 Website: TEL: 800-234-4228 ext 4644 AMS, INC. AdtomisuwtixMsaugement systcmu% Inc. Product No. Product Name Standard Rating Wide High Test Report # CertDate ExpDate 440-H-027.27 29004900129024902 Twin Single Hung 101/I.S.2/A440-11 Class R-PG15; Size Tested 2426mm 1880mm E7252.01-109-47 5/12/2015 5/27/2025 2426mm x 1880mm (96 x 74) Type-H; DP +15/-15 psf; Water Test Press 180Pa (3.76psf) 440-H-027.28 2900-4900129024902 Twin Single Hung 101/I.S.2/A440-11 Class R-PG25; Size Tested 2032mm 1880mm E7252.01-109-47 5/12/2015 5/27/2025 2032mm x 1880mm (80 x 74)' Type-H; DP +251-25 psl; Water Test Press 180Pa (3.76psi) 440M-027.29 2900-4900 Series/29024902 Twin Single Hung 101/l.S.2JA440-11 Class R-PG25; Size Tested 1918mm 1956mm E7244.01-109-47 8/6/2015, 9/8/2025 1918mm x.1956mm (76 x 77)• , Type-H; DP +25/-25 psf; Water Test Press. A80Pa (3.76psf) 440-H-027.30 2900-4900 Series/29024902 Twin Single Hung 101/I.S.2/A440-11 Class R-PG15; Size Tested 2184mm 2134mm E9218.01-109.47 12/29/2015 3/27/2026 2184mm x 2134mm (86 x 84) Type-H; DP +151-15 psf; Water Test Press 360Pa (7.52psi) 440-H-027.31 2900490012902-4902 Twin SH 101/l.S.2/A440-11 Class R-PG50; Size Tested 1918mm 1829mm E9220.01-109-47 1/15/2016 1/27/2026 1918mm.x 1829mm (76 x 72)' Type-H; DP +50/-50 psi; Water, Test Press 360'Pa (7.52psfp 440-H-027.32 2900-4900129024902 Twin SH (Finless) 101/I.S.2/A440-11 Class R-PG50; Size Tested 1918mm 1575mm F2423.01-109.47 1/15/2016 10=2025 1918mm x 1575mm (76 x 62)' Type-H; DP +50/-50 psi; Water Test Press 360Pa (7.52psf) 440-H-027.33 29004900/29024902 Twin SH (Finless) 101/I.S.2/A440-11 Class R-PG30; Size Tested 2426mm 1880mm F2252.01-109.47 2119/2016 10/21/2025 2426mm x 1880mm (96 x 74) Type-H; DP +30/-30 psf; Water Test Press 220Pa (4.59psQ 440-H-028.14 2903/4903170 Series 101/l.S.2/A440-08' Class R-PG50;Size tested 2737mm 1575mm 13643001 4/5/2012 12/16/2016 2737)e1575mm 008x62in}H 440-H-028.15 2900/4900170 Series 1011l.S.2/A440-08 Class R-PG15: Size tested 2718mm 2134mm C4710.01-109-47 2119/2013 1/17/2017 2718x2134mm (107x84in}H 440-H-028.16 2900/4900/ 70 Series 101/I.S.2/A440-08 Class R-PG30; Size tested 2718mm 1575mm C4710.01-109-47 2119/2013 1/17/2D17 2718x1575mm•(107x62in•-H 440-H-028.18 2903/4903 Series 101/I.S.2IA440-11 Class R-PG35; Size Tested 2737mm 1880mm D5516.01-109.47 3/26/2014 3/22/2018 2737 x 1880mm (-108 x 74 in.) Type-H WD-2010114109 Friday, May 13, 2016 Page 11 WINDOW 8 DOOR MANUFACTURERS ASSOCIATION IOWDMA Hallmark® Certificate of ,- Conformance and License CCL Silver Line Building Products Mfr ID: 440 One Silver Line Drive For more Information visit www.amscert.com North Brunswick, NJ 08902 Website: TEL: 800-234-4228 ext 4644 A , INC. tdrninLumthv''a°`m`° Systems, Inc. Product No. Product Name Standard Rating Wide High Test Report # CertDate ExpDate 440-H-028.19 29004900 Series/2903-4903 101/I.S.2/A440-11 Class R-PG50; Size Tested 2737mm 1829mm C0329.01-10947 11r7/2014 2/21/2018 2737mm x 1829mm (108 x 72) Type-H; DP +50/-50 psf; Water Test Press 360Pa (7.52psQ 440-H-028.20 2900/4900 Series 2903/4903 Triple Single Hung 101/I.S.2/A440-11 Class R-PG20; Size Tested 2743mm 2134mm E5617.01-109-47 4/10/2015 4/14/2025 2743mm x 2134mm (108 x 84) Type-H; DP +20/-20 psf; Water Test Press 150Pa (3.13psQ 440-H-028.21 2900/4900/70-2903/4903 Triple Single Hung 101/I.S.2/A440-11 Class R-PG25; Size Tested '2737mm 2134mm E7250.01-109.47 8/21/2015 10/14/2025 2737mm x 2134mm (108 x 84) Type-H; DP++25/-25 psf; Water, Test Press 180P.a (3.76psQ 440-H-028.22 2900-490012903-4903 Triple Single Hung 101/I.S.2/A440-11 Class R-PG30; Size Tested 2737mm 1575mm E9222.01-109-47 2142016 2/16/2026 2737mm x 1575mm (108 x 62) Type-H; DP +30/-30 psf; Water Test Press 220Pa (4.59psQ 440-H-029.06 2907/4907 101/I.S.21A440-08 Class R-PG20; Size tested 1219mm 2134mm C1542.01-109.47 12282012 9/5/2016 1219x2134 mm (48x84 in}H 440-H-029.07 49002900170 101/I.S.2/A440-08 Class R-PG35; Size tested 1118mm 1524mm C7073.01-109-47 10/31/2013 5/12017 1118x1524mm' (44x60'in)-H; DP+35/-35; Water Pen. Resist. Test Pressure = 260Pa 5.43psQ 440-H-029.08 29004900129074907 Single Hung 101/I.S.2/A440-11 Class R-PG35; Size Tested 1016mm 1727mm E5613.01-109.47 3132015 3/8/2025 1016mm x 1727mm (40 x 68) Type-H; DP +35/-35 psf; Water Test Press 260Pa (5.43psQ 440-H-030.15 2900/4900 Series 101/I.S.21A440-11 Class R-PG20; Size Tested 2032mm 1575mm D2935.01-109-47 1/142014 11/12/2017 2032 x 1575mm (80 x 62in}H; DP +20/-20psf; Water Pen Resist. Test Press = 150Pa 3.13psQ 440-H-030.16 2907TR/4907TR Series 101/I.S.21A440-11 Class R-PG20; Size Tested 2718mm 1880mm D5514.01-109-47 31262014 5/62018 2718 x 1880mm (-107 x 74 in.) Type-H 440-H-030.17 2907TR/4907TR Series 101/I.S.21A440.11 Class R-PG35; Size Tested 2718mm 1575mm D5514.01-109.47 3/262014 3/232018 2718 x 1575mm (-107 x 62 in.) Type-H WD-20 10114109 Friday, May 13, 2016 Page 12 WINDOW R DOOR MANUFACTURERS ASSOCIATION Hallmark® Certificate of AMs, INC. la, III W D M A Conformance and License (CCL) AdminiSrAMY Iffic. emenr Sysccros, Ir c. Silver Line Building Products Mfr ID: 440 One Silver Line Drive For more Information visit www.amscert.corn North Brunswick, NJ 08902 Website: TEL: 800-234-4228 ext 4644 Product No. Product Name Standard Rating Wide High Test Report # CertDate ExpDate 440-H-089.00 5500/5510 Side Lite (Specimen 2) 101/I.S.2/A440-11 440-H-089.01 5500/5540Transom (Specimen 1) 101/I.S.2/A440-11 WDMA HEREBY CERTIFIES that the aforesaid Company ("Licensee"), at its participating manufacturing plant(s), is licensed to use the WDMA Registered Hallmark on product lines that have been manufactured in accordance with the standards. It is further certified that the plant(s), facilities, quality control procedures, methods, and processes of Licensee have been inspected by WDMA, and are subject to regular follow-up inspection and test. It is further certified that samples of the product set forth above were tested and found to comply with the standards. Class R-PG35; Size Tested 1245mm x 2432mm (49 x 96) Type-SLT; DP +35/-35 psf; Water Test Press 260Pa 5.43psQ Class R-PG35; Size Tested 2734mm x 914mm (108 x 36) Type-TR; DP +35/-35 psf; Water Test Press 260Pa 5.43psQ By: 1245mm 2432mm E6290.01-109-47 2734mm 914mm E6290.01-109-47 46-1- 4w— John AfcFee, IMP c 11/23(2015 4/27/2025 11/23/2015 4/27/2025 ITIZ)MA Hallmark By. % ,,,,, &J4 Rhonda Schon_, Authorized Representative, AMS If Program Sponsor: Program Administrator: Window and Door Manufacturers Assoc Administrative Management Systems, Inc. 330 N. Wabash Avenue, Suite 2000 PO Box 730, 205 West Main Chicago, IL 60611 Sackets Harbor, NY 13685 TEL (312)673-4828 www.wdma.com TEL (315)646-2234 staff@amsoen.00m WD-20 10114109 Friday, May 13, 2016 Page 26 A\\ BUILDING DROPS A Perfect Solution in Every Drop Certificate of Authorization: 29578 398 East Dania Beach Blvd. Suite 338 Dania Beach, FL 33004 954.399.8478 PH 954.744.4738 FX contact@buildingdrops.com Product Evaluation Report Of Silver Line Building Products Series 2900/4900 — Extruded Vinyl Single Hung Window Non -Impact) for Florida Product Approval FL# FL 19715 Report No. 3947 51h Edition Florida Building Code Method: Category: Sub — Category: Product: Material: Product Dimensions: 1— A (Certificate) Windows Single Hung Series 290014900 Single Hung Window PVC See Installation Instructions, SWD002 Prepared for: Silver Line Building Products One Silverline Dr. North Brunswick, NJ 08902 Prepared by: Hermes F. Norero, P.E. Florida Professional Engineer # 73778 Date: 12/15/2015 Contents: Evaluation Report Pages I — 4 Digitally signed by Hermes F Norero, P.E. Reason: I am approving this document Date: 2016.02.12 12:20:17 -05'00' O z. o - 7 — T T = i •••.......••.• Gam= 9/0NAI. 1 1111 Hermes F. orero, P.E. Florida No. 73778 BUILDING DROPS A Perfect Solution in Every Drop Certificate of Authorization: 29578 Manufacturer: Silver Line Building Products Product Category: Windows Product Sub -Category: Single Hung Compliance Method: State Product Approval Method (1)(a) Product Name: Series 2900/4900 Single Hung Window FL#: FL1971S Date: 12/15/2015 Report No: 3947 Scope: This is a Product Evaluation Report issued by Hermes F. Norero, P.E. (FL # 73778) for Silver Line Building Products based on Method la of the State of Florida Product Approval, Florida Department of Business and Professional Regulation - Florida Building Commission. Limits of Use: Hermes F. Norero, P.E. does not have nor will acquire financial interest in the company manufacturing or distributing the product or in any other entity involved in the approval process of the product named herein. This product has been evaluated for use in locations adhering to the S' Edition Florida Building Code. See Installation Instructions SWD002, signed and sealed by Hermes F. Norero, P.E. (FL # 73778) for specific use parameters. 1. This product has been evaluated and is in compliance with the 51' Edition Florida Building Code, excluding the "High Velocity Hurricane Zone" (HVHZ). 2. Product anchors shall be as listed and spaced as shown on details. Anchor embedment into substrate material shall be beyond wall dressing or stucco. 3. When used in areas requiring wind borne debris protection this product complies with Chapter 16 of the 51h Edition Florida Building Code and does require an impact resistant covering. 4. Site conditions that deviate from the details of drawing SWD002 require further engineering analysis by a licensed engineer or registered architect. 5. See Installation Instructions SWD002 for size and design pressure limitations. Hermes F. Norero, P.E. Florida No. 73778 Page 2 of 4 A\\ BUILDING DROPS FL#: FL19715 A Perfect Solution in Every Drop Date: 12/15/2015ReportNo: 3947 Certificate of Authorization: 29578 Certification Agency: The manufacturer has demonstrated compliance of window products in Accordance with the Florida Building Code and State Rules for manufacturing under a Certification Agency through Window and Door Manufacturers Association (FBC Organization #: CER1508). Performance Standards: The product described herein has been tested per: Referenced Data: AAMA/WDMA/CSA 101/I.S.2/A440-08/11 1. Product Testing performed by Architectural Testing FBC Organization # TST1558) Report: Dated: B6430.01-109-47 3/09/2012 C0329.02-109-47 3/17/2014 C0375.01-109-47 3/11/2013 C0328.01-109-47 1/03/2014 C7074.01-109-47 6/17/2013 C7075.01-109-47 8/16/2013 C9952.01-109-47 8/30/2013 D9358.01-109-47 9/17/2014 09957.01-109-47 9/16/2014 D9964.01-109-47 1/05/2015 E5610.01-109-47 3/05/2015 E5611.01-109-47 3/03/2015 E5612.01-109-47 5/07/2015 E7244.01-109-47 6/16/2015 E7250.01-109-47 6/16/2015 E9219.01-109-47 10/21/2015 E9220.01-109-47 10/21/2015 2. Certification Agency Window and Door Manufacturers Association FBC Organization #: CER1508) 3. PVC profiles meet requirements of WDMA/HallMark WD-61 in accordance with AAMA 303 Hermes F. Norero, P.E. Florida No. 73778 Page 3 of 4 BUILDING DROPS A\\, A Perfect Solution in Every Drop Certificate of Authorization: 29578 Installation: 1. Approved anchor types and substrates are as follows: Nailing Fin Installation: FL#: FL19715 Date: 12/15/2015 Report No: 3947 A. For two by (2X) wood frame substrate (Min. S.G. = 0.55), use #8 PH Wood Screw OR 11 Gauge Roofing Nails OR 10d Common Nails type wood frame anchors of sufficient length to achieve minimum embedment of 1.50" into wood framing. B. For steel stud substrate (Min 18 Ga., Fy = 33 ksi), use #8 TEK PH or HWH Screw type steel stud anchors of sufficient length to achieve minimum 3 threads penetration beyond steel structure. Through Frame Installation: A. For two by (2X) wood buck substrate (Min. S.G. = 0.55), use #10 PH Wood Screw type installation anchors of sufficient length to achieve a minimum embedment of 1.50" into the wood substrate. B. For concrete (Min. fc = 3000 psi) or masonry (Conforms to ASTM C90) substrate where one by (IX), non-structural, wood bucking is employed, use 3/16" diameter ITW HWH Tapcon type concrete screw anchors of sufficient length to achieve minimum embedment of 1.25" into concrete or masonry. C. For concrete (Min. fc = 3000 psi) or masonry (Conforms to ASTM C90) substrate where wood bucking is NOT employed, use 3/16" diameter ITW HWH Tapcon type concrete screw anchors of sufficient length to achieve minimum embedment of 1.25" into concrete or masonry. D. For steel stud substrate (Min 18 Ga., Fy = 33 ksi), use #10 TEK PH or HWH Screw type steel stud anchors of sufficient length to achieve minimum 3 threads penetration beyond steel structure. Refer to Installation Instructions (SWD002) for anchor spacing and more details of the installation requirements. Design Pressure: Refer to Installation Instructions (SWD002) for anchor spacing and more details of the installation requirements. Hermes F. Norero, P.E. Florida No. 73778 Page 4 of 4 A 1027/2016 Florida Building code online BU. lness il Professiona=09011fien SCIS Home I Log In I User Registration I Hot Topics I submit Surcharge 1 Stats s Facts I Publications I FBC Staff I BCIS Site Map I Links Search Florida rflA', Product Approval USER: Public User a0 ' rcy Product Aoomvai Menu > Produtt or Aoditatlon Search > Aoolication List > Application Oetall FL A FL9174-R11 Application Type Revision Code Version 2014 Application Status Approved Comments Archived set to reapply per applicants request 4/28/15-rb Product Manufacturer Wayne -Dalton, a division of Overhead Door Corporation Address/ Phone/Email 3395 Addison Drive Pensacola, FL 32S14 8S0) 474-9890 Mark_ Garon@Overheaddoor.com Authorized Signature Greg Taylor gtaylor@Wayne- Dalton.com Technical Representative Greg Taylor Address/ Phone/Email 3395 Addison Drive Pensacola, FL 32514 8S0) 474-9890 gtaylor@wayne- dalton.com Quality Assurance Representative Address/ Phone/Email Category Exterior Doors Subcategory Sectional Exterior Door Assemblies Compliance Method Evaluation Report from a Florida Registered Architect or a Licensed Florida Professional Engineer Evaluation Report - Hardcopy Received Florida Engineer or Architect Name who developed John E. Scates the Evaluation Report Florida License PE-51737 Quality Assurance Entity Intertek Testing Services NA, Inc. Quality Assurance Contract Expiration Date 06/27/2038 Validated By Kurt Dietrich PE 4. Validation Checklist - Hardcopy Received Certificate of Independence Referenced Standard and Year (of Standard) Equivalence of Product Standards Certified By Sections from the Code FL2174 R11 COI Cert of Ind Scates 2011 s.odf Standard DASMA- 108 DASMA- 115 Year 2002 2005 hops:// www.floridabLdiding.org/pr/pr app o.aspx?param=wGEVXOwtDqu01JRfWxf6u7ojn10heH%2bRKJkizESWxAzegKuY8GeGQ%3d%3d 1/6 10/27/2016 Florida Building Cade online Product Approval Method Date Submitted Date Validated Date Pending FBC Approval Date Approved FL # I Model, Number or Name 9174.1 15120 / 6100 / 9100 #0228 Limits of Use Approved for use in HVHZ: No Approved for use outside HVHZ: Yes Impact Resistant: Yes Design Pressure: +26.90/-30.80 Other: 9174.2 1 5120 / 6100 / 9100 #0229 Method 1 Option O 04/06/2015 04/28/2015 OS/04/2015 06/23/201S Limits of Use Approved for use in HVHZ: No Approved for use outside HVHZ: Yes Impact Resistant: No Design Pressure: + 15. 30/-17.00 Other: Doors with glazing shall not be used in the wind- borne debris region unless protected or unless structure is designed as partially enclosed or door is a replacement door. 9174.3 1 5120 / 6100 / 9100 #0230 Limits of Use Approved for use in HVHZ: No Approved for use outside HVHZ: Yes Impact Resistant: Yes Design Pressure: +25.90/-28.80 Other: 9174.4 15120 / 6100 / 9100 # 0231 Limits of Use Approved for use in HVHZ: No Approved for use outside HVHZ: Yes Impact Resistant: Yes Design Pressure: +30.00/-33.50 Other: Doors with glazing shall not be used in the wind- borne debris region unless protected or unless structure is designed as partially enclosed or door is a replacement door. Description 9' Max width. 8'-9" Max height. Max section height 21". Glazing available in top or intermediate section. Installation Instructions FL9174 R11 It 0228 3189S8 P7.odf FL9174 Rl1 If Track Supplement Chart P10.odf FL9174 R11 If WDJambSuoolementPl6 s.odf Verified By: John E. Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports FL9174 R t I AE ASTM A 653.odf FL9174 RI AE Eval Rent 9100 rl s.odf FL9174 R11 AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 16' Max width. 8'-9" Max height. Max section height 21'. Glazing available in top or intermediate section. Installation Instructions FL9174 R11 II 0229 3189S9 P8.odf FL9174 R11 II Track Suoolement Chart P10.odf FL9174 R11 It WDJambSuoolementP16 s.odf Verified By: John E. Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports FL9174 R11 AE ASTM A 6S3.odf FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 16' Max width. 8'-9" Max height. Max section height 21". Glazing available in top or intermediate section. Installation Instructions EL9174 R11 11 0230 318960 P10.odf FL9174 R11 11 Track Suoolement Chart P10.odf FL9174 R11 II WD3ambSuoolementP16 s.odf Verified By: John E. Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports EU174 R11 AE ASTM A 653.odf FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 16' Max width. 8'-9" Max height. Max section height 21". Solid only - no glazing available. Installation Instructions FL9174 R1t It 0231 318996 PS.odf FL2174 R I I U Track Supplement Chart P10.odf FL9174 R11 H WD]ambSuoolementP16 s.odf Verified By: John E. Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports FL9174 R11 AE ASTM A 653.odf FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes I9174.5 15120 / 6100 / 9100 #0234 I9' Max width. 8'-9" Max height. Max section height 21". Glazing available in top or intermediate section. Limits of Use Approved for use in HVHZ: No Approved for use outside HVHZ: Yes Impact Resistant: Yes Installation Instructions FL9174 R11 11 0234 319022 PS.odf FL9174 R11 11 Track Suoolement Chart P10.odf FL9174 R11 It WD3ambSuoolementP16 s.odf Verified By: John E. Scates P.E. FLORIDA PE 51737 httpsJ/www.floridabuilding.orglpr/pr_app dU.aspx?param=wGEVXOwIDquf11JRfWxf6u7oinlOheH%2bRKJkizESWxAzegKuY8GeGQ%3d%3d 216 10f27/2016 Florida Building code online Design Pressure: +43.20/-49.60 Created by Independent Third Party: Yes Other: Evaluation Reports FL9174 R11 AE ASTM A 653.odf Eval Reot 9100FL9174R11AE rl s.odf 119174 RII AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.6 5120 / 6100 / 9100 #0235 16' Max width. 8' Max height. Max section height 21". Glazing available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 It 023S 319023 P6.odf Approved for use outside HVHZ: Yes FL9174 R11 It 319040 PI Post.odf Impact Resistant: Yes FL9174 R11 11 Track Suoolement Chart PIO.odf Design Pressure: +39.20/-43.70 FL9174 R11 It WDJambSuoolementP16 s.odf Other: Verified By: John E. Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports FL9174 RI AE ASTM A 6S3.odf FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 1111 AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.7 S120 / 9100 #0232 18' Max width. 8'-9" Max height. Max section height 21". Glazing available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 It 0232 318999 PS.odf Approved for use outside HVHZ: Yes FL9174 R11 If Track Suoolement Chart P10.odf Impact Resistant: No FL9174 R11 It WDJambSuoolementP16 s.odf Design Pressure: +12.40/-13.80 Verified By: John E. Scates P.E. FLORIDA PE 51737 Other: Doors with glazing shall not be used in the wind- Created by Independent Third Party: Yes borne debris region unless protected or unless structure is Evaluation Reports designed as partially enclosed or door is a replacement FL9174 R11 AE ASTM A 6S3.odf door. FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 Rll AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.8 5120 / 9100 #0233 18' Max width. 8'-9" Max height. Max section height 21". Glazing available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 RI I I1 0233 319000 PS.odf Approved for use outside HVHZ: Yes FL9174 R11 11 Track Supplement Chart P10.odf Impact Resistant: No FL9174 R11 It WD]ambSuoolementP16 s.odf Design Pressure: +18.50/-20.70 Verified By: John E. Scates P.E. FLORIDA PE 51737 Other: Doors with glazing shall not be used in the wind- Created by Independent Third Party: Yes borne debris region unless protected or unless structure is Evaluation Reports designed as partially enclosed or door is a replacement FL9174 R11 AE ASTM A 6S3.odf door. FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.9 5120 / 9100 #0236 18' Max width. 8' Max height. Max section height 21". Glazing available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 II 0236 319024 P6.odf Approved for use outside HVHZ: Yes FL9174 R11 If 319040 P1 Post.odf Impact Resistant: Yes FL9174 R11 11 Track Supplement Chart P10.odf Design Pressure: +30.00/-33.50 FL9174 R11 II WDJambSuoolementP16 s.odf Other: Verified By: John E. Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports FL9174 R11 AE ASTM A 653.odf FL9174 R11 AE Eval Rent 9100 rl s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.10 5120 / 9100 #0237 18' Max width. 8' Max height. Max section height 21". Glazing available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 Rll II 02117 31902S P6.odf Approved for use outside HVHZ: Yes FL9174 Rll 11 319040 P1 Post.odf Impact Resistant: Yes FL9174 R11 11 Track Supplement Chart P10.odf Design Pressure: +39.20/-43.70 FL9174 R11 II WDJambSuoolementP16 s.odf Other: Verified By: John E. Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports FL9174 R I I AE ASTM A 6S3.odf FL9174 RI1 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes https:lhvww.floridabuilding.orgtprlpr_app dtl.aspx?param=wGEVXQwtOqufIIJRfWxf6u7oin10heH%2bRKJkizESWxAzegKuY8GeGQ%3d%3d 3J6 10/27/2016 Florida Building Code Online 9174.11 5120/5140/6100/9100/9400/9600 9' Max width. 10' Max height. Max section height 24". Glazing 0600 available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 II 0600 319026 P4.odf Approved for use outside HVHZ: Yes FL9174 R11 II Track Supplement Chart P10.odf Impact Resistant: No FL9174 R11 II WDJambSuoolementP16 s.odf Design Pressure: +26.90/-30.80 Verified By: John E. Scates P.E. FLORIDA PE 51737 Other: Doors with glazing shall not be used in the wind- Created by Independent Third Party: Yes borne debris region unless protected or unless structure is Evaluation Reports designed as partially enclosed or door is a replacement FL9174 R11 AE ASTM A 653.odf door. FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.12 5120/5140/6100/9100/9400/9600 9' Max width. 10' Max height. Max section height 24" Glazing 0601 available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 If 0601 319027 P4.odf Approved for use outside HVHZ: Yes FL2174 R11 II Track Supplement Chart P10.odf Impact Resistant: Yes FL9174 R11 11 WDJambSuoolementP16 s.odf Design Pressure: +41.00/-46.30 Verified By: John E. Scates P.E. FLORIDA PE 51737 Other: Created by Independent Third Party: Yes Evaluation Reports FL9174 R11 AE ASTM A 6S3.odf FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.13 5120/5140/6100/9100/9400/9600 16' Max width. 10' Max height. Max section height 24'. Glazing 0602 available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 If 0602 319028 PS.odf Approved for use outside HVHZ: Yes FL9174 R11 I1 Track Suoolement Chart P10,odf Impact Resistant: No FL9174 R11 If WDJambSuoolementP16 s.odf Design Pressure: +15.30/-17.00 Verified By: John E. Scates P.E. FLORIDA PE 51737 Other: Doors with glazing shall not be used in the wind- Created by Independent Third Party: Yes borne debris region unless protected or unless structure is Evaluation Reports designed as partially enclosed or door is a replacement FL9174 R11 AE ASTM A 6S3.odf door. FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.14 5120/5140/6100/9100/9400/9600 16' Max width. 10' Max height. Max section height 24'. Glazing 0603 available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 it0603 319029 PS.odf Approved for use outside HVHZ: Yes FL9174 R11 It Track Supplement Chart P10.odf Impact Resistant: No FL9174 R11 It WDJambSuoolementP16 s.odf Design Pressure: +23.00/-25.00 Verified By: John E. Scates P.E. FLORIDA PE 51737 Other: Doors with glazing shall not be used in the wind- Created by Independent Third Party: Yes borne debris region unless protected or unless structure is Evaluation Reports designed as partially enclosed or door is a replacement FL9174 RI I AE ASTM A 653.odf door. FL9174 Rll AE Eval Reot 9100 rl s.odf FL9174 R11 AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.15 5120/5140/6100/9100/9400/9600 16' Max width. 8' Max height. Max section height 24" Glazing 0604 available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 11 0604 319030 PS.odf Approved for use outside HVHZ: Yes FL9174 R11 It 319040 P1 Post.odf Impact Resistant: Yes FL9174 R11 11 Track Suoolement Chart P10.odf Design Pressure: +39.20/-43.70 FL9174 1111 It WDJambSuoolementP16 s.odf Other: Verified By: John E Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports FL9174 R11 AE ASTM A 6S3.odf FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.16 5120/5140/6100/9100/9400/9600 18' Max width. 10' Max height. Max section height 24". Glazing 0605 available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHZ: No FL9174 R11 11 0605 319031 P4.odf Approved for use outside HVHZ: Yes FL9174 R11 If Track Supplement Chart P10.odf Impact Resistant: No FL2174 R11 11 WDJambSuoolementP16 s.odf hops://www.floridabuilding.orglpr/pr_app dtl.aspx?param=wGEVXQwlDqufllJRANxf6u7ajnl0heH%2bRKJkizESWxAzegKuYBGeGO%3d%3d 4/6 101272016 Florida Building code Online Design Pressure: +15.30/-17.00 Verified By: John E Scates P.E. FLORIDA PE 51737 Other: Doors with glazing shall not be used in the wind- Created by Independent Third Party: Yes borne debris region unless protected or unless structure is Evaluation Reports designed as partially enclosed or door is a replacement FL9174 RI I AE ASTM A 653,odf door. FL9174 1111 AE Eval Reot 9100 rl s.odf F19174 R11 AE FL09174 r9 Affirmation for FBC 5th 2014s.odf Created by Independent Third Party: Yes 9174.17 5120/5140/6100/9100/9400/9600 18' Max width. 8' Max height. Max section height 24" Glazing 0606 available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVH2: No FL9174 1111 It 0606 319032 P6.odf Approved for use outside HVHz: Yes FL9174 R11 If 319040 PI Post.odf Impact Resistant: No FL9174 R11 It Track Suoolement Chart P10.odf Design Pressure: +30.00/-33.50 FL9174 R11 It WDJambSuoolementP16 s.odf Other: Doors with glazing shall not be used in the wind- Verified By: John E Scates P.E. FLORIDA PE 51737 borne debris region unless protected or unless structure is Created by Independent Third Party: Yes designed as partially enclosed or door is a replacement Evaluation Reports door. FL9174 R11 AE ASTM A 653.odf FL9174 R11 AE Eval Rent 9100 rl s.odf FL9174 R11 AE FLO9174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.18 S120/5140/6100/9100/9400/9600 18' Max width. 8' Max height. Max section height 24" Solid only - 0609 no glazing available. Limits of Use Installation Instructions Approved for use in HVHz: No FL9174 R11 It 0609 319035 PS.odf Approved for use outside HVHz: Yes FL9174 R11 11 319040 PI Post.odf Impact Resistant: Yes FL9174 R11 11 Track Supplement Chart PIO.odf Design Pressure: +39.20/-43.70 FL9174 R11 11 WD3ambSuoolementP16 s.odf Other: Verified By: John E Scates P.E. FLORIDA PE 51737 Created by Independent Third Party: Yes Evaluation Reports FL9174 R11 AE ASTM A 653.odf FL9174 R11 AE Eval Rent 9100 rl s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.19 5140/6100/9400/9600 #0608 18' Max width. 8'-9" Max height. Max section height 21". Glazing available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVHz: No FL9174 R11 It 0608 319034 P4.odf Approved for use outside HVHz: Yes FL9174 R11 11 Track Suoolement Chart P10.odf Impact Resistant: No FL9174 R11 11 WDJambSuoolementP16 s.odf Design Pressure: +18.50/-20.70 Verified By: John E Scates P.E. FLORIDA PE 51737 Other: Doors with glazing shall not be used in the wind- Created by Independent Third Party: Yes borne debris region unless protected or unless structure is Evaluation Reports designed as partially enclosed or door is a replacement FL9174 R11 AE ASTM A 6S3.odf door. FL9174 R11 AE Eval Reot 9100 r1 s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes 9174.20 5140/9400/9600 #0607 16' Max width. 8'-9" Max height. Max section height 21". Glazing available in top or intermediate section. Limits of Use Installation Instructions Approved for use in HVH2: No FL2174 R11 It 0607 319033 PS.odf Approved for use outside HVH2: Yes FL9174 R11 11 Track Suoolement Chart PIO.odf Impact Resistant: No FL9174 R11 11 WDJambSuoolementP16 s.odf Design Pressure: +25.90/-28.80 Verified By: John E Scates P.E. FLORIDA PE 51737 Other: Doors with glazing shall not be used in the wind- Created by Independent Third Party: Yes borne debris region unless protected or unless structure is Evaluation Reports designed as partially enclosed or door is a replacement FL9174 R11 AE ASTM A 6S3.odf door. FL9174 R11 AE Eval Reot 9100 rl s.odf FL9174 R11 AE FL09174 r9 Affirmation for FBC Sth 2014s.odf Created by Independent Third Party: Yes Back 0Nam. Contact Us :: 2601 Blair Stone Road, Tallahassee FL 32M Phone: 850-487.1824 The State of Florida is an AA/EEO employer. Copyright 2007-2013 State of Florida... Privacy Statement :: Accessibility Statement :: Refund Statement Under Florida law, email addresses are public records if you do not want your e-mail address released in response to a public -records request, do not send electronic mad to this entity Instead, contact the office by phone or by traditional mad. If you have any questions, please contact 8S0.487.1395 'Pursuant to Section 455.275(I), Florida Statutes, effective October 1, 2012, licensees licensed under Chapter 455, F.S. must provide the Department with an email address if they have one. The emails provided may be used for official communication with the licensee. However email addresses are public record If you do not wish to supply a personal address, please provide the Department with an email address which can be made available to the public. To determine of you are a licensee under Chapter 4S5, F S., please dick hie t. Product Approval Accepts: https://www.floridabtrilding.org/pr/pr_app dtl.aspx?param=wGEVXQwIDquI11JRNVxf6u7ojnl0heH°k2bRKJkizESWxAzegKuYBGeGO%3d%3d 5/6 10127/2016 Florida Building Code Online Fill MR E Credit Card Safe Mtps://www.floridabuilding.orglpr/pr app dtf.aspx?param=wGEVXOwtDqufIIJRMJxt6u7oinlOheH%2bRKJkizESWxAzegKuYBGeGO%3d%3d 6l6 A Division of Overhead Door Corporation Jamb Connection Supplement This document provides a series of connection schedules and basic detailing concepts for the connection of garage door jambs to building frames with the use of various fasteners. DASMA Technical Data Sheet TDS-161 may be used as an alternate to this document. P/N 324620 Rev. P16 SCHEDULEI 5/16" DIAMETER LAG SCREWS MAXIMUM SPACING OF LAG SCREWS PER JAMB IN MAIN SUPPORT MEMBER SPECIES SYP SPECIFIC GRAVITY - 0.55 DOUGLAS FIR SPECIFIC GRAVITY - 0.46 SPF SPECIFIC GRAVITY - 0.42 LOAD PER JAMB LB/FT `''orE 100 24 24 24 120 24 24 24 140 24 24 24 160 24 24 24 180 24 24 24 200 24 24 24 220 24 24 22 240 24 24 20 260 24 22 19 280 24 20 17 300 24 19 16 320 22 18 15 340 21 16 14 360 20 16 13 380 19 15 13 400 18 14 12 420 17 13 11 440 16 13 11 460 15 12 10 480 15 12 10 500 14 11 10 520 14 11 9 540 13 10 9 560 13 10 8 580 12 9 8 600 12 9 8 620 11 9 8 640 11 9 7 660 11 8 7 680 10 8 7 700 10 8 7 720 10 8 6 740 9 7 6 760 9 7 6 780 9 7 6 800 9 7 6 eNaF rF ;40! No. 51737 i 0 STATE OF illilfI1 1. BASED ON 5/16' DIAMETER LAG SCREWS WITH 1-1/2' O.O. WASHERS WITH A 1-9/32' THREAD PENETRATION INTO SEASONED DRY WOOD SUPPORTING STRUCTURE. 2. PROVIDE QUANTITY OF LAG SCREWS AS REQUIRED TO MAINTAIN MAXIMUM SPACING AS SHOWN IN TABLE WITH A MINIMUM OF THREE (3) LAG SCREWS PER JAMB. LAG SCREWS AT TOP AND BOTTOM OF JAMB SHALL BE PLACED A MAXIMUM OF 6' FROM THE END OF THE JAMB. 3. LOAD PER JAMB CALCULATED BY TAKING DESIGN LOAD (PSF) TIMES DOOR WIDTH (FT) DIVIDED BY 2. EXAMPLE: DESIGN LOAD = 30psf DOOR WIDTH = 16ft LOAD PER JAMB - 30psf x 16ft/2 = 2401b/ft 4. CHART IS BASED ON 6-6' MINIMUM AND 24'-W MAXIMUM DOOR HEIGHT. S. DOOR JAMB TO BE 2x4 OR LARGER NO.2 GRADE SPF (SPECIFIC GRAVITY >-0.42) LUMBER OR BETTER MOUNTED TO SUPPORT STRUCTURE. IF MOUNTING OVER DRYWALL, INCREASE FASTENER LENGTH TO ACHIEVE MINIMUM REQUIRED PENETRATION. 6. DESIGN OF THE SUPPORT STRUCTURE SHALL BE THE SOLE RESPONSIBILITY OF THE BUILDING DESIGNER AND SHALL BE DESIGNED FOR THE JAMB LOAD LISTED IN ABOVE TABLE AS CALCULATED PER NOTE 3. 7. MINIMUM EDGE DISTANCE SHALL BE 1/2', MINIMUM FASTENER SPACING SHALL BE 1-1/2% AND ALL HOLES SHALL BE PRE -DRILLED TO PREVENT SPLITTING. 8. LAG SCREWS SHALL CONFORM TO ANSI / ASME STANDARD 818.2.1. Digitally signed by John E. Scates, P.E. Date: 2015.02.20 09:56:33-06'00' Approved John E. Scates, P.E. 3121 Fairgate Dr. Carrollton, TX 75007 FL PE 51737 TX PE 56308/1`2203 Revision P16 SCHEDULE2 16d COMMON WIRE NAILS AND 16d THREADED HARDENED -STEEL NAILS MAXIMUM NAIL SPACING PER JAMB IN MAIN SUPPORT MEMBER SPECIES SYP SPECIFIC GRAVITY - 0.55 DOUGLAS FIR SPECIFIC GRAVITY - 0.46 SPF SPECIFIC GRAVITY - 0.42 LOAD PER JAMB LB/FT "o 100 24 24 19 120 24 20 16 140 21 17 14 160 18 15 12 180 16 13 10 200 15 12 9 220 13 11 8 240 12 10 8 260 11 9 7 280 10 8 7 300 10 8 6 320 9 7 6 340 8 7 n/a 360 8 6 n/a 380 7 6 n/a 400 7 6 n/a 420 7 n/a n/a 440 6 n/a n/a 460 6 n/a n/a 480 6 n/a n/a 500 6 n/a n/a 520 n/a n/a n/a 540 n/a n/a n/a 560 n/a n/a n/a 580 n/a n/a n/a 600 n/a n/a n/a 620 n/a n/a n/a 640 n/a n/a n/a 660 n/a n/a n/a 680 n/a n/a n/a 700 n/a n/a n/a 720 n/a n/a n/a 740 n/a n/a n/a 760 n/a n/a n/a 780 n/a n/a n/a 800 n/a n/a n/a No. 51737 0 STATE OF 6 • 4(/ 0` •••;c OR1QP N . 1. BASED ON 16d COMMON WIRE NAILS (0.162"x3-1/2") OR 16d THREADED HARDENED -STEEL NAILS (0.148"x3-1/2") WITH A MINIMUM PENETRATION OF 2' INTO SIDE GRAIN OF MAIN MEMBER. 2. NAILS SHALL BE PROVIDED IN PAIRS AT A MAXIMUM SPACING AS SHOWN IN TABLE WITH A MINIMUM OF THREE (3) PAIRS OF NAILS PER JAMB. NAILS AT TOP AND BOTTOM OF JAMB SHALL BE PLACED A MAXIMUM OF 6" FROM THE END OF THE JAMB. 3. LOAD PER JAMB CALCULATED BY TAKING DESIGN LOAD (PSF) TIMES DOOR WIDTH (FT) DIVIDED BY 2. EXAMPLE: DESIGN LOAD = 30psf DOOR WIDTH = 16h LOAD PER JAMB = 30psf x 16fU2 = 240lb/ft 4. CHART IS BASED ON 6'-6' MINIMUM AND 24'-0" MAXIMUM DOOR HEIGHT. 5. DOOR JAMB TO BE 2x4 OR LARGER NO. 2 GRADE SPF (SPECIFIC GRAVITY >-0.42) LUMBER OR BETTER MOUNTED TO SUPPORT STRUCTURE. IF MOUNTING OVER DRYWALL, INCREASE FASTENER LENGTH TO ACHIEVE MINIMUM REQUIRED PENETRATION. 6. DESIGN OF THE SUPPORT STRUCTURE SHALL BE THE SOLE RESPONSIBILITY OF THE BUILDING DESIGNER AND SHALL BE DESIGNED FOR THE JAMB LOAD LISTED IN ABOVE TABLE AS CALCULATED PER NOTE 3. 7. EDGE DISTANCES, END DISTANCES AND SPACINGS SHALL BE SUFFICIENT TO PREVENT SPLITTING OF THE WOOD. Digitally signed by John E. Scates, P.E. Approved Date: 2015.02.20 09:56:58 -06'00' John E. Scates, P.E. 3121 Fairgate Dr. Carrollton, TX 75007 FL PE 51737 TX PE 56308/1`2203 Revision P16 SCHEDULE 3 3/8"0 A307 HEADED OR HOOKED ANCHOR BOLTS IN NORMAL WEIGHT CONCRETE MAXIMUM SPACING OF ANCHOR BOLTS PER JAMB (IN) LOAD PER JAMB (LB/"ore' 2000 PSI CONCRETE 2500 PSI CONCRETE 3000 PSI CONCRETE 100 24 24 24 120 24 24 24 140 24 24 24 160 24 24 24 180 24 24 24 200 24 24 24 220 24 24 24 240 24 24 24 260 24 24 24 280 24 24 24 300 24 24 24 320 24 24 24 340 24 24 24 360 23 24 24 380 22 24 24 400 20 24 24 420 19 24 24 440 19 23 24 460 18 22 24 480 17 21 24 500 16 20 24 520 16 20 24 540 15 19 23 560 14 18 22 580 14 18 21 600 13 17 20 620 13 16 20 640 13 16 19 660 12 15 19 680 12 15 18 700 11 14 17 720 11 14 17 740 11 14 16 760 11 1 13 1 16 780 10 1 13 1 16 800 10 1 13 1 15 No. 51737 0 STATE OF • 7a Oftof091- 1. BASED ON 3/8'0 A307 HEADED OR HOOKED (1.69" MIN. HOOK LENGTH) ANCHOR BOLTS WITH A 2" O.D. WASHER WITH A MINIMUM EMBEDMENT DEPTH OF 3" AND A MINIMUM EDGE DISTANCE OF 3". 2. PROVIDE QUANTITY OF ANCHOR BOLTS AS REQUIRED TO MAINTAIN MAXIMUM SPACING AS SHOWN IN TABLE WITH A MINIMUM OF THREE (3) ANCHOR BOLTS PER JAMB. ANCHOR BOLTS AT TOP AND BOTTOM OF JAMB SHALL BE PLACED A MAXIMUM OF 6" FROM THE END OF THE JAMB. 3. LOAD PER JAMB CALCULATED BY TAKING DESIGN LOAD (PSF) TIMES DOOR WIDTH (FT) DIVIDED BY 2. EXAMPLE: DESIGN LOAD = 30psf DOOR WIDTH = 16ft LOAD PER JAMB = 30psf x 161V2 = 240lb/ft 4. CHART IS BASED ON 6'-6" MINIMUM AND 24'-0" MAXIMUM DOOR HEIGHT. 5. DOOR JAMB TO BE 2x6 OR LARGER NO.2 GRADE SPF (SPECIFIC GRAVITY >=0.42) LUMBER OR BETTER MOUNTED TO SUPPORT STRUCTURE. IF MOUNTING OVER DRYWALL, INCREASE FASTENER LENGTH TO ACHIEVE MINIMUM REQUIRED PENETRATION. 6. DESIGN OF THE SUPPORT STRUCTURE SHALL BE THE SOLE RESPONSIBILITY OF THE BUILDING DESIGNER AND SHALL BE DESIGNED FOR THE JAMB LOAD LISTED IN ABOVE TABLE AS CALCULATED PER NOTE 3. Digitally signed by John E. Scates, P.E. Aooroved Date: 2015.02.20 09:57:27-06'00' John E. Scates, P.E. 3121 Fairgate Dr. Carrollton, TX 75007 FL PE 51737 TX PE 56308/F2203 Revision P16 SCHEDULE 4 3/8"0 SIMPSON TITEN HD SCREW ANCHORS MAXIMUM SPACING OF ANCHORS PER JAMB (IN) LOAD PER JAMB (LB/NOTE' 2500 PSI CONCRETENOTE I 4000 PSI CONCRETENOiE i 2000 PSI GROUT FILLED CMUNOTE 2 100 24 24 24 120 24 24 24 140 24 24 24 160 24 24 24 180 24 24 24 200 24 24 24 220 24 24 24 240 24 24 24 260 24 24 16 280 24 24 16 300 24 24 16 320 24 24 16 340 24 24 16 360 24 24 16 380 24 24 8 400 24 24 8 420 24 24 8 0 24 24 8 460 24 24 8 480 24 24 8 Soo 24 24 8 520 24 24 8 540 24 24 8 560 23 24 8 580 22 24 8 600 21 23 8 620 21 22 8 640 20 22 8 660 19 21 8 680 19 20 8 700 18 20 8 720 18 19 8 740 17 19 N/A 760 17 18 N/A 780 16 18 N/A Boo 16 17 N/A p'j'e cENaAr i No. 51737 0 STATE OF p• t'`.!c(OR10P 1. BASED ON 3/8"0 SIMPSON TITEN HD SCREW ANCHOR WITH A 1-3/4- O.D. WASHER INTO NORMAL WEIGHT UNCRACKED CONCRETE WITH A MINIMUM EMBEDMENT DEPTH OF 2-3/4' AND A MINIMUM EDGE DISTANCE OF 2-3/4". 2. BASED ON 3/8'O SIMPSON TITEN HD SCREW ANCHOR WITH A 1-3/4' O.O. WASHER INTO GROUT FILLED CMU WITH A MINIMUM EMBEDMENT DEPTH OF 2-3/4-, A MINIMUM EDGE DISTANCE OF 4% AND A MINIMUM END DISTANCE OF 4-. CONCRETE MASONRY UNITS SHALL CONFORM TO ASTM C90 AND GROUT SHALL CONFORM TO ASTM C476. 3. PROVIDE QUANTITY OF SCREW ANCHORS AS REQUIRED TO MAINTAIN MAXIMUM SPACING AS SHOWN IN TABLE WITH A MINIMUM OF THREE (3) SCREW ANCHORS PER JAMB. SCREW ANCHORS AT TOP AND BOTTOM OF JAMB SHALL BE PLACED A MAXIMUM OF 6" FROM THE END OF THE JAMB. 4. LOAD PER JAMB CALCULATED BY TAKING DESIGN LOAD (PSF) TIMES DOOR WIDTH (FT) DIVIDED BY 2. EXAMPLE: DESIGN LOAD = 30psf DOOR WIDTH = 16ft LOAD PER JAMB = 30psf x 16tV2 = 240lb/11 5. CHART IS BASED ON 6'-6' MINIMUM AND 24'-0" MAXIMUM DOOR HEIGHT. . 6. DOOR JAMB TO BE 2x6 OR LARGER NO.2 GRADE SPF (SPECIFIC GRAVITY >=0.42) LUMBER OR BETTER MOUNTED TO SUPPORT STRUCTURE. IF MOUNTING OVER DRYWALL, INCREASE FASTENER LENGTH TO ACHIEVE MINIMUM REQUIRED PENETRATION. 7. DESIGN OF THE SUPPORT STRUCTURE SHALL BE THE SOLE RESPONSIBILITY OF THE BUILDING DESIGNER AND SHALL BE DESIGNED FOR THE JAMB LOAD LISTED IN ABOVE TABLE AS CALCULATED PER NOTE 4. 8. SCREW ANCHORS SHALL BE INSTALLED PER MANUFACTURER'S WRITTEN INSTRUCTIONS. Digitally signed by John E. Scates, P.E. Aooroved Date: 2015.02.20 09:58:01 -06'00' John E. Scates, P.E. 3121 Fairgate Dr. Carrollton, TX 75007 FL PE 51737 TX PE 56308/1`2203 Revision P16 SCHEDULES 3/8"0 HILTI KWIK BOLT 3 EXPANSION ANCHOR MAXIMUM SPACING OF ANCHORS PER JAMB (IN) LOAD PER JAMB LB/FT "o "' 2500 PSI CONCRETENOTe i 4000 PSI CONCRETE"OT" 2000 PSI GROUT FILLED CMU"ore' 100 24 24 24 120 24 24 24 140 24 24 24 160 24 24 24 180 24 24 24 200 24 24 24 220 24 24 24 240 24 24 24 260 24 24 24 280 24 24 24 300 24 24 24 320 24 24 16 340 24 24 16 360 24 24 16 380 24 24 16 400 24 24 16 420 24 24 16 440 24 24 16 460 24 24 16 480 24 24 8 500 24 24 8 520 24 24 8 540 24 24 8 560 24 24 8 580 24 24 8 600 23 23 8 620 22 22 8 640 22 22 8 660 21 21 8 680 20 20 8 700 20 20 8 720 19 19 8 740 19 19 8 760 18 18 8 780 18 18 8 800 17 1 17 1 8 NaFrF'ii No. 51737 O STATE OF LORM 1. BASED ON 3/8'0 HILTI KWIK BOLT 3 EXPANSION ANCHOR WITH A 1-3/4' O.O. WASHER INTO NORMAL WEIGHT UNCRACKED CONCRETE WITH A MINIMUM EMBEDMENT DEPTH OF 2-1/2. AND A MINIMUM EDGE DISTANCE OF 3% 2. BASED ON 3/8'0 HILTI KWIK BOLT 3 EXPANSION ANCHOR WITH A 1-3/4' O.D. WASHER INTO GROUT FILLED CMU WITH A MINIMUM EMBEDMENT DEPTH OF 2-1/2- AND A MINIMUM EDGE DISTANCE OF 4'. ONLY ONE ANCHOR PER MASONRY UNIT CONCRETE MASONRY UNITS SHALL CONFORM TO ASTM C90 AND GROUT SHALL CONFORM TO ASTM C476. 3. PROVIDE QUANTITY OF ANCHORS AS REQUIRED TO MAINTAIN MAXIMUM SPACING AS SHOWN IN TABLE WITH A MINIMUM OF THREE (3) ANCHORS PER JAMB. ANCHORS AT TOP AND BOTTOM OF JAMB SHALL BE PLACED A MAXIMUM OF 6" FROM THE END OF THE JAMB. 4. LOAD PER JAMB CALCULATED BY TAKING DESIGN LOAD (PSF) TIMES DOOR WIDTH (FT) DIVIDED BY 2. EXAMPLE: DESIGN LOAD = 30psf DOOR WIDTH = 16ft LOAD PER JAMB = 30psf x 16(t/2 = 2401b/ft 5. CHART IS BASED ON 6'-6' MINIMUM AND'24'-0' MAXIMUM DOOR HEIGHT. 6. DOOR JAMB TO BE 2x6 OR LARGER NO.2 GRADE SPF (SPECIFIC GRAVITY >=0.42) LUMBER OR BETTER MOUNTED TO SUPPORT STRUCTURE. IF MOUNTING OVER DRYWALL, INCREASE FASTENER LENGTH TO ACHIEVE MINIMUM REQUIRED PENETRATION. 7. DESIGN OF THE SUPPORT STRUCTURE SHALL BE THE SOLE RESPONSIBILITY OF THE BUILDING DESIGNER AND SHALL BE DESIGNED FOR THE JAMB LOAD LISTED IN ABOVE TABLE AS CALCULATED PER NOTE 4. 8. SCREW ANCHORS SHALL BE INSTALLED PER MANUFACTURER'S WRITTEN INSTRUCTIONS. Digitally signed by John E. Scates, P.E. Approved Date: 2015.02.20 09:58:27 -06'00' John E. Scates, P.E. 3121 Fairgate Dr. Carrollton, TX 75007 FL PE S1737 TX PE 56308/F2203 Revision P16 wagnc® REVISIONS 3395 ADDISON DRIVE PENSACOLA. FLORIDA 32514 850) 474-9890 SEE DETAILS 1, 2, AND 3 REOUIRED FOR VERTICAL POST REINFORCING 1 - SYSTEMS. 6- MAX J I I— 1 1. FASTENERS PER SCHEDULES T THRU 4 MINIMUM 2.4 STRUCTURAL GRADE LUMBER FOR DOOR HEIGHT MAXIMUM ATTACHMENT TO SPACING WOOD SUBSTRATE OR MINIMUM 2.6 FOR ATTACHEMENT TO CONCRETE AND GROUT FILLED CMU, TYP. p`i'e erF iF 6- MAx 4 • DOOR WIDTH No. 51737 O STATE OF ; • Q gyp, • tv S/pNAv- 0` HEADER LOCK MINIMUM 2.8 /3MINIMUM2.6 /3 IF HEADER LOCK MINIMUM 2.8 /3 Q HEADER LOCK SOUTHERN PINE BRACKET SOUTHERN PINE BRACKET SOUTHERN PINE BRACKET LUMBER. LUMBER LUMBER. 4 8- 4- 4- 2-3/4- 4- t_1/2- 1-t/2- 2) 3/8- SIMPSON MEN HD SCREW (4) 3/8- SIMPSON TITEN HO SCREW (4) 3/B- DIA. LAC SCREWS ANCHOR WITH A 1 1/4- WASHER AND ANCHOR "TH A 1-1/4- WASHER AND WITH 1-1/4. 00. WASHERS A MINIMUM EMBEDMENT DEPTH OF A MINIMUM EMBEDMENT DEPTH OF LAC SCREWS SNAIL HAVE A DISTANCE AND A MINIM3/4' UN EDGE 2-3/4- AND A MINIMUM EDGE MINIMUM PENETRATION OF DISTANCE OF 2-3/4 • DISTANCE OF 4 1-9/32- INTOMEM ER MAIN Digitally signed by John E. Scates, P.E. SUPPORT MEMBER 0E0P1 DETAIL Date: 2015.02.20 09:58:53-06'00' MINIMUM 2505CONCREIE MINIMUM 2000 PDE9 RQ Ii fILIEO CMU NOTE. MAXIMUM DESIGN LOAD dQ3f- MAXIMUM DESIGN LOAD NOTE. MAXIMUM D SICN L AD DATE NAME OHN E SCATES. PC CAPACITY OF 2085 LBS. CAPACITY OF 2400 LBS CAPACITY OF 2430 LBS DRAWN 1 5724 07 CRT CARROLLTON, TX755007 SHEET 1 OF 2 CHECKED h PC5I n7 T. PE 563oe/F2203 DRAWING PART NO REV. aEmoN °' E a.PROVIDED An°R JAMB CONNECTION SUPPLEMENT 324620 P16 wa c® Balton 3395 ADDISON DRIVE PENSACOLA, FLORIDA 32514 850) 474-9890 QIz No. M737 0 STATE OF j,tu4 ttll O 3OOR ` p `2: Digitally signed by John E. Scates, P.E. Date: 2015.02.20 09:S9:26-06'00' JONN E SCATES. PE 3121 fAIRGATE DR CARROLLTON, TX 75007 FL PE 51737 TA PE 56300/F2203 PROFESSIONAL ENCINEEWS SEAL PROVIDED ONLY FOR KRITTCATION OF WNOLOAD CONSTRUCTION DETAILS, MIN 25W PSI CONCRETE MAX ALLOWABLE FASTENER LOAD MAY EXCEED THE DESIGN LOAD OF THE STRUCTURE. DESIGN 2 3//4' OF SUPPORTING STRUCTURE SHALL MIN EDGE D BE THE SOLE RESPONSIBILITY OF THE PROFESSIONAL OF RECORD FOR THE STRUCTURE a a 3/6. STMPSON "OS EN ND. 2-3/4' MIN EMBED. MIN 6' BETWEEN JAMB BRACKET LOCATION JAMB BRACKET 1/4-20.9/18- TRACK BOLT AND 1/4-20 HEX NU MIN 2 4 SPF (C-042) OR BETTER WALL STUD f=- MAIL ALLOWABLE FASTENER LOAD MAY EXCEED THE DESIGN LOAD OF THE STRUCTURE. DESIGN OF SUPPORTING STRUCTURE SHALL BE THE SOLE RESPONSIBILITY OF THE PROFESSIONAL OF RECORD FOR THE STRUCTURE ----\ EXTERIOR 5/18' LAC SCREW WITH 1-9/32' EMBED IN CENTER OF STUD (! 1/4-) FOR EACHJAMBBRACKETLOCATION JAMB BRACKET 1/4-20.9/16 TRACK BOLT AND // 1/4-20 HEX NU SHEET 2 OF 2 DRAWING PART NO. REV. JAMB CONNECTION SUPPLEMENT 324620 P16 The Genuine. The Origiunl. 0 April 28, 2015 Subject: ASTM A653-00 To Whom It May Concern: Overhead Door Corporation 2S01 S. State Hwy 121, Suite 200 Lorasvillo. TX 75067 Phone 469 S49 7100 Fax 4695497281 vmwoverheaddoor.com This letter is to state that ASTM A 653-00 as tested in FL 9174 meets or exceeds the requirements of ASTM A 653-06. Please feel free to contact me if you need any additional information. Sincerely, Dwayne J. Kornish P.E. FL PE 77945 Overhead Door.Corporation ASubtdia'.# aawaHowingt,Corporatlon John E. Scates, Professional Engineer June 10, 2011 Wayne -Dalton, a Division of Overhead Door Corporation 3395 Addison Dr Pensacola, FL 32514 Re: Evaluation Report for Residential Model 5140/9100/9600 family FL 09174-117 To Whom It May Concern: 3121 Fairgate Dr. Carrollton TX 75007 972) 492-9500 At the request of Wayne -Dalton, a Division of Overhead Door Corporation, I have reviewed the drawings and tests listed below. These doors were tested at an accredited laboratory according to ANSI/DASMA 108-2002 and ANSI/DASMA 115-2005 test procedures. The pressures listed on the drawings are a direct result of these tests. I have concluded that the construction shown on these drawings comply with the structural requirements of the 2007 Florida Building Code. I certify that I meet the requirements of "independence" as detailed in Florida Statute 9N-3.005. Code References 2007 Florida Building Code Section 1609 Wind Loads Section 1609.1.2 ANSI/DASMA 115 - Windborne Debris testing Section 1714.5.3.1 ANSI/DASMA 108 - Static windload testing Test Procedures Testing was conducted in accordance with ANSI/DASMA 108-2002 and 108-2005. ANSI/DASMA 108-2002 is forward compatible with ANSI/DASMA 108-2005. All tests included holding the door at design pressure for a minimum of 10 seconds, and achieving a 150% overload test" or "proof") pressure for 10 seconds. In addition, some of the doors were also tested for windborne debris according to ANSI/DASMA 115-2005. Not all windborne testing included glazing with the door panels. These are itemized in Tables 1 and 2. FL 09174-117 Test Reports ETC-06-976-17575.1, static per 108-02, dated 5/30/2006 ETC-06-976-18185.0, static per 108-02, dated 10/27/2006 ETC-06-976-19011.0, impact per 115-05, dated 4/25/2007 CTLA 1911W static 108-02 and impact 115-05, dated 10/21/2008 CTLA 1911W-3 static 108-02 and impact 115-05, dated 2/10/2009 CTLA 2020W static 108-05 and impact 115-05, dated 3/9/2010 CTLA 2020W-1 static 108-05, dated 3/9/2010 OHD/TREQ ETR 06182-2 static 108-05, dated 5/26/2011 ETC = ETC Laboratories, 297 Buell Rod, Rochester, NY Testing was conducted by ETC at Wayne -Dalton Test Facility in Pensacola, Florida. CTLA = Certified Testing Laboratories, Architectural Division, 7252 Narcoossee Rd., Orlando, FL Testing was conducted by CTLA at Wayne -Dalton Test Facility in Pensacola, Florida. OHD/TREQ = Overhead Door's TREQ facility in Dallas, TX. This facility had a current accreditation per ANSI/IEC/ISO 17025 at the time of testing, listed with International Accreditation Service, Certificate No. TL-368. Installation Instructions The drawings provide installation instructions peculiar to windload reinforcement. In addition, Drawing 307494, Rev P10, provides supplemental track assembly details. Jamb attachment: Methods of securing the door to the mounting surface is detailed in the Jamb Connection Supplement, P/N 324620, Rev P9. This Evaluation Report does not address design of the wall/jambs themselves. These drawings only illustrate common means to attach the door to the jambs. Walls and Jambs should be designed (by others) to withstand the loads imposed by door onto the building. Additional information is available in DASMA Technical Data Sheet TDS-161 at www.dasma.com. OM Drawings TABLE 1. FL 09174-117 Drawing Option Width Height psf Impact Glazing Glazing Static Impact Door Avail Impact Test Test Avail 318958 0228 9 8.75 26.9/-30.8 Yes Yes Yes 17575 19011 Rev P7 318959 0229 16 8.75 15.3/-17.0 No Yes No 17575 Rev P8 318960 0230 16 8.75 25.9/-28.8 Yes Yes Yes 17575 & 19011 Rev P10 1911W3 & ETR6182-2 318996 0231 16 8.75 30.0/-33.5 Yes No No 1911W 1911W Rev P5 318999 0232 18 8.75 12.4/-13.8 No Yes No 17575 Rev P5 319000 0233 18 8.75 18.5/-20.7 No Yes No 17575 Rev P5 319022 0234 9 8.75 43.2/-49.6 Yes Yes Yes 17575, 19011 & Rev PS 18185 & 1911W3 1911W3 319023 0235 16 8 39.2/-43.7 Yes Yes Yes 17575 & 19011 Rev P6 18185 319024 0236 18 8 30.0/-33.5 Yes Yes Yes 17575 & 19011 Rev P6 18185 379025 0237 18 8 39.2/-43.7 Yes Yes Yes 7575, 19011 & Rev P6 18185 & 1911W3 1911W3 3 "A((0/q FL 09174-117 TABLE 2. Drawing Option Width Height psf Impact Glazing Glazing Static Impact Door Avail Impact Test Test Avail 319026 0600 9 10 26.9/-30.8 No Yes No 17575 Rev P4 319027 0601 9 10 41.0/46.3 Yes Yes Yes 17575 & 2020W Rev P4 2020W 319028 0602 16 10 15.3/-17.0 No Yes No 17575 Rev P5 319029 0603 16 10 23.0/-25.0 No Yes No 17575 Rev PS 319030 0604 16 8 39.2/-43.7 Yes Yes Yes 17575 & 19011 & Rev P5 2020W 2020W 319031 0605 18 10 15.3/-17.0 No Yes No 17575 Rev P4 319032 0606 18 8 30.0/-33.5 No Yes No 17575 & Rev P6 2020W-1 319033 0607 16 8.75 25.9/-28.8 No Yes No 17575 Rev P5 319034 0608 18 8.75 18.5/-20.7 No Yes No 17575 Rev P4 379035 0609 18 8 39.2/43.7 Yes No No 17575 19011 Rev P5 4 FL 09174-117 Model Descriptions Model 5120/9100 is constructed of 30 gage, ASTM A653-00 CS Type B exterior steel skin with an ASTM A525 G-30 galvanized coating and two coats of polyester paint, a foamed in place polyurethane core, with an interior polylaminate skin, having a thickness of 1.1" for sections with a maximum height of 21" and a thickness of 1.4" for sections with a maximum height of 24". Includes foamed -in -place ribs and a stamped or flush facer design. Model 5140/9400 is constructed of 30 gage, ASTM A653-00 CS Type B exterior steel skin with an ASTM A525 G-30 galvanized coating and two coats of polyester paint, a foamed in place polyurethane core, with an interior polylaminate skin, having a thickness of 1.4" for sections with a maximum height of 24". Includes foamed -in -place ribs and a Y4" deep recessed facer panel that may use optional decorative trim. Model 9600 is constructed of 30 gage, ASTM A653-00 CS Type B exterior steel skin with an ASTM A525 G-30 galvanized coating and two coats of polyester paint, a foamed in place polyurethane core, with an interior galvanized and painted 32 gage skin, having a thickness of 1.4" for sections with a maximum height of 24". Includes foamed -in -place ribs and a stamped or flush facer design. Model 6100 is constructed of 30 gage, ASTM A653-00 CS Type B exterior steel skin with an ASTM A525 G-30 galvanized coating and two coats of polyester paint, a foamed in place polyurethane core, with an interior polylaminate skin, having a thickness of 1.4" for sections with a maximum height of 24". Includes foamed -in -place ribs and a flush facer design with W MDF decorative overlay. 5 i10 i1 FL 09174-117 Additional Limitations The drawings cited above are an explicit part of this evaluation report. The text of this report does not attempt to address all design details, but relies upon the illustrations and text of these drawings and instructions as well. Selected products within this Evaluation have been tested for Windborne Debris according to ANSI/DASMA 115. Tables 1 and 2 indicate the Windborne Debris doors by a "Yes" in the Impact Door" column. Doors with available impact glazing are also indicated in these Tables. These products are not intended for the Florida High Velocity Hurricane Zone (HVHZ). Sincerely, John E. Scates, P.E. Y Florida PE # 51737 6 3121 Fairgate Dr. Carrollton TX 75007 John E. Scates, Professional Engineer fax (972) 492-0077 1 office (972) 492-9500 February 3, 2015 Wayne -Dalton, a Division of Overhead Door Corporation 3395 Addison Dr Pensacola, FL 32514 Re: Statement of Affirmation to FBC 5`" Edition (2014) FL 09174-119 To Whom It May Concern: To the best of my knowledge, the products listed in FL 09174-119 conform to the requirements of the 5`" Edition (2014) of the Florida Building Code. I, John E. Scates, P.E., certify that I meet the requirements of "independence" as it relates to Wayne -Dalton (A Division of Overhead Door Corporation). Specifically, 1) 1 do not have, nor intend to acquire or will acquire, a financial interest in any company manufacturing or distributing these products. 2) 1 (my business) is not owned, operated or controlled by any company manufacturing or distributing these products. 3) 1 do not have nor will acquire, a financial interest in any company manufacturing or distributing products for which the reports are being issued. 4) 1 do not have, nor will acquire, a financial interest in any other entity involved in the approval process of the product. Digitally signed by John E. Scates, P.E. Date: 2015.02.03 13:32:17-06'00' John E. Scates, P.E. Florida PE q 51737 aa\ III I Illl j No. 51737 STATE OF X. ONALssi - E N 1. SHORT PANEL NON -IMPACT RESISTANT GLAZING OPTION - 090' MINIMUM SSS GLAZING IN MOLOW FRAMES SCREWED WITH A MINIMUM OF (6) J8.1' SCREWS INSTALLED IN IJ CA HORIZ ANGLE - TOPTOP OR INTERMEDIATE SECTION (WITH OR WITHOUT DECORATIVE INSERTS) MEETS UNIFORM STATIC DESIGN PRESSURES SHOWN ON THIS DRAWING GLAZING SHALL HAVE A MAXIMUM HEIGHT t3 GA MG ANGI,E• OF 13.75' AND A MAXIMUM LENGTH OF 16 75'. GLAZING IS NOT IMPACT RESISTANT AND DOES NOT MEET THE REQUIREMENTS FOR WIND-BORNE DEBRIS REGIONS 16 GA YIN HORIZ. TRACK 2. LONG PANEL NON -IMPACT RESISTANT GLAZING OPTION - 5/16.1-5/6', OWMINIMUM SSB GLAZING IN MOLDED FRAMES GLUED WITH LAG SCR A t BEAD OF BOSTIK 1100 OR EQUIVALENT UNDER THE MIN 3 AS OUTERFRAME AND SCREWED TOGETHER WITH A MINIMUM O F SHOWN) 10) 08.1' SCREWS INSTALLED W TOP OR INTERMEDIATE SECTION (WITH OR WITHOUT DECORATIVE INSERTS) MEETS 16 GA YIN VERT- UNIFORM STATIC DESIGN PRESSURES SHOWN ON US ORAWING. TRACK GLAZING SMALL HAVE A MAXIMUM HEIGHT OF 13.75' AND A MAXIMUM LENGTH OF 39'. GLAZING IS NOT IMPACT RESISTANT AND DOES NOT MEET THE REQUIREMENTS FOR WIND-BORNE S 6.t-S1 /6' LAP DEBRIS REGIONS GLAZED SECTION REQUIRES 16 CA J-STRUT SCREW AT EACH SCREWED TO LOWER INTEGRAL RIB OF SECTION AND OPERATOR JAMB BRACKET STILE TO BE FACTORY INSTALLED. INSTALLER SMALL FIELD INSTALL Lt) I/A-1A.7/B' SELF DRILLING CIMPTIIE SCREW TO 1/4-20.9/16' TRAM ATTAIN E J-STRUT TO THE INTEGRAL RIB AND OPERATOR BOLT AND 1/4-20 HEX STILE AT THE CENTERLINE OF THE DOOR PER DETAIL F ON NUT AT EACH JB JAMB SHEET 2. BRACKET LOCATION 3. IMPACT RESISTANT GLAZING OPTION - IMPACT RESISTANT GLAZING SYSTEM MAY BE INSTALLED IN TOP OR INTERMEDIATE SECTION (WITH OR WITHOUT DECORATIVE INSERTS} GLAZING SHALL BE 1/4' MAKROLON-AR POLYCARBONATE OR EQUAL. GLAZING SMALL HAVE A MAXIMUM HEIGHT Of 15.21' AND A MAXIMUM LENGTH OF 50.00'. GLAZING IS IMPACT RESISTANT AND DOES MEET THE REQUIREMENTS FOR WINO -BORNE DEBRIS REGIONS. SEE DETAIL E ON SHEET 2 FOR ASSEMBLY DETAILS GLAZED SECTION REQUIRES REINFORCEMENT BRACKETS 7ISGASTIFFENEKETDATTACHEDTOU-BAR ON UPPER INTEGRAL RIB (SEE DETAIL G JAMB BRAC AC SHEET 2). 18 GA J-STRUT SCREWED TO LOWER INTEGRAL RIB SEE SCHELO FOR OF SECTION AND OPERATOR STILE TO BE FACTORY INSTALLED. OUANI TY LOCATION. INSTALLER! SMALL FIELD INSTALL (1) 1/4-1417/6' SELF AND TYPE DRILLINGCRIMPTITESCREWTOATTACHTHEJ-STRUT TO THE INTEGRAL RIB AND OPERATOR STILE AT THE CENTERLINE OF THE DOOR PER DETAIL F ON SHEET 2. LEY LOCK OR SLIDE LOCK. VINYL OR WOOD DOOR STOP NAILED A MAXIMUM OF 6' O.C. BOTH ENDS (NOT MUST OVERLAP TOP AND BOTH ENDS OF PANELS MINIMUM REQUIRED WITH OPERATOR 7/ 16' TO MEET NEGATIVE PRESSURES. SEE NOTE 5). SLIDE LOCK SHOWN FOR 5. KEY LOCK, SUOE LOCKS, OR OPERATOR REQUIRED. CLARITY 6. SECTION SMALL BE CONSTRUCTED WITH FOAMED IN PLACE NOTE, (4) SECTION SOLO POLYURETHANE FOAM INSULATION CHEMICALLY BONDED TO 30 DOOR SHOWN. SEE SHEET GA MINIMUM FACER STEEL AND A POLYLAYINATE BACKER, 2 FOR U-BAR LOCATIONS END CAP TO HAVE A MINIMUM 1.1' DEPTH. ON DOORS WITH OTHER SECTION QUANTITIES AND 7. THE DESIGN OF THE SUPPORTING STRUCTURAL ELEMENTS SEE NOTES 1, 2, AND 3 SMALL BE THE RESPON981UTY OF THE PROFESSIONAL OF ON THIS SHEET FOR RECORD FOR THE BUILDING OR STRUCTURE AND IN GLAZING OPTIONS. ACCORDANCE WITH CURRENT BUILDING CODES FOR THE LOADS LISTED ON THIS DRAWING. 6. DOOR JAMB TO BE MINIMUM 2.6 STRUCTURAL GRADE LUMBER. REFER TO JAMB CONNECTION SUPPLEMENT FOR ATTACHMENT TO SUPPORTING STRUCTURE. 9. LOUVER OPTION - .0/0' MINIMUM LOUVERS IN MOLDED FRAMES SCREWED TOGETHER WITH A MINIMUM Of (6) /80' SCREWS INSTALLED IN THE BOTTOM SECTION. LOUVERS ARE NOT IMPACT RESISTANT AND 00 NOT MEET THE REQUIREMENTS FOR WINO -BORNE DEBRIS RECKONS LOUVERED SECTION REQUIRES OPERATOR STILE TO BE FACTORY INSTALLED AT THE CENTERLINE OF THE DOOR. JOHN E. SCATES PE 3121 FAIRGATE OR CARROLLTGN. TX 750D7 FL PE 51737 TX PE 36306/F2203 PROFESSIONAL ENGINEER'S SEAL ROI000 ONLY FOR VERIFICATION OF WINDLOAD CONSTRUCTION OETAILS E6' j TO12'-0'. JAMB BRACKET DOORT SECTIONS NO. OF JAMB BRACKETS EACH JAMB) TRACK LOUA " ON OF 'HCLINTERLINE OF JAMB BRACKETS MEASURED FROM BOTTOM Of TRACK (ALL DIMENSIONS t 2') 7'- 0' A 6 418). 13 01. 25-1 JB . 34JB. A5-t A 01, 63 JB 7'-0' 6 JB , 10 JB , 21-3 • JB , 29-3 JB • J2 JS • 63-t a JB 6'-0' S 6 JB , t3' q . 23' JB . Js' JB , s7-t s' q , 56 JB , 67 p , 75' JB 8 -0' S 8 JB , 10 JS ,21 JB ,29-3 ,B 18 JB . 57-t JB 86 JB 75-1 JB6 0 1GHLIFTOOFPITCHSEEMOTEBELOWU91L JB) FOLLOWING DIMENSION DENOTES SLOTTED JAMB BRACKET ATTACHED TO TRACK WITH 1/4-2019/16' TRACK BOLT AND NUT. p) FOLLOWING DIMENSION DENOTES QUICK INSTALL JAMB BRACKET INSTALLED IN BUTTERFLY SLOT. NO AODITONAL HARDWARE NEEDED 11D0 ATTACH TO TRACK. ALL DOORS WITH HIGH LIFT, ROOF PITON, ANO/OR GREATER THAN F IN HEIGHT REWIRE USE OF CONTINUOUS WALL ANGLE. SEE SUPPLEMENT TRACK CHART FOR OETAILS. SUPERIMPOSED DESIGN PRESSURE LOADS ON SUPPORTING STRUCTURE MAXDOOR DOOR HEIGHT UNIFORM LOAD EACH JAMB (PLF) VA OTN t6'-0' All 207.2 -230.4 ts'-0' All t6t.3 -201.6 12'-O- 1 ALL 1 +153.4-172.5 io'-O* l ALL 1 +129.5 -1As.0 Wayne onion DIVISION OF OVERHEAD DOOR C 3395 ADDISON DRIVE PENSACOLA. FLORIDA 32514 REVISIONS Ps CHANGES TO GENERAL FORMAT AND CHANGED U-BAR FASTENER TYPE AT END CAPS AND BOTTOM RETAINER. CHANGED CENTER HINGE GAUGE AND ADDEO LOUVER OPTION. CHANGED STRUT IDENTIFICATION METHOD FROM COLORED PAINT TO STAMPED NUMBER. GRT 3/ 8/06 P5 ADDED SUPERIMPOSED DESIGN PRESSURE LOADS RIFIEO NUMBER OF TENERS AND CENTER ES REQUIRED FOR ROWER DOOR WIDTHS. 1 5/ 10/06 ADDED IMPACT ISTANCE TO DOOR. ED MODEL WOO. TIERED NOTE 8 TO TE THAI LOUVERS NOTIMPACT ISTANT. 6/ 6/ 07 CKET SCHEDULE FOR OPTION. ADDED LHR CK DETAIL SWEET 2 4/17/ 08 ADDED IMPACT ISTANT GLAZING. ED TEXAS LICENSE IBER TO TITLE BLOCK. NGEO LOUVER NOTE. TEASED MAX HEIGHT 8'-9• ADDED HIGH AND ROOF PITCH CK NOTE 7/22/ 08 UPDATED TITLE BLOCK 6/26/ 10 ADDED LONG PANEL ZING OPTION 3/15/ 11 STATIC PRESSURE RATINGS I APPROVED SIZES SCALE: N.T.S. SIZE: A DESIGN (PSF): + 25.90/-28.80 IMAX WIDTH: 16'-0' 1 DATE I NAME TEST (PSF): + 38.85/-43.20 IMAX HEIGHT: 8'-9- IDRAWN 3/8/06 1 GRT IMPACT/CYCLIC RATED (YES/NO)' YES IMAX SECTION HEIGHT: 21' CHECKED 4/6/06 1 MRS MODELS 5120/ 6100/9100 SHEET 1 OF 2 DRAWING PART NO. REV. WINDLOAD SPECIFICATION OPTION CODE 0230 318960 P10 13 CA ADJUSTABLE TOP PLACE U-BAR OVER INTEGRAL RIB 13 GA ADJUSTABLE FIXTURE ATTACHED TO WITH THE (8) PRE -PUNCHED TOP FIXTURE PRE -PUNCHED HOLES HOLES EACH ENO FACING UPWARD IN BOTTOM OF U-BAR AND ATTACK THRU ENO WITH (2) 1/4-14 6/5' EACH END WITH (2) 1//4 PCRIYPTITESCREWSSELFDRILLINGCRIMPTITEFORSTANDARDTRACKA 1/4-14 7/B' SELF DRILLING CRIYPTITE SCREWS FOR LOW HEADROOM TRACK (2 OF WHICH °. ARE USED TO ATTACHED THE TOP DETAIL A BRACKET AS SHOWN). LOW HEADROOM TRACK DETAIL A 13 GA ROVER SLIDE ATTACHED TO PRE -PUNCHED HOLES IN TOP OF U-BAR PLACE U-BAR OVER INTEGRAL RIB WITH WITH (2) 1/4-14X5/8' CRIMPTIJSCRETHE 8) PRE -PINCHED HOLES EACH END USE HEWING HOLE IN SUOE TOFACING UPWARD AND ATTACH THRU ENO PROPER ALIGNMENT OF ROLLERCAP AT EACH ENO VAN (2) 1/4-14117/6' SELF DRILLING CRIMPTITE SCREWS 15 GA HINGE ATTACHED EXCEPTION. U-BAR PLACED OVER TOP WITH (4) 1/4-14 5/6'RIB ON THE BOTTOM SECTION SHALL ONLY CRIMPTITE SCREWS (2 OFBE ATTACHED THRU ENO CAP AT EACH WHICH ARE FACTORYENO WITH (1) 1/4-1401W SELF DRIWNG ATTACHED) CRIMPTITE SCREW LOCATED ON THE 80TTOM FLANGE OF THE U-BAR NOTE: DUE TO CLEARANCES REQUIRED TO 2' NYLON STORMGAROINSTALL SCREWS AT THE ENDS OF THE ROLLER WITH U-SARS, ALL U-BARS SHALL BE 4-1/2' STEM INSTALLED ON SECTIONS PRIOR TO DETAIL B INSTALLING ROLLER SLIDES AND TOP FIXTURE ON THE U-BARS SEE ATTACHMENT NOTES ON THIS SHEET. 18 GA HINGE ATTACHED PUCE U-BAR OVER ACH WITH (6) 1/4-20R5/B' CRIMPTITE SCREWS (2 OF WITHINTE($)L /4-204AT UCRIMPTITEyYS WHICH ARE FACTORY PRE -PUNCHED HOLES AT ATTACHED, 3 OF WHICH EACH INTERMEDIATE HINGE ARE FIELD INSTALLED INTO LOCATION (1 THRU FIANCE TOP LEAF, AND 1 OF OF U-BAR AND BOTTOM WHICH IS FIELD INSTALLED HINGE LEAF AND 1 THRU PRE -PUNCHED HOLE WEB OF U-BAR AND IN U-SAR DETAIL C INTEGRAL RIB OF SECTION) 12 CA BOTTOM BRACKET FACTORY ATTACHED WITHFACTORYATTACKED'° 3) 6' / CE U-BAR OVER INTEGRAL RIB WITH NOTCH DOWN TO CLEAR BOTTOMCRIMPTTE CKET AND ATTACH THRU ENO CAP EACH ENO WITH (1) 1/4-14R7/8' F OR1lUNG CRIMPTTE SCREW ASjATFORIMPACTRESISTANCE, WN AND USE (1) 1/4-14 7/8' SELF BOTTOM BRACKET MUST BE WNG CRIMPTITE SCREW ACROSS THE SCREWED TO THE BOTTOM .• BOTTOM OF THE BOTTOM U-BAR AT U-BAR WITH EACH PRE -PUNCHED HOLE AT EVERY 2) 1/4-14117/8' SELF DETAILD HINGE LOCATION. USE (1) 1/4-20XS/8' ODRIWNG CRIMPTITE SCREWS. CRIMPTITE SCREW AT ALL OTHER SEE IMPACT BOTTOM BRACKET PRE -PUNCHED HOLE LOCATIONS. DETAIL NIS SHEET. USED ONLY ON IMPACT GLAZED SECTION - 11 CA REINFORCEMENT BRACKET ATTACKED WITH (4) 1/4-14117/8' SELF DRILLING : CRIMPTITE SCREWS (2 THROUGH BOTH BRACKET AND U-BAR)) of 1 1/4-14117/8' SELF DRILLING CRIMPTITE SCREW AT CENTER LINE OF DOOR THRU J-STRUT t OPERATOR BRACKET. HQTEL J-STRUT IX SCREW ONLY REOLRREO ON LONG PANEL AND IMPACT GLAZED 08v3/4' MIN STAINLESS SCREWS WITH STAINLESS BACKEO RUBBER WASHERS 3-1/2' O.C. MAX 1/6' BEAD GEULTRACLAZE SSG4000AC I STRUCTURAL SEALANT OR EQUIVALENT FACER STEED 1 JONN E SCA TES PE NON-STRUCTURAL 3121 FAIRW IE OR. DECORATIVE INNER CAQQMMN. 17SOO7 WNDOW TRIM — FL PE 31737 lY PE 56306/F2203 PROFESSIONAL ENC'NEER'5 SEAL PROMOEO ONLY FOR VERFICAnow OF 1UNOLOAO CONSTRUCTION OETAILS DETAIL E ATTACH BOTTOM BRACKET TO BOTTOM U-BAR DRILLING G i(( OT . 1CRIMPTITE7/6' SELF ORILLRC /%A!_ CRWPTTE SCREWS 000'00" F;,loill 60-01d IMPACT BOTTOM BRACKET 5) SECTION DOORS WITH (6) Y. 18 GA. BID KSI U-SARS LOCATED OVER INTEGRAL RIBS AS SHOWN 4) SECTION DOORS WITH (S) 3', 18 CA, 60 KSI U-BARS LOCATED OVER INTEGRAL RIBS AS SHOWN _-_ DETAIL F U-BAR ATTACHMENT NOTES 1. ALL U-BARS SHALL BE PLACED OVER INTEGRAL RIBS AND ATTACHED THRU PRE -PUNCHED HOLES WITN (2) 1/4-14A5/8' CRIMPTITE SCREWS AT EACH INTERMEDIATE HINGE LOCATION, (2) 1/4-14117/8' SELF DRILLING CRIMPTITE SCREWS AT EACH ENO CAP (EXCEPT BOTH U-SARS ON BOTTOM SECTION - SEE DETAIL B AND 0 THIS SHEET). (2) 1 4-14115/8' CRIMPTITE SCREWS APPROXIMATELY MIDWAY BETWEEN ENO OF DOOR AND INTERMEDIATE HINGE LOCATION. AND (1) 1/4-14R5/8' CRIMPTITE SCREW APPROXIMATELY 6' FROM EACH ENO. FOR DOOR WIDTHS GREATER THAN 12'-0'. THERE SHALL BE A TOTAL OF (20) SCREWS ATTACHING EACH U-BAR EXCEPT BOTH U-SARS ON BOTTOM SECTION SMALL HAVE A TOTAL OF (16 SCREWS EACH. FOR DOOR WIDTHS LESS THAN OR EQUAL TO 12'-O', THERE SHALL BE A TOTAL OF (16) SCREWS ATTACHING EACH U-BAR EXCEPT BOTH U-SARS ON BOTTOM SECTION STRUCTURAL DECORATIVE SHALL HAVE A TOTAL OF (14) SCREWS EACH. t WINDOW TRIM 2. WITH THE EXCEPTION Of THE (8) PRE -PUNCHED HOLES IN THE TOP OF EACH ENO USED FOR ATTACHMENT Of THE ROLLER POLYCARBONATE SUOES AND THE (6) PRE -PUNCHED HOLES IN THE BOTTOM OF EACH ENO USED FOR THE ATTACHMENT Of THE TOP FIXTURE AND UNLESS NOTED OTHERWISE ON THIS SPECIFICATION ORAWINO, ALL PRE -PUNCHED HOLES IN ALL U-8ARS SHALL BE ATTACHED TO THE DOOR WITH 1/4-105/8' CRIMPTITE SCREWS I 3. 18 CA U-BARS SHALL BE STAMPED '46' APPROXIMATELY B' FROM EACH ENO. STAnC PRESSURE RATINGS APPROVE Wayne® DESIGN (PSF). +25.90/-28.80 MAX WIDTH: TEST (PSF): +38 85/-43 20 MAX HEIGHT: Elon IMPACT/CYCLIC RATED (YES/NO): YES MAX SECTION MODELS 5120/6100/9100 3395 ALOIN orI3 SACOLA. FLORIDA2s11 1 WINDLOAD SPECIFICATION OPTION CODE 0230 ACREVISIONS P4 CHANGES TO GENERAL FORMAL AND CHANGED J- BAR FASTENER TYPE AT ENO CAPS AND BOTTOM RETAINER CHANGED CENTER HINGE GAUGE AND ADDED LOUVER OPTION. CHANGED STRUT iOENTIFICAFION METHOD FROM COLOREO PAINT TO STAMPED NUMBER. CRT 3/8/06 PS ADDED SUPERIMPOSED DESIGN PRESSURE LOADS ON SUPPORTING STRUCTURE AND CLARIFIED NUMBER OF FASTENERS AND CENTER HINGES REQUIRED FOR NARROWER DOOR WIOTIHS, MRB 5/10/06 P6 ADDED IMPACT RESISTANCE TO DOOR. ADDED MODEL 6100. MODIFIED NOTE 8 TO STATE THAT LOUVERS ARE NOT IMPACT RESISTANT. CRT 6/6/07 P7 MOOIFEO JAMB BRACKET SCHEDULE FOR FAT OPTION. ADDED LHR TRACK DETAIL SHEET 2 CRT 4/17/08 PS ADDED IMPACT RESISTANT GLAZING ADDED TEXAS LICENSE NUMBER TO T17LE BLOCK CHANGED LOUVER NOTE INCREASED MAX HEIGHT TO 8•-9'. ADDEO HIGH LIFT AND ROOF PITCH TRACK NOTE. GRT 7/22/08 P9 UPDATED TITLE BLOCK CRT 8/26/10 PIC ADDED LONG PANEL GLAZING OPTION GRT 3/15/11 HAS SIZE. A GATE NAME i 3/8/06 CRT EO 4/6/06 MR8 SHEET 2 OF 2 DRAWING PART NO. I REV 318960 P10 14" MAX 12" MAX 12" MAX i I 12" \, i MAX 12" MAX 12" MAX CLIPS TO BE EITHER RIVETED, BOLTED, OR WELDED. SEE DETAILS THIS PAGE. JONN E. $CATES, PE 3121 FNRCATE DR CARROLLTON. TA 73007 FL PE 51737 TA PE 30300/12203 PROFESSIONAL CNCD[ER'S SEAL PROVIDED ONLY FOR VER6ICARON OF WHOLOAD CONSTRUCTION OEIAILS PLATE LOCATION HEDULE CLIP DETAIL CLIP LOCATIONS SEE SCHEDULE TRACK 13 GA MIIS CONTINUOI WALL ANG 11 GA MIN CLIP SEE SCHEDULE TYPICAL CLIP RACK 3) 1/4"-20 TRACK 3R CARRIAGE BOLT WITH 1/4"-20 NUT BOLTING DETAIL 13 GA MIN CONTINUOUS TRACKWALLANGLE 2) 1/4" X 7/16 SEMI TUBULAR RI VI TS O 1) 1/4"-20 TRACK 11 GA MIN 1 OR CARRIAGE BOLT CLIP SEE WITH 1/4"-20 NUT SCHEDULE TYPICAL CLIP RIVETING DETAIL IRS W 0.28„ 2 // II III / `. SEE SCHEDULE 11 CA MIN P 1) 1/4"-20 TRACK 13 GA MIN ff OR CARRIAGE BOLT CONTINUOUS / WITH 1/4"-20 NUT WALL ANGLEl'.. TRACK TYPICAL CLIP WELDING DETAIL DESIGN PRESSURE CHART DOOR MAX PSF WIDTH 9'-0" 46.0 PSF -52.0 PSF 16'-0" 46.0 PSF/-52.0 PSF 18'-0" 46.0 PSF/-52.0 PSF REVISIONS 2 2 INCH RACK -CUPS -TEXAS ALL ANGLE 12 FOOT PORTED P3 6/11/03 3 UPDATED FORMAT. CREASED ALLOWABLE RESSURES TO 46.00/-52 00 PSF FOR LL DOOR WIDTHS. HANGED 'TEXAS WALL NCLE' TO 'CONTINUOUS FALL ANGLE'. ADDED UBSTRATE MOUNTING ETAIL. CHANCED TO 17EN HD ANCHORS RT 4/2/07 4 CHANCED FORMAT. DDED MODELS 9800 ND 8024 WITH OVERLAY 0 TRACK CUP CHEDULE. RT 8/21/07 8 UPDATED MODELS iSTED IN CHARTS UPDATED SPLICE & CLIP CHEDULES. LP 9/06/07 6 UPDATE MOUNTING DETAIL DRAWINGS. RT 10/05/07 7 UPDATED CHARTS TO LIMINATE THE USE OF HE JYB CUP (REPLACED ATH 9 ACROSS THE OARD). LP 10/24/07 6 UPDATED STEEL IOUNTwC DETAIL IRS 04/11/08 9 EXPANDED 1-1/2' TO 3/8- DOOR THICKNESS HART UP TO 14' HIGH. RT 12/11/08 10 UPDATED TITLE LOCK RT 6/2/10 wa,® DRAWN DATE 8/21/07 NAME GRi iton CHECKED 1 8/21/07 MRS 3395 ADDISON DRIVE SHEET 1 OF 2 DRAWING PART NO. 307494 REV P10TRACKSUPPLEMENTCHARTPENACOLA. FLORIDA32514 2 3/4" t1" EDGE DIST 5/16" x 1-5/8" LAG SCREW OR EQUIVALENT INTO MIN 2 6 NO 2 MIN 3/16" THICK STEEL FOR MOUN WALL ANGLE E60XX MIN N1 8 2-24 1/8 V 2-24 SPF (G=0.42) OR _ _ _ TRACK CLIP--` BETTER AT EACH it 1/4-20x9/16" HOLE OR PAIR OF CLIP --` TRACK BOLT AND HOLE LOCATIONS 1/4-20 HEX NUT Y N/ MOUNTING TO WOOD JAMB DETAIL MOUNTING TO STEEL DETAIL 2 3/4" OPTIONAL: WALL ANGLE MAY BE MIN EDGE DIST ATTACHED TO SUPPORTING STEEL e. WITH MIN. (1) 1/4-200/8" SELF DRILLING SCREW WITH 1" O.D. WASHER AT EACH HOLE OR PAIR OF HOLE LOCATIONS IN LIEU OF WELDING a CONCRETE MOUNTING DETAIL JOHN E SCATE% PE 3121 rMRGA1E DR. CAAMLTON. IA 75007 IL PE 31737 Tx PE 56306/F2203 PROFESSIONAL ENGMERS SEAL PROM= ONLY FOR YEAOXARON OF WHDLOAO CONSIRUCTION DETAILS. 3/8" SIMPSON TITEN HD, 2-3/4" MIN EMBED INTO MIN 2000 PSI CONCRETE AT EACH HOLE OR PAIR OF HOLE LOCATIONS WALL ANGLE 1/4-20x9/16" TRACK BOLT AND 1/4-20 HEX NUT TRACK CLIP CLIP AND SPUCEPLATE MODELS 8024 8124 WITH DECATRIM OVERLAY 2-1 2 THICK DOORHEIGH CLIP #'S FROM BOTTOM TO TOP SPLICEPLATE 7'-0' 7, 9, 9, 9, 9, 11 16 8'-0' 7. 9. 9. 9. 9. 11, 11 16 9'-0' 7. 9. 9. 9. 9. 11, 11, 11 18 10'- 0" 7, 9, 9, 9, 9. 11, 11, 11, 13 18 11'- 0" 7, 9, 9, 9, 9. 11, 11, 11, 13, 13 20 12'-0' 7, 9, 9, 9, 9, 11, 11. 11, 13, 13, 13 20 13'- 0" 7, 9, 9, 9, 9, 11, 11, 11. 13, 13, 13, 13 22 14'- 0" 7, 9, 9, 9, 9, 11, 11, 11, 13, 13, 13, 13 22 MODELS 5200 8000 8024 8100 8124 8500 2 THICK DOOR HEIGHLATECLIP #'S FROM BOTTOM TO TOP SPLICE 7'-0' S, 6, 6, 7, 7, 9 12 8'-0' S, 6. 6, 7, 7, 9, 9 12 9'-0' S, 6, 6, 7, 7, 9, 9, 9 14 10'-0" 5, 6, 6, 7, 7, 9, 9, 9, 11 14 11'-0" 5, 6, 6, 7, 7, 9, 9, 9, 11, 11 16 12'-0' S, 6. 6, 7, 7, 9. 9. 9, 11. 11. 11 16 13' - 0" 5, 6, 6, 7, 7, 9, 9, 9, 11, 11. 11, 13 18 14'-0" 5, 6, 6, 7, 7, 9, 9, 9, 11. 11. 11, 13, 13 18 MODELS 6100 8300 8700 1-3/8" TO 1-5 8 THICK DOOR HEIGHT CLIP #'S FROM BOTTOM TO TOP SPLICELATE 7'-0' 4, 4, 4, 4, 5, 6 8 8'-0' 4, 4, 4, 4, 5, 6, 6 8 9'-0' 4, 4, 4, 4, 5, 6, 6, 7 8 10'-0" 4, 4, 4, 4, 5, 6, 6, 7, 7 8 11'-0" 4, 4, 4, 4, 5, 6, 6, 7, 7, 9 10 12'-0' 4, 4, 4, 4, 5, 6, 6, 7, 7, 9, 9 10 13'-0" 4, 4. 4, 4, 5, 6, 6, 7, 7. 9, 9, 9 12 14'-0' 4, 4, 4, 4, 5, 6, 6. 7, 7, 9, 9, 9, 9 12 MODELS 9100 9400 9600 9700 9800 1 THICK DOOff HEIGHT CLIP #'S FROM BOTTOM TO TOP SPLICE 7'-0' 4, 4. 4, 4, 4. 4 6 8'-0' 4, 4, 4, 4, 4, 4, 4 6 9'-0' 4, 4, 4, 4, 4, 4, 4, 4 6 10'-0" 4, 4. 4, 4, 4, 4, 4, 4, 4 6 REVISIONS 2 2 INCH LACK -CUPS -TEXAS ALL ANGLE 12 FOOT DATED J 6/11/03 T UPDATED FORMAT. CREASED ALLOWABLE TESSURES TO 46.00/-52.00 PSr FOR LL DOOR WIDTHS 4ANGED 'TEXAS WALL MCLE' TO 'CONTINUOUS ALL ANGLE'. ADDED JBSTRATE MOUNTING TAIL. CHANGED TO TEN ND ANCHORS IT ./2/07 CHANGED FORMAT. DDED MODELS 9800 ND 802• WITH OVERLAY 3 TRACK CUP HEDULE. IT 8/21/07 5 UPDATED MODELS STED IN CHARTS PRATED SPLICE h CUP HEDULES. P 9/06/07 5 UPDATE MOUNTING TAIL DRAWINGS. IT 10/05/07 7 UPDATED CHARTS TO IMINAIE THE USE Or 08 CUP (REPLACED iTH 09 ACROSS THE UPDATED STEEL UNTING DETAIL B 04/11/08 EXPANDED 1-1/2. 70 3/8- DOOR THICKNESS ART UP 10 14' RICH. T 12/11/08 3 ADDED MODEL 8700 DATED TITLE BLOCK T 6/2/10 Wayne® DATE NAME BiltOn DRAWN 8/21/07 GRT CHECKE 8/21/07 MRS SHEET 2 OF 2 3395 ADDISON DRIVE PEN 50)A474-9890325T4 DRAWING PART NO. 307494 REV P1o. TRACK SUPPLEMENT CHART Florida Building Code Online Page 1 of 3 FL A Application 'type Code Version Application Status Comments Archived Product Manufacturer Address/Phone/Emall Authorized Signature Technical Representative Address/Phone/Emall Quality Assurance Representative Address/Phone/Email Category Subcategory Compliance Method Florida Engineer or Architect Name who developed the Evaluation Report Florida License Quality Assurance EnUty Quality Assurance Contract Expiration Date Validated By Certificate of Independence Referenced Standard and Year (of Standard) Equivalence of Product Standards Certified By Sections from the Code FL1Si32-R2 Affirmation 2014 Approved MI Windows and Doors 6S0 West Market Street. Gratz, PA 17030 717)36S-3300 Ext2S60 bsttlinger®mlwd.com Brent Sltlinger bslUingerpmlwd.com Bct rlor Doors Sliding Exterior Door Assemblies Evaluation Report from a Florida Registered Architect or a Licensed Florida Professional Engineer Evaluation Report - Hardcopy Received Luls Roberta Lomas PE-62514 NaUonal Accreditation and Management Institute 12/31/201S Staves M. Urlch, PE 0 Validation Checklist - Hardmpy Received Standard X= AAMA/WDMA/CSA 101/I.S.2/A440 200S 01 affirm that there are no changes In the new Florida Building Code which affect my product(s) and my product(s) are In compliance with the new Florida Building Code. Documentation from approved Evaluation or Validation Entity UYes ONo ON/A https:llwww.floridabuildiung.orgtprlpr app dtl.aspx?param=wGEVXQwtDgtH8572gvdWI... 8/31/2015 Florida Building Code Online FLIS332 RZ COC FLIS332-COMP.odf Product Approval Method Method 1 Option O Date Submitted 04/30/201S Data Validated 04/30/2015 Data Pending FBC Approval Date Approved OS/06/201S Summery of Products Page 2 of 3 FL Is Model, Number or Name Description 1S332.1 SERIES 420 ALUMINUM SGD SERIES 420 ALUMINUM SGD OXO 14S-3/4"xSO" NON - REINFORCED Limits of Use Installation Instructions Approved for use In HVHZ: No FLIS332 R2 It 08-00500C.Qdf Approved for use outside HVHZ: Yes Verified By: Luis Roberto Lomas 62514 Impact Resistant: No Created by Independent Third Party: Yes Design Pressuroi N/A Evaluation Reports Other. REFER TO APPROVAL DOCUMENT FOR DESIGN FLIS332 R2 AE 5108078.odf PRESSURE RATINGS Created by Independent Third Party: Yes 15332.2. SERIES 420 ALUMINUM SGD SERIES 420 ALUMINUM SGD OX, XO, KX 96'x80' NON - REINFORCED Limits of Use Installation Instructions Approved for use In HVHZ: No FL1S332 R2 II 08-00498C.odf Approved for use outside HVHZ. Yes Verified By: Luis Roberto Lomas 62S14 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other. REFER TO APPROVAL DOCUMENT FOR DESIGN FLIS332 R2 AE 51080SB.odf PRESSURE RATINGS Created by Independent Third Party: Yes 15332.3 SERIES 420 ALUMINUM SGD SERIES 420 ALUMINUM SGO REINFORCED OXO REINFORCED 145-3/4'x96' Limits of Use Installation Instructions Approved for use In HVHZ: No FLIS332 R2 u o8-02248A.odf Approved for use outside HVHZ: Yes Verified By: Luis Roberto Lomas 6251.4 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other: REFER TO APPROVAL DOCUMENT FOR DESIGN FLt5332 R2 AE S12968A odf PRESSURE RATINGS Created by Independent Third Party: Yes 153332.4 SERIES 420 ALUMINUM SGD SERIES 420 ALUMINUM SGD REINFORCED OX, XO, XX REINFORCED 961x96" Limits of Use Installation Instructions Approved for use In HVHZ: No FLIS332 R2 II D8-02249A.odf Approved for use outside HVHZ: Yes Verified By: Luis Roberto Lomas 62514 Impact Resistant: No Created by IndependentThlyd Party: Yes Design Pressure: N/A Evaluation Reports Others REFER TO APPROVAL DOCUMENT FOR DESIGN FL15332 R2 AE S 12969A.odf PRESSURE RATINGS Created by Independent Third Party: Yes 15332.5 SERIES 420 ALUMINUM SGD SERIES 420 ALUMINUM SGD REINFORCED XXX 1439196' REINFORCED Limits of Use Installation instructions Approved for use In HVHZ= No FLIS332 R2 It 08-02250A.odf Approved for use outside HVIiZs Yes Verified By: Luis Roberto Lomas 62514 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other. REFER TO APPROVAL DOCUMENT FOR DESIGN FL15332 R2 AE S12970A.odf PRESSURE RATINGS Created by Independent Third Party: Yes 1S332.6 SERIES 420 REINFORCED SERIES 420 REINFORCED ALUMINUM SGD OX, XO, XX ALUMINUM SGD 96"x96' Limits of use Installation Instructions Approved for use In HVHZ: No FLIS332 R2 11 OB-00499C.odf Approved for use outside HVHZs Yes Verified By: Luis Roberto Lomas 62514 Impact Resistants No Created by Independent Third Party: Yes Design Pressures N/A Evaluation Reports Others REFER TO APPROVAL DOCUMENT FOR DESIGN FLIS332 Ram St0806B.odf PRESSURE RATINGS Created by Independent Third Party: Yes 15332.7 SERIES 420 REINFORCED SERIES 420 REINFORCED ALUMINUM SGD OXO 146'x96' ALUMINUM SGD https:llwww.floridabuilding.orglprlpi app_dtl.aspx?param=wGEVXQwtDgtH8572gvdWI... 8/31/2015 Florida Building Code Online Limits of Use Installation Instructions Approved for use In HVHZ: No F115332 R2 II OB-00SOIC.odf Approved for use outside HVHZt Yes Verified By: Luis Roberto Lomas 62514 Impact Resistance No Created by Independent Third Party: Yes Design Pressurot N/A evaluation Reports Other: REFER TO APPROVAL DOCUMENT FOR DESIGN EL15332 R2 AE S108086.ndf PRESSURE RATINGS Created by Independent Third Party: Yes Page 3 of 3 15332.8 SERIES 430/440 ALUMINUM SGD SERIES 430/440 ALUMINUM SGD XXX 143'x80' NON - REINFORCED Limits of Use Installation Instructions Approved for use in HVHZ: No Ca 15332 RZ It 08.00S02C.odf Approved for use outside HVHZ: Yes Verified By: Luis Roberto Lomas 62514 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other: REFER TO APPROVAL DOCUMENT FOR DESIGN FL15332 R2 AE 5108098.odf PRESSURE RATINGS 1 Created by Independent Third Party: Yes 1S332.9 SERIES 4301440 REINFORCED SERIES 430/440 REINFORCED ALUMINUM SGD XXX ALUMINUM SGD 143'x96' Limits of Use Installation Instructions Approved for use in HVHZ: No Fq 1S332 R2 Ii 08-OOS03C.edf Approved for use outside HVHZ: Yes Verified By., Luis Roberto Lamas 62514 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: WA Evaluation Reports Othert REFER TO APPROVAL DOCUMENT FOR DESIGN FI ±S332 RZ AE St081OB.odf PRESSURE RATINGS Created by Independent Third Party: Yes r 1940 North Momon Sbrt. Tallahassee R. 32M Phone: AS0487-1e24 The SUM of Flortda Is an ANffO employer. [oevhloht 2007-2013 state eP Florida.:: th AnrrssIbIahr statement :: Rdrehd Statement Under Roddy low, ernall addresses am public records. rf you do net want your e-mail address released M response to a pubr rOwnis request, do net and dedmnk mall to this entity. Instead, contact the ofnm by phone or by tradi0onal (mg. If you raw Any ewsuorw plaase contact SS0,437. 139S. 'Pursuant to SeRbrh 453175 jg)t Florida Statute effective October 1, 201L Iker6oas brensed under chapter 455. P.S. must provide the Departrrhent NM an ereat addren IfNoyhawone. Tho emadi provider! may be used for *"I communication wit the licantee. Howaver smell addraun are pubtk record. If you donut wish to supply a personal address, please provide the DepartrwwA with an area0 address wh Ich an be read* even" to the pubYrs To dotemhlne if you are a licensee under Chapter 4S5, F.S., pleas e0ctthZEL. Product Approval Acceptsl CrcriitSA FE https://www.floridabuilding.org/pr/pr app dtl.aspx?param--wGEVXQwtDgtH8572gvdWI... 8/31/2015 TOTES: 1. THE PRODUCT SHOWN HERON IS DESIGNED AND MANUFACTURED TO COMPLY WITH REQUIREMENTS OF THE FLORIDA BUILDING CODE 2. WOOD FRAMING AND MASONRY OPENING TO BE DESIGNED AND ANC14OREO TO PROPERLY TRANSFER ALL LOADS TO STRUCTURE. FRAMING AND MASONRY OPENING IS THE RESPONSIBILITY OF THE ARCHITECT OR ENGINEER OF RECORD. 3. 1% BUCK OVER MASONRY/CONCRETE IS OPTIONAL INHERE 1X BUCK IS NOT USED DISSIMILAR MATERIALS MUST BE SEPARATED WITH APPROVED COATING OR M048IWNE SELECTION OF COATING OR MEMBRANE 15 THc RESPONSIBILITY OF THE ARCHTECT OR ENGINEER OF RECORD. 4. ALLOWABLE STRESS INCREASE OF 1/3 WAS NOT USED IN THE DESIGN OF THE PRODUCT SHOWN HEREIN. WIND LOAD DURATION FACTOR Cd-1.6 WAS USED FOR WOOD ANCHOR CALCULATIONS. 5. FRAME MATERtAL• ERRUDED ALUMINUM 6063-T5. S. UNITS MUST BE GLAZED PER ASTM E1300-04 WITH SAFETY GLASS. 7. APPROVED IMPACT PROTECTIVE SYSTEM IS REQUIRED FOR THS PRODUCT IN WIND BORNE DEBRIS REWONS. B. SHIM AS REQUIRED AT EACH INSTALLATION ANCHOR WITH LOAD BEARING SHIM. SHIM WHERE SPACE OF 1/16. OR GREATER OCCURS. MAXIMUM ALLOWABLE SHIM STACK TO BE 1/4% 9. DOOR ASSEMBLIES INSTALLED WHERE OVERHANG RATIO IS EQUAL OR GREATER THAN 1.0 DO NOT REQUIRE WATER INFILTRATION RESISTANCE OVERHANG RATIO - OVERHANG LENGTH/OVERHANG HEIGHT 10. FOR ANCHORING INTO WOOD FRAMINo OR 2X BUCK USE #10 WOOD SCREWS WITH SUFFICIENT LENGTH TO ACHIEVE A 1 3/6- MINIMUM EMBEDMENT INTO SUBSTRATE. LOCATE ANCHORS AS SHOWN IN ELEVATIONS AND INSTALLATION DETAILS. 11. =0R ANCHORING INTO MASONRY/CONCRETE USE 3/16- TAPCONS WITH SUFFICIENT LENGTH TO.ACHIEVE A 1 1/4" MINIMUM EMBEDMENT INTO SUBSTRATE WITH 2 1/2" MINIMUM EDGE DISTANCE. LOCATE ANCHORS AS SHOWN IN ELEVATIONS AND INSTALLATION DETAILS. 12. FOR ANCHORING INTO METAL STRUCTURE USE #10 SMS OR SELF DRILLING SCREWS WITH SUFFICIENT LENGTH TO ACHIEVE 3 THREADS MINIMUM BEYOMO STRUCTURE INTERIOR WALL LOCATE ANCHORS AS SHOWN IN ELEVATIONS AND INSTALLATION DETAILS. 13. ALL FASTENERS TO BE CORROSION RESISTANT. 14. INSTALLATION ANCHORS SHALL BE INSTALLED IN ACCORDANCE WITH ANCHOR MANUFACTURER'S INSTALLATION INSTRUCTIONS AND ANCHORS SHALL NOT BE USED IN SUBSTRATES WITH STRENGTHS LESS TWIN THE MINIMUM STRENGTH SPECIFIED BELOW: A ROOD - MINIMUM SPECIFIC GRAVITY OF 0-0.42 B. CONCRETE - MINIMUM COMPRESSIVE STRENGTH OF 3.192 PSI. C. MASONRY - STRENGTH CONFORMANCE TO ASTM C-90, GRADE N. TYZE 1 (OR GREATER). 0. METAL STRUCTURE STEEL 180A. 33KSI OR ALUMINUM 6063-T5 1/8- TWCX MINIMUM 15. APPROVED CONFIGURATIONS: OX. XO. XX. XP. PX. XIP, PIX I TABLE OF CONTENTS 1 SHEET NO.1 DESCRIPTION 1 NOTES 2 — 3 1 ELEVATIONS I RN I outpi " I oat I AwRo'= 1 I A I ADDED FLANGE AND FIN PISTALLATION 112/10/13 I R„ I SIGNED: i2/162013 MI WINDOWS AND DOORS LLC \`so%%!IZf) 1001 W. CROSBY RD \\,\°. - • • . CARROLLTON, TX 75006 `••\GENa SERIES 420 SGD REINFORCED WITHOUT ADAPTER96" x 96" NOTES TAT 0 V.L. Km 08-02249 95' MAX FRAME WIDTH ANCHORS TO BE EQUALLY SPACED CHHOORS PER LOCATION SEE CFORNUMBEROFLOCATIONS REQUIRED 6- MAX r - 6' MAX I6- LAX AME IGNT L 6- MAX 6' MAX SERIES 420 SGO REINFORCED WITHOUT ADAPTER Ea FnpR VIEW DESIGNPREssuRERATWO v4pAcrRA7WG t35.0PSF Norte WI7N2•f4r SILL SEA CHARTS #1 ANO /2 FOR OTHER LWRS RA7WGS DESuiNPRESSURERATIG IAIPACTR4T7NG 25.01-2&6PSF NONE WRH 1-wSILL SEEC40RrSA4 AND I4 FOR OTHER E#M RATIOS cj"Rrff EVRH2.1mrsLu WHERE W47ERWRLTRIT70N RESISTANCE IS REQUIRED. occ.A . lucrri assign P+es wm ehaR QuB R. skloftnelvid 14 M t<+) aoA I a 2u moo I 47.0 I "W 1 QA 1 ecm Pef -9 I Pee I Nee I pw I Nee a. sy e40 40.0 " 40D 60A LD 0 40 M 4aA fQD1 410 1 31L4 u,0 4" 1 9.1 1 47.1 eca 4" 3L4 3l0 310 T 02 WRH2•Vdrsu EVUS7Z WATER WFRTR4770N RESISTANCE IS NOTREOLPrM SEE NOTE 9 SHEET 1 Dtsigrt PAR 06-9 (04 Rt shabp" V4edA 47a mo Ao Imo 490 eLo PSeo. a YSfy Poa Nev P0 N 10 el 2 4eA 7A e4 51A a]A MaeDIN eEvmola OEM WE I AFFMM ADDED nAN CE AND AN INWULATION 12/10/13 1 R.L OHARr40 vmI I.wsILL WHERE WATER WFIL7R4WNRESISTANCEISREQUIRED. r pp)0lZ 4`C701t:G1 VEj`A42R-LA0 Sam XUA z: 0 D Ee)F.. f F777 CHARre4 Wfw l-14.SxL WHERE WATER WFATRATAW RESISTANCE 5 NOTREWIRE0. SEENOTEeSHEETI GHARros Dedgn px+swn etnx(pss FNM e 70W Fifes NOW fkn Lo Mw 4" 0 1 4&0 Pos M49 Pm Ne0 Pof if Pw Noy 7D 4 D 41.7 J f 77A XI ifA eL0 eos 2 ele faA 42.9 e 2 2 2 e60 0a=eer pisnd/WFOefd.w/gW/fQ sh* hno sew Ta71F4E Few fn 4L0 4sA aaA NLS d s NLB ame Has irob EYA 4 1e e e e a e e eeA 4 e s e s a e e L0 4 1 s 1 6 1 e 6 e e e SEA 4 0 e e e e e e MI WINooWw. caosaY00 RS LLC CARROLLTON, TX 75008 51t..to//i' GHHSF9i t1-VC it96' SERIES 420 SGO REINFORCED 1VTTHOUT ADAPTER z 96' uz:ELEVATION OF ;' Fs. M.a20R10? muaFx 0110 ON aw V.L 08-02249 A NA111 \\`` HTS are 10/30/13 s wr2 OF 10 f w FF HE 95' MAX FRAME WIOTH ANCHORS TO SE EQUALLY SPACED 2) ANCHORS PER LOCATION SEE CHART 16 FOR NUMBER OF LOCATLONS REQUIRED 6' UX 6' MAX I d r I r- 6' MAX 6' AX WE GHT L 6' MAX SERIES 420 SGO REINFORCED WrrHOUT ADAPTER V(TEMR V)EW DESIONPAESSI/REAATM NPACTRATWO 135.0PSF NONE wrrH 2-1ar SILL SEE CHARTS C AND 92 SHEE7`2 FOR OTHER UNIT 5 AVINGS DESIGNPRESSURERATING WPACTR47APS 26.01-28.6PSF NONE WITH1.1/rsILL SEE C44AR7S 90AND RI SHEET 2 FOR OTHER UNITS RATINGS r ADDED FLANGE AND FIN 0WAUATION 12/10/13 1 R.L CHART06 Nmna• r OrsncAar A esOau poJiM Or& Fandseo TaUl UdUtlN OD R 0 sC0 Q.0 Q.0 1 NewGuo Ht? bRd T20 HY bm0 0 H• e bmb s ed His bma A e S e e e e e sao 1 f S a f e a e ese s s a f e e s feA a a 6 e e a a 2' L—L—J-1 2113r SILL ALUNNUM aouiTS.OssTHICK i I/r SQL AU AdWMW69-T3.assTHICK MI WINDOWS AND DOORS LLC X It. 7-0//, 1001 W. CROSBY RD `5 • • • CARROLLTON, TX 75006 W-? rAVOFSERIES 420 SGO RO' x 96 D WITHOUT ADAPTER9696' FINELEVATION :, V.L. 1 08-02249 NTS O17C 10/30/13 —3 OF 10 1/2- MIN. AL 6Id6 ar DOW~ are aneovID EDGE DISTANCE A ADDM FIANCE AND FIN INS ALL MON 12/10/13 ILL 1 3/6 MIN. WOOD FRAMING OR 2X BUCK EMBEDMENT F BY OTHERS - 1/4" MAX. 10 WOOD 0 swim SPACE EMBEDM36- EENT SHIM•MAX SPACE SCREW 1 I INTE410R 1/ 2" MIN. EDGE DISTANCE r-i 010 WOOD SCREW WOOD FRAMING OR 2X BUCK BY OTHERS OUERIOR U_U LU INTERIOR VERTICAL CROSS SECTION WOOD Fft4M1N Q OR 2YBUCK 64STALLATxw NOTES.' 1. lNiERlOR AND EXTERIOR FINISHES. BYOTNER$ NOT SHOWN FOR CURRY. 2 PERIMFIERANDJOXTSEALANT BYOTPZ:3TOBE OESRPNED 64ACCOROANCE IA4T)4ASTME2112 SILL TO BE SET IN A BED OF VLq.KEM 116 CONSTRUCTION ADHESIVE OR EQUAL EE SHEET 3 OR SILL OPTIONS MIN. ENT 10 WOOD EXTEI SCREWWOOD FRAMING JAMB BVSTALLA77ON DETAIL OR 2X BUCK WOOD FRAMN(i OR 2X SUCKWSTALLATION BY OTHERS MI WINDOWS AND DOORS LLC 1001 W. CROSBY RD CARROLLTON, TX 75005 SERIES 420 SGO REINFORCED WITHOUT ADAPTER 96, z 96" FRAME INSTALLATION DETAILS pine me l a V. L I 08-02249 WHIZ NTS IWE 10/30/13 IPW4 OF 10 St11 1i11LlO 1,, METAL STRUCTURE BY OTHERS 10 SMS OR SELF DRILLING SCREW METAL STRUCTURE BY OTHERS EXTERIOR 1 /4- MAX. SHIM SPACE 10 SMS OR SELF DRILLING SCREW INTFAIOR VEATICAL CROSS SECTION METAL S7RUGTUREA6TALLATION NOTES: Y. INTERIOR AND EXTERIOR FBJISNES BY OTHERS NOTSNOWNFORCL4R . 2 PERIMETER ANO JOINT SEALANT' BYOTNEALS TO BE DESIGNED INAOCOROANCE 4WTUASTU &ZI 1`2 L TO BE SET IN BED OF WLKEM 116 NSTRUCTION ADHESNE EQUAL SEE SHEET 3 FOR SILL OPTIONS T — 7/6" MIN. EDGE DISTANCE 110 SMS OR SELF DRILLING SCREWS METAL STRUCTURE BY OTHERS Apr ocsauvlpx TYOL uT7lWTD A I ADDEo v1ANG6 AND nN Qi muno11 1 12/10/13 F-L 1/4' MAX. SHIM SPACE INTERIOR EXTERIOR JAMB INSTALLATION DETAIL METAL STRUCTURE IN9TAUATTON Mf WINDOWS AND DOORS LLC tool W. CROSBY RO CARROLLTON, TX 75006 SERIES 420 $GO REINFORCED WITHOUT ADAPTER 96" z 96" FRAME INSTALLATION DETAILS ovlam V.L 08-02248 WAR NTS IVOE 10/30/13 —5 OF 10 2 1/Y MIN. L EDGE DISTANCE a s ' `, ; 1 1/4' MIN. a. .:. : : ' . EMBEDMENT 1 1/4' MIN. CONCRETE/ r EMBEDMENT MASONRY 1/4' MAX. BY OTHERS SHIM SPACE OPTIONAL T1XBUCK TO BE 2 1/2' PROPERLY MIN. SECURED EDGE SEE NOTE 3 DISTANCE SHEET 1 J- i3/16' TAPCON 3/16' TAPCOW MASONRY/ CONCRETE BY OTHERS 3/18- TAPCON CONCREIE/MASONRY BY OTHERS EXTERIOR WJ LL-U INTERIOR r SILL TO BE SET IN 1 CONSTRUCTION ADHESIVE OR EQUAL SEE SHEEP 3 OPTIONAL 1X BUCKFORSILLOPTIONSOPTIONALBE PROPERLY SECURED SEE NOTE 3 SHEET 1 s • . A; 1 1/4MIN. a'• . 4 ^ EMBEDMENT VERTICAL CROSS SECTION CONCRET &MASONRY INSTALLATION 2 1/ 2" MIN. EDGE DISTANCE EA I tFll Uf1 JAMB INSTALLATION DETAIL CONCRETE/MASONRYWSTAUAT) ON N01ES` 1. wnYWR AND OCTSW0R RNISNES, BYOTFfERS NOTSHoWAI FOR CIARRY. 2 PERMWTS: t ANDJgfNTSEALIMBYOTWJW TO BE DESIGNED W ACCORDANCE %TWASTII/ E2112 1/2" MIN. EDGE DISTANCE WOOD FRAMING 1 3/8' MIN. OR ZX BUCK EMBEDMENT BY OTHERS MAX. SPACE S10CREWS00 T- 1 3/8 GIN. EDGE DISTANCE I r 1 /4- UAX. SHIM SPACE 7 R 11$I@.i 0 110r1 a1>: .rRRwm ADoo FLANGE AND FIN INSIALLATION 12/10/13 R.L. rrcoino EXTERIOR U J IJJ INTERIOR U SILL TO BE SET IN MABEDOF ION AD 116 CONSTRUCTION ADHESIVE 10 WOOD OR EQUAL SCREWS 110 WOOD SCREW SEE SHEET 3 FOR SILL OPTIONS EXTE) WOOD FRAMING ok1ORDCBUCK JAMS INSTALLAT70N DE ML BY OTHERS WOOD FRAMING ypppFRANpol:ORPXB(IdCLvSTALLATtOW OR ZX BUCK BY OTHERS 3/8' MIN. EMBEDMENT VERTICAL CROSS SECTION 11210D FRAMING OR 2X HUGKWSTAL ATAON NOTES: 1. BJTERIORAND Sar891QR FW RIK 9Y OTHERS, NOT SHOWN FOR CL WW.. Y. PERfA&7Ei1 ANDJOWT SEALANT SYOTHERS TO SE DESIONED /N ACCORDANCEWW ASM E22f12 NI WINDOWS AND DOORS LLC 1001 W. CROSBY RD CARROLLTON, TX 75006 SERIES 4ZO SGD REINFORCED WITHOUT ADAPTER 96" z 96" FLANGE INSTALLATION DETAILS DRAW low ft Y.L. 08-02.249 U" NTS 1D'h 10/30/13 _ -7 OF 10 METAL STRUCTURE BY OTHERS 10 SMS OR SELF ORILLNG SCREW METAL STRUCTURE 8Y OTHERS EXTERIOR 1/4- MAX. r SHIM SPACE f10 SMS OR SELF DRILLING SCREW INTERIOR SET IN WLKEM 118 ION ADHESIVE SEE SHEET 3 FOR SILL OPTIONS VERTICAL CROSS SECTION METAL STRUC:TUAE 1NSTALLATION NOTES: I. WT8110RAND S(TERIOR ANISNES, BY 07WJM NorSHOWN FW CLWW. Y PERIMETEAANDJONTSEALAAIT HYOID TO RE DESIGNED INACCORLLWCE WTlNA$W EY117 AWS4l3 OA1e Avvlea vm A ADM FLAKE AM FIN OIS'U,LlA.TION 12/10/13 1 R.L. 1/4• MAX. SHIM SPACE 7/8' MIN. INTERIOR EDGE DISTANCE n I -- JIG SMS OR L SELF DRILLING SCREWS METAL _H STRUCTURE BY OTHERS EXT_ ERIOR JAMB INSTALLATION DETAIL METAL STIWCTUREIMSTALLATM MI WINDOWS AND DOORS LLC 1001 W. CROM RD CARROLLTON, TX 75006 SERIES d20 SGD REINFORCED WITHOUT ADAPTER 95" x 96" FLANGE INSTALLATION DETAILS OKATIM ONO m N V.L 1 03-02249 10/30/13 *W8 OF 10 Rac.a+s 2 1/z' MIN RLV o®oRrrm oae aoaovFn EDGE DISTANCE A AWM FLANGE AND RM RLSfALLAMON 12/10/13 ILL g 1 1/4" MIN. EMBEDMENT 1 CONCRETE/ ' • .a. A _ EMBEDMENT MASONRY 1/4' MAX. BY OTHERS SHIU SPACE r 1 MAX IX SUCK r SHIM4•SPACETOBE21/2" ' INTERIOR PROPERLY MIN. ` 1 SECURED EDGE SEE NOTE 3 DISTANCE ' SHEET 1 3/18' TAPCON Fill 3/16" TAPCON CONCREIE/MASONRY BY OTHERS EXMRIOR INTERIOR SILL TO BE SET IN :a A BED OF VULKEM 116 DCrEAIOR CONSTRUCTION ADHESIVE 3/16- TAPCON OR EQUAL SEE SHEET 3 JAMB INSTALLATION DETAIL MASONRY/l i R FOR SILL OPTIONS OPTIONAL 1K BUCK COMCRETEMASON:IYINSTALLATION CONCRETE • TO BE PROP SECUREDOTHERSSECURED SEE NOTE 3 SHEET 1 NOTES 1 . h 1 1/4" MIN. 1.NTS70RAND 0ffERIORfaJfSR&%6YOTHERA a: ; . • EMBmuFNf ORCILARrTY EMRAAAADJOA? BYOTNERSTOSE t'^ . • . OESIGAW DYACCORDANCE MMASTME211P 2 1/2" MIN. EDGE DISTANCE VERTICAL CROSS SECTION MI WINDOWS AND DOORS LLC ,U11I1UYYI/ 1COwGRb' H>+(SONAY Al1.RJ10N! 1001 W. R TONCTX75006 \g 6EN3SERIFS 420 SGD REINFORCED WITHOUT ADAPTER *• 0 6 9x 96' FIANCE INSTALLATION DETAILS zp TAT OF oAana an NIL v.t_ 0849 A IWX 1O/ 30/13 10=9 OF 10 WOOD FRAMING BY OTHERS 1 1/4' MIN. EMBEDMENT T-- IB WOOD — SCREW 7/16" MIN EDGE DISTANCE 1/4" MAX I SHIM SPACE JAMB INSTALLATION DETAIL WOOO FRAMING OR 2X SUCK INSTALLATTOY ADDED FLANGE AND FW INWAUATION 12/ID/13 R.L. 1 5/8" MIN. EDGE GIST. TRIM INTERIOR MASONRY/CONCRETE BY OTHERS HOOK STRIP ---- e 1 1 /4" MIN. EMBEDMENT T 1X BUCK BY OTHERS. 1X BUCK TO BE PROPERLY SECURED 3/16" EXTERIOR `PANEL INTERLOCK HOOK STRIP INSTALLATION MASOVRYX4Mr-RETE 1 1/4" MIN. METAL STRUCTURE EMBEDMENT BY OTHERS is W000 WOOD SCREW BYOTHERS 1MgRIOR TRIM ING TRIM 1/4" MAX. 1 3/8, MIN. j SHIM SPACE EMBEDMENT INTERIOR 7/16" MIN rIEDGEDISTANCE HOOK STRIP HOOK STRIP S10 WOOD S10 SELF DRILLING SCREW a SCREW PANEL EXTERIOR PANEL INTERLOCK EXTERIOR INTERRLOCK EXTERIOR INTERIOR HOOK STRIP INSTALLA77ON HOOK STRIP INSTALLATION 2X eUCXiwOOD FRAMING METAL STRUCTURE 0RS LLCMIWlNooww. 0 ii VER71G4LCROSS SECTION Y cRoseY0RDCARROLLTON. TX 75006 No' - Pay K000FR4MWGORUSUCITPSTALLITION CEFUR SILL INSTALL1T10NSEESHEE7S44 SERIES 420 SOD REINFORCED WITHOUT ADAPTER R' it=_ 0XOPF T. INTERIORANDOfTEIVORRNISHES, 8YOTHERS,C 96" z96• NAILFIN & HOOK INSTALLATION DETAILS ak7-07 1 xOTSHOWNFLTRCLIRlT1 2. PESIGAIF. DINA HCCORAANCEtAE2ERSTOBE G ,mow OUgTy 0wc w pASS%(ORl O 08-02249 EI G`` ONA swcas air NTS 10/30/13 IO OF 10 R!NS0'6 1/2' MIN. Lov6 •rvrtwm EDGE OISTANCE A AOOED CHARTS 03/06/12 R.L 8 REVISED PER NDN TFSRN6 10/15/13 RL 1 3/6' MIN. C AWED FLANGE INSTAUATIONS tuns/13 fLL WOOD FRAMNG EMBE ENT OR 2X BUCK (. BY HERS 1 3/8' MIN. 1/4' MAX. EMBEDMENT r SHIM SPACE MAIL SFJM INTERIOR SPACE 1 2 MIN. tOSCRREWOOD EDCE DISTANCE a0 EXTERIOR INTERIOR 10 WOOD SCREW a SILL TO BE SET IN 010 WOOD A BED OF D116 SCREW CONSTRUCTION ADHESIVE OR EQUAL SEE SHEET 2 EXTERIOR FORSILLOPTIONSWOOD FRAMING OR 2X BUCK WOOD FRAMING JAMB INSTALLATION DETAIL BY OTHERS OR 2X BUCK WOOD r-RSARNGORZKOUCKINSTALLATIONBY OTHERS 1 3/8' MIN. 04SOMENT VERTICAL CROSS SECTION W000 FRANWQORYX 8UCKn0TAU AIICW MI WfNooWw. AND YOOoS LLC \`````gu tllto,i CARROLLTON. TX 75006 `J b\ GBMet`, SERIES 430/"0 XIX SGD *• r NOTE& 143' x 96" REINFORCED 1. INTERJORAND E7C MORFWJSNES,BYOTNER$ FRAME INSTAU.TION DETAILS 0 TAT OP 20T SWVW Faq CLARITY. PMMETERANO NTSEALANTBYOThWSTOBE DRUM ow m 08-00503 DESfGNEDINACCOROAAICEINTNASTNEV12 NTS — 02 23/09 —3 Of 9 /JI111111 METAL STRUCTURE BY OTHERS 10 SMS OR SELF DRILLING SCREW I METAL STRUCTURE BY OTHERS EXTERIOR VERTICAL CROSS SECTION METAL STRUCTURE INSTALLATION 11 MIEAIOAANDEM9ilORRWSHE4 BYOTNEAS NOT SHOWN FOR CL4R11Y. I PEAIMETERAND JAONNT SEALANT BYOTF1EiRS TO SE DESIGNFD NN ACCORDANCEWTNASTN F2112 1 /4' MAIL SHIM SPACE 10 SMS OR SELF DRILLING SCREW INTERIOR 7/8, MIN. EDGE DISTANCE 10 SMS OR SELF DRILLING SCREWS 08ESETIN OF VULKEM 116 RUCTION ADHESIVE IUAL METAL STRUCTURE SEE SHEET 2 BY OTHERS FOR SILL OPTIONS 1 /4V MAX. SHIM SPACE INTERIOR EXTERIOR s w oFsePWTon are A"ntw G A ADDED CW I S 03/00/12 R.L B REVISED PER NEW T=NG 10/13/13 0.L G ADDED FLANGE INSTALLATIONS I2/0E/13 RL J JAMB INSTAUATION DETAIL METAL STAU TIARE OCTALLATTON Ml WINDOWS AND DOORS LLC 1001 W. CROSBY RO CARROLLTON, TX 75006 SERIES 430/440 XIX SGO 143" x 96" REINFORCED FRAME INSTALLATION DETAILS mtuft ova mm F.A. 1 08-00503 WAZ NTS °pE 02 23/09 --4 OF 9 Redsve 2 1/2' MIL 1av 6tsalvaan ale AfNE01fD EDGE DISTANCE A ADDED 01ARt3 I RL 8 Rnmo POt NEW TESIIItt1 10/15/13 RL t 1 1/4' MIN. C ADDED ANTE INFC&1A110NS 17/06/13 IRA e' S EMBEDMENT 1 1/4' MIN. 1/4' MAX. EMBEDMENT r SHIM SPACE CONCRETE/ IMASONRY •+ : . BY OTHERS 2 1/2' MIN. OPTIONAL EDGE DISTANCE : •` .. a1XSUCK INTERIOR a TO BE 1/4' MAX. o PROPERLY SHIM SPACE 3/1 S' TAPCON : SECURED" 3 , aSEENOTE3 SHEET 1 3/16' TAPCON CONCRETE ASONRY OTHERS EXTERIOR INTERIOR SILL TO BE SET IN EXTERIOR A BED OF WL1D:M 116 3/18' TAPCON CONSTRUCTION ADHESIVE OR EQUAL ,IAMB INSTALLATION DETAIL SEE SHEET 2 OPTIONAL 1% SUCK CONCRE7EMASON(RYINSTALLAT70N FOR SILL OPTIONS TO BE PROPERLY MASONRY/ SECURED CONCRETE SEE NOTE 3 SHEET 1 BY OTHERS s b • •! 1 1 /4' MIN. 1. QVTMon AND SRFRIOR RA Sf(ES, BY OTHERS EMBEDMENT NOTSHOWNFOR CLAR/TY. _ r f` .. .. OESCE/1?THTASTM@f Yl STOBE Q: VERTICAL CROSS SECTION IRYINSI' ALLATION 2 1/2' MIN. EDGE DISTANCE MI WINDOWS AND DOORS LLC 10"""Ilfil, 1001 W. CROSBY RD CARROLLTON, TX 75006 tir,•y CENSF.,d' 0 5 9<_ SERIES430/440 XIX SGID 143' x 98' REINFORCED FRAME INSTALLATION DETAILS ig. TA OF ;,Z F. A. 0S-00503 C /%S ONA Dews NTS—.02/23 09 —5 OF 9 MOOD FRAMING IOR 2X BUCK BY OTHERS p0 WOOD SCREW EXTERIOR 10 WOOD SCREW WOOD FRAMING OR 2X BUCK BY OTHERS 1/2" MIN. EDGE DISTANCE C 1 3/8' MIN. 1 3/8, MIN. 7,lmlAxe EMBEDMENT SHIM T— SPACE 1/2' MIN. EDGE DISTANCE INTERIOR VERTICAL CROSS SECTION WOOO FRL4VG OR 2X 8UdCINSTAUAITON NOTES. 1. rNT6TIORANO EXTERIOR FINISH % BY OTHERS, NOT SHOWN FOR CCARFIY. 2. PERIUET FIFT AND"VTSEV.ANT BYOTHERSTO BE 06943WO INA000ROANCE WITHA S ME2112 10 WOOD SCREW SILL TO BE SET IN A BED OF VULKEM 116 CONSTRUCTION ADHESIVE OR EQUAL SEE SHEET 2 FOR SILL OPTIONS WOOD FRAMING 1 OR 2X BUCK BY OTHERS 1 3/3' MIN. EMBEDMENT Rpt9R6 REV oEsa+wRw WE APPRMW A ADDED CHARTS 03/06/12 R.L. S RENSED PER NEW TE6T6(G 10/15/13 RL C ADDED FLANGE INSTALLATIONS 12/06/13 R.L. 1/4' MAX. F SHIM SPAC'c INTERIOR EXTERIOR JAMB INSTALLATION DETAIL WOOD FRAMING OR 2X 8UOX INSTALLATION MI WINDOWS AND DOORS LLC 1001 W. CROSBY RD CARROLLTON, TX 75006 SERIES 430/"0 XIX SGD 143" x 96' REINFORCED FLANGE INSTALLATION DETAILS DUM ONO ND. F.A. 08-00503 PME NTS — 02/23/09 —6 OF 9 ttuur o 6z11\JNS tZ - - NGENS* •a rVv . METAL STRUCTURE BY OTHERS 010 SMS OR SELF DRILLING SCREW META. STRUCTURE BY OTHERS VERTICAL CROSS SEC7)ON AL bTR(/CT1/RE 6vsrALL4TYoN NOTES: T. !NT ERIORAND EXTERIOR Frimea BYOTNERA NOT 8WK V FOR CLAWiY. 2 PERmerERANDJOWrSEALANT BYOTNPR$ rO BE DEB/ONED INACCORDANCEWflNASM E211P 1 /4' MAX. SHIM SPACE OR 7/8- MIN. LUNG EDGE DISTANCE T- 10 SMS OR SELF NG SRCREWS 0 BE SET IN OF VUU(EM 116 RUCTION ADHESIVE IUAL METAL STRUCTURE BY OTHERS SEE SHEET 2 FOR SILL OPTIONS RtV acpmw m DATE uaaauEa A ADDED CNAR15 03/06/12 RA- 0 RCVM PER NET TES M 10/13/13 R1.. C ADDED R 4GE INSTALLATIONS 12/06/13 RL. 1/4' MAX r SHIM SPACE INFERIOR a a EXTERIOR JAMB INSTALLATION DETAIL METAL BTRUCITIRElAIS7ALLAr1QV Ml WINDOWS AND DOORS LLC 1001 W. CROSBY RD CARROLLTON, TX 75006 SERIES 430/4 O XIX SOD 143' x 96' REINFORCED FLANGE INSTALLATION DETAILS OMrx: ma in F.A. 08-00503 NTS 1— 02/23/09 JVW7 OF 9 W-TviOF 2 1/2' MIN. CCONCRETE/ EDGE DISTANCE MASONRY BY OTHERS t •' 1 1/4' MLA. EMBEDMENT 1 1/4• MIN. a; EMBEDMENT OPTIONAL 2 I/2' MIN. IX BUCK EDGE DISTANCE TO 8E PROPERLY 1/4' MAX. SECURED X NOTE 3 SHIN SPACE 3/16' TAPCONSHEET1 3/16- TAPCON CONCRETE/MASONRY . EXTERIOR INTERIOR BY OTHERS 3/16• TAPCON SILL TO BE SET IN A BED OF WLKEM 116 CONISTRUCi1ON ADHESVE OR EOUAL SEE SHEET 2 FOR SILL OPTIONS MASONRY/ CONCRETE BY OTHERs i ".. 1 1/4' MIN. EMBEDMENT VERTICAL CROSS SECTION 2 1/2' MIN. CONCRTErrMASONRYWSTALLATION EDGE DISTANCE 1 /4- MAX. SHIM SPACE INTERIOR RENIM REY ,fml osle WROVED A -DOER CHARTS 03/06/12 R.L EI REVISED PER NEW TESTING 10/15/13 RA- C ADDED FIANCE INWALIATRNIS 12/06/13 1 P-L EXTERIOR OPTIONAL 1X BUCK JAMB INSTALLATION DETAIL TO BE PROPERLY ooNCRE/FJMASONRYOVSTALATKW SECURED SEE NOTE 3 SHEET 1 NOTES: T. INTERYOR AND EXTERIOR RNTSHE$ BY OTHERS, NorSNoWN FOR OIARITY. P. PERAIETERANOJOOVTSEAL1NrBYOTHERSTOHE DESRONED W ACOOROANCE W?NASTM 62112 All WINDOWS AND DOORS LLC LRp ii 1001 W. CROSBY RO CARROLLTON. TX 75006 X611R N,-•• . VSC•ENSt.gd SERIES 430/"0 XIX SGD o 143" x 95" REINFORCED O FLANGE INSTALLATION DETAILS E OF ; ORACb one N0. 08-00503 RN FSSORIaG\ dAfAL'IF scat NTS °QE 02 23/09 —B OF 9 1 5/6' MIN. EDGE DIST. TRIM INTERIOR MASONRY/CONCRETE — 6Y OTHERS HOOK STRIP 1 1 MIN. EMBEDMENT IX SUCK BY OTHERS. BUCK To BE• PRPROPERLY SECURED 3/l6' EXTERIOR _J) _— PANEL INTERLOCK HOOK STRIP INSTALLA77ON MASONRYMONCRETE INTERIOR TRIM _", : E I 1 3/6' MIN. EMBEDMENT HOOK STRIP j10 WOOD SCREW EXTERIOR ---PANEL INTERLOCK HOOK STRIP INSTALLATION V(BUG70W000 FRAMWO rzvtwm Wv oampw we wasv® A ADDED CHARTS 03/06/12 RA. 6 NEVm PER NEW TCSIWC 10/15/13 R.L. C ADDED FLANGE INSTALLATIONS 12/06/13 RL METAL STRUCTURE BY OTHERS TRIM INTERIOR HOOK STRIP @10 SELF DRILLING SCREW PANEL EXTERIOR INTERLOCK HOOKSTRIP INSTALLATION AlETAL STRUCTURE NOTES 1. ffnV RIORANDOMMORF6WSNE$ BYOTHER$ NOTSHOWNFORCLAW". Z PERIMETERANO. oNrSEALANTBYOTHERS TOBE OESIONED INAcooRDANCE WITHASTM EV 12 MI WINDOWS AND -DOORS LLC 1o01 W. CROSSY RD CARROLLTON. TX 75006 SERIES 43014Q XIX SOD 143' x 96' REINFORCED HOOK INSTALLATION DETAILS MAW oxo xo. F, A, 06-00503 NNE N75 DAM 0I/23/09 sllw9. OF 9 Florida Building Code Online Page 1 of 3 p Depiftentd acts Home I tou to I user P*QWMtlon i Hot Topics I suhMt Surcharge I Stats a Facts { Publhcations I FBc Stag I eas Ste Map I unla I Search Buslnes; OMProduct ApprovalProessirYaUSBR:PuhicUsvRegulation Product Aoerovah Menu > Pradud or AmlkaUon Seam > Aoollntlen Ug > Application Ootall FL # FUS000-112 Application Type Revision Code Version 2014 Application Status Approved Comments Archived C.3 Product Manufacturer Therma-Tru Corporation Address/Phone/Email 118 Industrial Drive Edgerton, OH 43517 419) 298-1740 rlckw@rwbldgeonsultants.com Authorized Signature Vivian Wright rickw@rwbidgconsultants.00m Technical Representative Address/Phone/Email Quality Assurance Representative Address/Phone/Email Category Exterior Doors Subcategory Swinging Exterior Door Assemblies Compliance Method Evaluation Report from a Florida Registered Architect or a licensed Florida Professional Engineer G3 Evaluation Report - Hardcopy Received Florida Engineer or Architect Name who developed Lyndon F. Schmidt, P.E. the Evaluation Report Florida license PE-43409 Quality Assurance Entity National Accreditation and Management Institute Quality Assurance Contract Expiration Date 12/31/2018 Validated By Ryan 1. King, P.E. @ Validation Checklist - Hardcopy Received Certificate of Independence FL1S000 R2 COI Certificate Of Indeoendence.odf Referenced Standard and Year (of Standard) Standard Year AAMA/WDMA/CSA301/I.S.2/A440 2005 ASTM D1929 1996 ASTM D2843 1999 ASTM D63S 2003 ASTM E1300 1998 ASTM E84 2000 ASTM G26 199S TAS 202 1994 Equivalence of Product Standards Certified By Florida Licensed Professional Engineer or Archltect FL15000 R2 Eauly FL - 1S000 Eoulv of Standards.odf https://www.floridabuilding.orglprlpr_app dtl.aspx?param=wGEVXQwtDquS73Fr2ZyiPo... 8/31/2015 Florida Building Code Online Page 2 of 3 Sections from the Code Product Approval Method Method 1 Option D Date Submitted 05/29/2015 Date Validated 06/28/2015 Date Pending FBC Approval 07/OS/2015 Date Approved 08/19/2015 Summary of Products FL ax I Model, Number or Name Description 15000.1 a. "Fiber -Classic' or "Smooth -Star" 6'8 'Non -Impact" Opaque Fiberglass Door with & without Sldelite(s) - Outswing (X, OX or XO, OXO, )X, OXXO Configurations) Llmks of Use Installation Instructions Approved for use In HVHZ: Yes FL15000 R2 [I [NST 15000.1.odf Approved for use outside HVHZ: Yes Verified By: Lyndon F. Schmidt, P.E. 43409 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other: See INST 15000.1 for Design Pressure Ratings, any FL15000 R2 AE EVAL i5000.1.0df additional use limitations, Installation Instructions and Created by Independent Third Party: Yes product particulars. (This product approval requires the use of 7' part number doors and sidelltes, which have been stained or painted within 6 months of Installation.) 15000.2 or "Smooth -Star" 6'8 "Non -Impact" Opaque Fiberglass Door with & withoutrFiber-Classic" Sidelite(s) - Inswing (X, OX or XO, OXO, XX, OXXO Configurations) Limits of Use Installation Instructions Approved for use In HVHZ: Yes FL15000 R2 II INST 15000.2.odf Approved for use outside HVHZ: Yes Verified By: Lyndon F. Schmidt, P.E. 43409 Impact Resistant: No Created by Independent Third Parry: Yes Design Pressure: N/A Evaluation Reports Other: See INST 15000.2 for Design Pressure Ratings, any FLI5000 R2 AE EVAL 15000.2.odf additional use limitations, Installation Instructions and Created by Independent Third Party: Yes product particulars. (This product approval requires the use of "I" part number doors and sldelites, which have been stained or painted within 6 months of Installation.) 15000.3 c. 'Fiber -Classic" or "Smooth -Star" 8'0 "Non -Impact' Opaque Fiberglass Door with & without Sidelite(s) - Outswing (X, OX or XO, OXO, XX, OXXO Configurations) Limits of Use Installation Instructions Approved for use In HVHZ: Yes EL15000 R2 11 INST 15000.3.odf Approved for use outside HVHZ: Yes Verified By: Lyndon F. Schmidt, P.E. 43409 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other: See INST 15000.3 for Design Pressure Ratings, any ELIS000 R2 AE EVAL 15000.3.0df additional use limitations, Installation Instructions and Created by Independent Third Party: Yes product particulars. (This product approval requires the use of "I" part number doors and sldelites, which have been stained or painted within 6 months of Installation) 15000.4 d. "Fiber -Classic" or "Smooth -Star" 8'0 'Non -Impact" Opaque Fiberglass Door with & without Sidelite(s) - Inswing (X, OX or XO, OXO, XX, OXXO Configurations) Limits of Use Installation Instructions Approved for use in HVHZ: Yes FLIS000 R2 II INST 15000.4.odf Approved for use outside HVHZ: Yes Verified By: Lyndon F. Schmidt, P.E. 43409 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other: See INST 15000.4 for Design Pressure Ratings, any FLIS000 R2 AE EVAL 15000.4.0df additional use limitations, Installation Instructions and Created by Independent Third Party: Yes product particulars. (This product approval requires the use of'I" part number doors and sidelites, which have been stained or painted within 6 months of Installation.) 15000.5 e. "Flber-Classlc' or "Smooth -Star' 8'0'Non-Impact" Glazed Double Flberg lass Door - Outswing Inswing (XX Configurations) https://www.floridabuilding.oriz/i3r/pr app_dtl.aspx?param=wGEVXQwtDquS73Fr2ZyiPo... 8/31/2015 Florida Building Code Online Page 3 of 3 Limits of Use Installation Instructions Approved for use in HVHZ: Yes FL1S000 R2 tl INST 15000.5.odf Approved for use outside HVHZ: Yes Verined By: Lyndon F. Schmidt, P.E. 43409 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other: See INST 15000.5 for Design Pressure Ratings, any FL15000 R2 AE EVAL 15000.5.0df additional use limitations, Installation Instructions and Created by Independent Third Party: Yes product particulars. (This product approval requires the use of'7" part number doors, which have been stained or painted within 6 months of Installation.) 15000.6 f. "Flber-Classic" or 'Smooth -Star" 6'8'Non-Impact' Center Hinged Glazed Fiberglass Double Door - Inswing (OX or XO Configurations) Limits of Use Installation Instructions Approved for use In HVHZ: Yes FL15000 R2 II INST 1S000.6.odf Approved for use outside HVHZ: Yes Verified By: Lyndon F. Schmidt, P.E. 43409 Impact Resistant: No Created by Independent Third Party: Yes Design Pressure: N/A Evaluation Reports Other: See INST 15000.6 for Design Pressure Ratings, any FL15000 R2 AE EVAL 15000.6.odP additional use limitations, Installation Instructions and Created by Independent Third Party: Yes product particulars. (This product approval requires the use of "]" part number doors, which have been stained or painted within 6 months of Installation.) Fa`--] PER tantart us :: I= North MontaitStMeLlallshassee FL 32399 Phone: 8504a7-1824 The State of Florida Is an AAICEO employer. copyright 2007-2013 Sated Florida.:: Privacy Statement :: Actesslblaty Statement :: Rend SUbement Under Florida saw. snail addresses are public records. If you do not want your a -mail address released In response to a public -records request do not send ele nic mall to this amlty. Instead, contact the office try phone or by traditional map, 1f you have any questions, please contact eS0.467.1395. *Pursuant to Section 455.275(1), Florida Statutes, effective October 1, 2012, licensees named under Chapter 45S, F.S. must provide the Department with an small address If they have one. The emal6 provided may be used for official communication with the tceiLwa. However email addresses are public record. It you do not wish to supply a personal address, please provide the Department with an email address which an be made available to the public. To debermine If you are a licensee under Chapter 455, P.S., please dick bW-. Product Approval Accepts: Credit0s, r E https://www.floridabuilding.orglpr/pr app_dtl.aspx?param=wGEVXQwtDquS73Fr2ZyiPo... 8/31/2015 IHERMAITRU' o THERMA TRU DOORS 1 IS INDUFMIAL DR.. ED60RON. 014 43517 FIBER CLASSIC" / "SMOOTH STAR" 8'0 OUTSWING w/ & WOUT SIDELITES FIBERGLASS DOOR GlWEI l NOTES 1. This product has been evaluated and is in compliance with the 5Ih Edition (20141 Rondo Buidng Code FBC) structural regAwwts bdudng the Ugh Velocity Hurriccm Zone NMI. Z Product anchors shall be as listed and spaced as shown on detak Anchor embedment to base material shall be beyond wall dmss!r g or stucco. 3. When used in the IlYHr this product Is required to be protected with an Impact resistant covering that compiles with Section 1626 of the FBC. 4. When used in areas outside of the 1tVIC mquiirtg wind borne debris protection this product Is required to be protected with on Impact resistant covering that c omp0es wllh Section 1d09.1.2 of the FBC. 5. For 2rc stud fromhlg construction, anchoring of these unit shall be the some as that shown for 2x buck masonry construction. 6. Site conditions that deviate from the details of It& drawing require further erQheerbV analysis by a licensed engineer or registered a ctulect. 7. Outswing configurctions using coastal A Hem #39 under active doors, and oil silt used under inactive doors, meet water infiltration requirement for'1iVHr. tl. Outswing configurations using A hem # 19 under the door do not meet the water infiltration requirement; for the IfVHr and shall be installed only In non -habitable areas or at habitable locatbm protected by an overhang or canopy such that the angle between the edge of campy or overhang to A is fez than 45 degrees TABLE OF COMM 1 fticd efevdbm deslan pron m & Cm wd dotes 2 Doorpwwl detch 3 pond am= Classic 4 Siam MCM&Ommgdelm S vemm aSseewft 6 Haftic dCaD l;Ctbta T HOthMWCaareClbM e nutk 9 Bane t0 nmlealcllodng 11 AQCWOUM 12 m d mDlerbtt a Caaponenh 37.W MAX OV9UAl wmlH 5 I"MAX 17V6tA11 titMAE { F S D d DOUBLE W/SrOELriF'S OLIMMNG UNR 74M MAX OVO ALL r 5 ii "WIDM D SEE i'k ESfGNiCJt fJ H+ Cf`1F 7 J:Y::I v` D Vkrsl:?.r ej.0.A 2R WIIlSilB C_ X 1i3s'itxt SINGLE 67.0 67.0 71 DOUBLE 47.0 47.0 60.0 60.0 SINGLE 3 DOUBLE 47.0 47.0 60.0 WITH SIDEUIES iK be IS%``` f... ... Z. Ile a a i`j a tllltl V %,W, Ospa.: x. FL-15000.3 Tr 1 or 12 55 1A 56 CMRIOR in its N. A 36WMAX FDOOR INTERIOR PANEL VADIN I"\ HORIZONTAL CROSS SECTION 1113 DOOR PANEL 14mr D3W ed 1.549 MERIO o all lit ag 55 LATCH STILETOP PRAIL Sl_DWNSTAR &( SMOOTHSTAR) Ln DOOR PANEL Smooth Star I.W R L" R LM ImDIM 02/ 24/12 56 HIKE Sub N.T.S. STILE 0MIVER77CALCROSSSECTIONSMOOTHS &!(SM_ THSrAR) 2 DOOR PANEL DTH STAR) on or. jK CHL W. US FL— 15000. 3 0n I. 2or120 EXTERIOR3 2 ul FA INTERIOR m 36.0(rMAX DOOR f—l"\ HORIZONTAL CROSS SECTION PANELMM k,jDOOR PANEL A: 4. 0= IAS' 1310i- V— INTERIOR Ed LATCH STILE —TOP "L naER CLASSIC) l-Z (nm CLAssic) in pa DOOR PANEL FIber Classic V. 2 WE 02/24/12 tLINGE STILE OL'o--m— SLIM N.T.S. noM CLASSIC) &L( neiw c"L-!C) t-2'\ VERTICAL CROSS SECTION JK DOOR PANEL CHL ffr. LFS CAW= RDA FL- 15000.3 1/2' GLASS 25' STEEL IR INTERCEPTNTERIOSPACER 40 41 SEE NOTE 1 INSULATED CLASS V,i SMC LITE FRAME A71N DEW 13.9379 MAX. PAN& WIDTH 7.125' MAX D.LO. WLDT i O O vA SIDEUTE PANEL Smooth Star It 1/2' MIN. 1/2 GLASS 1/2' MIN. n GLASS THK. 40 GLASS THK.,,' n S. EXTERIOR 40 42 i: n TEMPERED Ct TEMPERED 4i' 0' ^m GLASS GLASS •.:':'..7 o 0 AIR SPACE AIR SPACE J3 ° 34 a: f ; rrrrr # Vs-. 25' STEEL 1/8' ""..'•.'s; a.. TEMPERED INTERIOR INTERCEPT TEMPERED 5 m GLASS SPACER GLASS r4 m ui 40 29 SEE NOTE T 29 \ AI m s a. 1 ez M Nilia:+Zrl;e1 W.741:I 1iL11 HEICUUMM"/ as-;.: SEE NOTE i I HORIZONTAL CROSS SECTION 4 SIOELITE PANEL 2.152' 2-W i •-- s2s' PLASTIC UP UTE FRAME LASTIC UP LITE FRAME EXTRUDID PVC EXTRUDED SMC E 1 r I pJr —^{ I Off 4 SIDEU2 SIDELiVERTICAL CROSS SECTION rjIIr%% TEPANEL1.. Spacing for Item #29 do J41 Oft frame screws) I 7 is as follows: From the bottom up on sides: 6.5', with ( 7) more spaced at 9.875' o.c. there are (2) 42 screws- both top and bottom of 2.125' in from each i! 1 S1D£LliE i0P dt BOTTOM RAIL SIOELlTE BLANK SIDE STILE corner. FNGER JOINTID PONDEROSA PINE SC 0.43 FINGER JOINTED PONDEROSA PINE, SG=0.43 r N.T.S. er: JK L BE US um 10, FL- 15000.3 st- A—O J{il°11110 ,: T E SEE NOTE 2l 6I n ,= i%.r • 59 1 VERTICAL CROSS SECTION 5 Outswing configuration see jy=,rgl notes, shesll for FIVNZ water infiltration requirements r •` 6021 a !Ifui SEE N07E 1 G, NOTE I. The sldefite is direct set Into the SEE NOTE 2 62jambwith (12) item ;/43 a 18 x 01 2' pfh. wood screw. There ore (4) INTERIOR of each vertical jamb, from the top down at 13.57. 31', 48.5' do 3 VERTICAL CROSS Si BRIO INTERIO 66' There are (2) at the header 5 Shown w/1x sub-1 of 4' from the outside comers of the frame. there are (2) at the SEE NOTE 2 y : •` sill, 4' from the outside comers. 46 62 2. Optional surface bolt., see design pressure chart sheet I. INTERIOR r to to 42%. A 20 19 30 48 M E)MIOR 52 58 exec 02 24 12 14 a..... N.T.S. eec er. JK 2 VERTICAL CRO55 SECTION 4 VERTTCAL CROSS SECTION am atLFS 5 Outswing conrigurofion *+K xd 5 see =rgl notes, sheets FL-15000.3 for 'TiVH2 water infiltration requirements — -L OF J 2 it 4524INT22 0%** ....... 8 7 35 4 4t__ 27 43 36 S VA., INACTIVE ACTIVE INTERIO ........... a" yr, 7 8 pi X. - it ta d 10 lz 13 33 a, 34 J 43 SEE NOTE I iTBIQB 9 10 37 18 HORIZONTAL CROSS SECTION r2\ HORIZONTAL CROSS SECTION 49 6 17 35 45 36 46 INTERIOR INTER10 A EB 47 ACI)VE 33 43 SEE NOTE I d34DETAIL 'A MIN OPTIONAL SURFACE BOLTS IN ACTIVE PANEL 13 C-SINK (SEE DESIGN PRESSURE CHART) 1-114*Mk— DAM 02/24/12 1 WL oyp) scum N.T.S. 1. HORIZONTAL The idefite is direct got Into the jamb with (12) item 14,3 a IS x 2' pfh. wood screw. ON_ on JK CROSS SECTION Thereare (4) at each vertical jamb. from the top down at 13.57. 31. 48.5' & 66. There cW_ On LFS ore (2) of the header at 4' from the outside corners of the frame• there are (2) at the sill. 4' from the outside comers. FL-15000.3 ! a SHED 6 OF lz 04 48 49 t3 17 CSMK V•f ti i0 I1vrEaroa i \t+. d S L CP M 7 Zp apdrOl11tIQ2 ate• h p ie 1' o o: 1. The sidelite is direct set Into the jamb with (12) Item /43 o 16 z 2' pfh. wood screw. There are p ' 13 4) at each vertical jamb, from the top down at y 16 13.57, 31'. 48.5' & 66'. There ore (2) of the 21 )8 header at 4' from the outside comers of theI-1/4'M1N EMIL (M) from&. There are (2) at the sill, 4' from the oa g outside corners. 1 1 HORIZONTAL CROSS SECTION R. LL m 48 1-1/4' MIN. EMB. (TYP) SSI 49 5 15'MM 17 13 45 6CKSMK 43 n 44 INTMID N i`i• i 7 INTERIQ ACTIVE Cf .33 to 34 SEE NOTE 1 35 2 EXTERIQ$ a, 21 oac 02 24 12 9 1 B 43 Bohm N.T.S. 10 12 on Of JK o' 2 HORIZONTAL CROSS SECTION L 3 `HORIZONTAL CROSS SEC110Ng USOefUP. a UM1rp0 rl&.: 7 7 18 FL-15000.3 n I=iOF_M 0 4- 144 8 9=FFF 1 1: MULUON SHOWN FOR 0 II MASONRY 49 REFERENCE OPENING 11 Typ. HEAD MULLION-/' JAMBS SHOWN FOR II REFERENCE II II u II 2X BUCK II 0 II ASTRAGAL II II Q SHOWN FOR II II REFERENCE II II B II DOUBLE BUCK W/SIDEUTES ANCHORING MASONRY OPENING CONCRETE ANCHOR NOTES: 1. Concrete anchor locations at the corner; may be a*ded to maintaln the min. 2X BUCK edge dWance to morkw)o1rdL 2 Concrete anchor locations noted as MAX ON CV4111r nwAl be cdAnted to maintain the nin' edge distance to mortar joists, odalond concrete anchors may be requked to ensue the "MAX. ON CIDIW dkymdon are not exceeded Concrete anchor table-* AN.Q.fPk-. ANCRof C= Y ANCHbIt- nw TAPCON 4- ELCO 11.11.7111ACON 114- C4 CS ci ao C5 a 1 !9 JK0;1 jjvs FL 15000.3 xr -L oF 12 MASONRY OPENING FRAME 2X BUCK SEE DETAIL '3' I 13 W/2XBUCK DETAIL '2" 13 W12X BUCK '4 j jjyl J o m e INSTALLA1IONINSTALLATION $ _ 51 W/IX BUCK - ` a, j 51 W/iX BUCK ONRY INSTALLATION , _ 1. X.2 ° tf INSTALLATIONTYR HEAD $ OPENING & APEAD 48S +° 3 Ri min tDt . LIMBS \ ` II t: 0 t^O °i V $z 7+ 17YP FRAME 931YP. 2X BUCK SEE DETAIL 14 TYP. 5- g SEE _ SILL _ n DETAIL ' 4' 52 , • 7 52 TYP. 1 SEE NOTE 1 1 1 1 SILL VIEW " B•-:2 8- A• 10EW ' C'-'C' VIEW A• -A• C. A, DOUBLE ODOR W/SIDf7 rtF'S SINGLE DOOR W/SIDE1 fiFS 58 59 13 ° 30 CONCRETE ANCHOR NOTE: 13 1. Concrete anchor locations at the comers may be mgwted to maintain the min 10 DETAIL ' 1' edge distance tomortarjoints. 10 SURFATTETBELSISTRIKE f3 W/2X BUCK 2ConcreteanchorlocationsnotedasMAX. ON C&M*must be odlusted to DETAIL '3' INSTALLATIOD maintain the min. edge distance to martar joink oddtlonaf concrete onchors may be requ6ed to ensm the MAX ON CVW dimension cre not exceeded. 70 60 W/1 X BUCK 9. Concrete anchor table: DETAIL 'S' 43 INSTALLATION SEE DETAIL 1' E3P>! vim_•. _.•._..,.::::•-•--::- ANCJfOR? r,<.- r::.:-. 7411Af_::.: fMtli''C-lEA'R.4NG; M}:C4H RANCE jdElj(i R=•: t1 re;>: s.E;_=:;. ftirBED1NENi;•;' icriptiisQ!v tl':•=;.:-?ice ici;cti: r.,•.:..:.:...... EDi:E.<..:s•-_;.:._:-='A7 1GHGtt=::::.;; TA, PCON• 1/C 1-114' IIVY TAPCON0 3/16' 1 -1/4• 3• 1.1/7 WOOD SCREW INSTALLATION NOTE: edoe dinbnee. I'and &dnnee. A 11e e..eeeba of 51W1. MomtaLn a mmurn,m wood screws to 30 43 so 0 13 W/2X BUCK INSTALLATION 31 W/1X BUCK Dt -4• DETAIL '2' INSTALLATION ASTRAGAL do SURFACE BOLT STRIKE PLATE AT HEAD On IR r 02 24 12 i Lft N. T.S. ° o. nr JK m' OM. LFS 3 pw° =I c FL- I5000. 3 0 a-LWJZ 0 a SEE DETAIL 3' 9. A' 73 I 1 1 1 1 'o il• .• SEE 13 W/2X BUCK DETAIL 12' INSTALLATION - MASONRY 51 W/1X BUCK OPENING INSTALLATION $ TYP. HEAD € JAMBS _ 0. 0 FRAME Lv 2X BUCK SEE 14 TYP. SILL DETAIL 'I - sEE DETAIL B. _ DOUBLE DODR CONCRETE ANCHOR NOTE: 1. Concrete anchor locations of the comers may be ocWed to maintain the min. edge distance to mortarlahts. 2 Concrete anchor iocokxu noted cis'MAX. ON CBJIER' must be adjusted to maintain the min. edge distance to mortor)oinfs, oddtdond concrete anchors may be required to ensue the AAAX. ON CSWW dknendan are not exceeded. 3. Concrete anchor table: A' ANs=lIOR; ANCiIGB MIN :==i::......... VAIN,•CRf/IRANtif::M1N:=GLEtRA'HCE jO SCNRY;=; IC iCDIAGEt Q:;. i-'AIILHC7Jt_:•e- l1w o TAPCON 1/Ar 1-1/4r 2` 4' nw TAPCONO 3/16' 1-1/4' 8" 1.1/Y WOOD SCREW INSTALLATON NOTES: I. Malntoin a minlmum 5/8' edge datanc& t' end ddcnce. d 1"o.c. spacing of wood screws to prevent fhe splitting of wood Tw, MASONRY OPENING FRAME-, 2X BUCK-1 I F, I- to W/2X BUCK3INSTALLATION W/1X BUCK 1 INSTALLATION _ TYP. HEAD _ JAMBS 1 fJ0 SILL II SEE DETAIL '5' VIEW 'C'-'C' VIEW A'- A' C- SINGLE DOOR 58 59 13 0 H w/1x euCK o531NSTAILAnoN30in W12XL1BUCK TION 12 13 DETAIL '1INSTA' Q 10 SURFACE SOLT STRIKE 10 AT THE SILL 13 W/2x BUCK S DETAIL '3 INSTALLATION i 60 W/1X BUCK 10 INSTALLATION DETAIL 5' 30 c SEE NOTE 1 W/1X BUCK 53 O0 INSTAW17ON s0 WE 02124112 13 W/2X BUCK sale N.T.S. W/2X BUCK 12 INSTALLATION Oft at, INSTALLATIONINSTALLATION W/ 1X BUCK CHL W. lFS DETAIL ' 4' DETAIL '2INSTALLATION ORWIM to- ASTRAGAL do SURFACE BOLT FL-15000.3 STRIKE PLATE AT HEAD s1w JO a3 r jztY% f 1896 AN 2AG9" 1BB 143B BOTTOM TOP mu66i 27 ' 27 TYP. TYP. AZ 4S 313' 3.25' T OJS 0.75 ri Mr 8 N 0 SEE NOTE 1, 0 4 a C4 I 0.126- J O NOTE: TRAC+11 DETAfL acre 02 24 12 ; a... N.T.S. 9 s a + JK m 1. THE ASTRAGAL BOLT HAS A 3' THROW AT THE TOP LFS dANDTHEBOTTOM. xo n FL-15000.3 0 Mdffw 1(A4CL 1 AWfl SILL .11RMML M f?FRQASS BY IA IN WR7 , PANEL S10N 07AMFBFRQASS DT F812AsS FC TOP RAIL m J FC LATCH STILE mm COyp= 4 FC NDCE SIRE PONDLRM PINE, SC-043 Wm rC 00TMV ft Wm osam 6 POLIUREDLWE FOLIC 1JbL 7 SHORT REi m RFATH0 w 8 LONG REACH MWWSWM WTAT)OMP Fm 10o PFHMODSCREW11IX Wm em SC >. D55 mm 10 , MW WDW SCREW 5Tm IJ e = - 1 wooN S Mm 14 r 1 rry PRi CN, ewr SCREW mm B SC >• O.SS pm 17 1 +' SN4 W m If KNW 19 BLAP FACE DIRMW ALIJUAM 20 HEADER t SU PAK 90-4, Im 21 SW AM sc uow 22 Ma JAMB SB_Q+J 2j KtIM7 KAMT - SICNATIDE 00 fM- 4 MdBdO X AS IUM A ANN JIL A5IRAAIL RELSN BOIL STEEL 24B ASTRAGAL RISH BOl7 REGDlOt ALA, 27 10 A I-f Ls PAMIFAO S1HET , SCREW STEEL 29 16 = 1- FLLDWAN 5(REW FDR Sim JO ACE BDti PLATE 1 J 1 = 3-I PRI CONCRETE say t 719L CLELEW CIA791C TAPE Sw-6 TAM- ja PLASTIC LP LITE mow PIC 34 9 BIAW 1AL18 PDXIKR051 p6E SG-a4J 36 SIOBDE SIDE STILE YM 10 = I 4 W PFH M W SCREW SIM 39 JKff WATER 40 1 56.00011E CAULK 795SILICm 41 f0 = 7-1 PIASCREW RELSim 42 SIDErITE TOP ! BUMN RA! AAE SFfQ43 MOOD 43 F8= 2' LG PFH MOOD SCREW Sm 4 J ' r J IERUND • OUARROM fW= AATOED PD6: Ww 45 I' L = . 0/ Sim 46 MS SURFACE BOLT 1454 80' L = 25 IW STEEL 47 1 4- 2D SIX ORT N f 4-20 FDLALE END r l-3 4• 1, Sim- 4e LlSVN1T1' - Avw P9 19N. CDNCRETC COMDRVW 70 ACI 3DI OR HMLOWBLOWCOWDR!" 70 ASTY C90 CLA4T8E>F 49 14' r 2-34 MW aCD OR 11N SCREW On 50 ASIRICAL SIRRE PLATE Sim 51 14 = J-! 4 Db' PFH CONQktE SCREW Slm SZ 1 4 = 2-! 4 RW CONCRETE SCREW STEEL. 5! 1 4 = J- 1 4 IIW PFH L>NAC W SCREW STEEL 54 SS TLW w m COMWE 55 55 LATCH SW m CO1POyT,E 56 SS Ma STILE SC-043 WOOD 57 SS BOrm RArL WDOD COWP0671E 58 3116 = 2-f 4 IM PM CCNCRETE SCREW SIM J ,B r 2- J + ITW PM CMCAETE SCREW 60 16 = !-1 4 IIW PFH CONCRETE SCREW STEEL 62 99M NWD 20 21 WOOD FRAME 2 FINGER JOINTED PONDEROSA PINE, SG=0.43 4.56r s-W 1 HIGH DAM THRESHOLD 39 ALUMINUM/WOOD THRESHOLD 050' WALL TYP. 19 BUMP FACE ALUMINUM/ WOOD THRESHOLD 050' WALL TYP. NOTE: USE OF THIS COMPONENT DOES NOt MEET THE WATER REQUIREMENTS FOR HIGH VELOCITY HURRICANE ZONES'. r--ems-1 000 @SURFACE BOLT STRIKE P • ( T S' STEEL 46 SURFACE BOLT WES. . 25• STEEL) Iam or. JK 1 I FL-15000.3 I Ce 4 R W R W Building Consultants, Inc. B Consulting and Engineering Services for the Building Industry C P.O. Box 230 Velrico, FL 33595 Phone 813.659.9197 Florida Board of Professional Eagineens Certificate of Authorization No. 9913 Product Category Sub Category Manufacturer Product Name Swinging Therma-Tru Corporation Fiber Classic" i "Smooth Star" Extorlor Exterior Door 118 Industrial Drive 8'0 Outswing wl and wlout Sldelites Doors Assemblies Edgerton, ON 43517 Fiberglass Door Phone 419 298-1740 Non -impact" Scope: This is a Product Evaluation report issued by R W Building Consultants, Inc, and Lyndon F. Schmidt, P.E. (System ID # 1998) for Thenna Tru Corporation based on Rule Chapter No. 61G20-3, Method 10 of the State of Florida Product Approval, Department of Business & Professional Regulation. RW Building Consultants and Lyndon F. Schmidt, P.E. do not have nor will acquire financlal Interest in the company manufacturing or distributing the product or In any other entity involved in the approval process of the product named herein. Umllatlons: 1. This product has been evaluated and is In compliance with the 5th Edition (2014) Florida Building Code (FBC) structural requirements Including the "High Velocity Hurricane Zone" (HVHZ). 2. Product anchors shall be as listed and spaced as shown on details. Anchor embedment to base material shall be beyond wall dressing or stucco. 3. When used in the "HVHZ" this product is required to be protected with an impact resistant covering that complies with Section 1626 of the FBC. 4. When used in areas outside of the'MVHZ" requiring wind bome debris protection this product is required to be protected with an impact resistant covedna that complies with Section 1609.1.2 of the FBC. S. For 2x stud framing construction, anchoring of these units shall be the same as that shown for 2x buck masonry construction. 6. Site conditions that deviate from the details of drawing FL-15000.3 require further engineering analysis by a licensed engineer or registered architect. 7. Oulswing configurations using coastal sill item #39 under active doors, and all sills used under Inactive doors meet water Infiltration requirements for "HVHZ". 8. Outswing configurations using sill #19 under the door do not meet the water infiltration requirements for the "HVHZ" and shall be Installed only In non -habitable areas or at habitable locations protected by an overhang or canopy such that the angle between the edge of canopy or overhang to sill is less than 45 degrees. See drawing FLA$000.3 for size and design pressure limitations. Supporting Documents: 1. LestRgoort No. TEL 01460337-A,B,C TEL 01460336-A,B,C STTS00001 15427-107362 ATI 67508.01-106-18 ETC 01-741-10701.0 ETC 01-741-10703.0 ETC 01-741-10593.0 TEL 06-1031-3 TEL 06-1031-4 Test Standard ASTM DOSS-03,ASTM D1929-98 ASTM 02843.99 ASTM 0635.03, ASTM DMS-98 ASTM D2843-99 ASTM G26-M ASTM E84-00a ASTM D1929-96 TAS 202-94 TAS 202-94 TAS 202-94 TAS 202-94 TAS 202-94 Testing 1-aboratory Signed by Testing Evaluation Lab.,lna Lyndon F. Schmidt, P.E. Testing Evaluation Lab.,inc. Lyndon F. Schmidt, P.E. Sub Tropical Testing Omega Point Laboratories Architectural Testing, Inc. ETC Laboratories ETC Laboratories ETC Laboratories Testing Evaluation Lab.,lnc. Testing Evaluation Lab.,lnc. Lon Hicks, VP Operations William E. Fitch, P.E. Joseph A. Reed, P.E. Wendell W. Haney, P.E. Wendell W. Haney, P.E. Mark D. Pasero, P.E. Wendell W, Haney, P.E. Wendell W. Haney, P.E. Drawing No. Prepared by Signed & foaled by No. FL 15000.3 RW Building Consultants, Inc. (CA #9813) q*@°' tit c(;;(-)r 9p p' Lyndon F. Schmidt, E Calculations Prepared by ee, '..•- -.,. Signed 8 Seated by Anchoring RW Building Consultants, Inc. (CA #9813) hw t: C, E. f¢ '- ° oVndon F. Schmidt, P.E. ASTM E1300 Glass Load Lyndon F. Schmidt, P.E. Quality Assurance Certificate of Participation issued by National Accreditation and Management. r g Institute , certifying that Thenna-Tru Corporation is manufacturing products 0 : ; Ov within a quality assurance program that complies with ISO/IEC 17020 and iA, f• E OF -'4i/ Y tGuide53. ` C°• ` ; Jvlo 9a6 bGol >t+5'' 3 Aa' Lyndon SchNo. 43409 2/2/2015 Sheet 1 of 1 THERMAITRU 0 THERMA TRU DOORS r IS INDU87*1^6 D".. CDDiRION. OH 42SI7 FIBER CLASSIC" / "SMOOTH STAR" 8'0 INSWING w/ & W/OUT SIDELITES FIBERGLASS DOOR NON- mmr GB4SW NOTE 1. Thisproduct has been emk ofed and k m cvmpkmm wM the Sth Bd fbn (MI4) Haida Building Code ( FBC) structural mquhnmts kx:bjdng the 14gh Velocity Hurricane Zone (HVHA. Z Product anchors shall be as fated and spaced as shown on detcds. Anchor embedment to Dose material sty be beyond wag dress or stucco. I When used in the WHr this product Is required to be protected with an impoct resistant ommilng that compiles with Section 162b of the FBC. 4. When used In areas outside of the WvNr requ ft wind borne debrs protection this product Is required to be protected with an k pact resistant coveting that oanpl es with Section 16M.1.2 of the FBC. I For 2x stud Gaming cortshuclion, anchodng of these units shag be the Borne cis that shove for 2x buck mosonry corofiuction. 6. Site conditions that deviate from the details of this drawing require further engineering analysis by o gcensed engineer or regisiemd oddtact. 7. This product does not meet the water hsftirorwn requirernenis for the 1NHr. Inswing units shall be Installed only in nonhobilable areas or at habitable locations protected by an overhang or canopy such that the angle between the edge of canopy or awmhong to sl Is tens than 45 degrees. TABLE OF COMEMS SHEET# DEf[fMM I Typical elevations, design pressures a general notes 2 Door panel details (Smooth stm 3 Door panel details Fiber classic) 4 Waite ponel details 6 glaring details 5 Vertloal coin sections 6 HO1lrardd cross sections 7 Hotirontalcrossseeds B Buck Archto6n 9 Home 10 Frome onchmI ng 1112 detals VIM 12 oComponentsofSF (Dl> 1> 1055a' ASAxOvetult'1rAASEwm1H `, f,,. t 013 IN - ACTIVE AC1WU Mivl/ rrr* r 6 6 6 in SEE DETAIL A' t 2 SHEET 6 5 5 DOUBLE W/SIDELM INSWING UN? OXXO 37-WMAX Ove FRM4fW M SINGLE INSWING UNR X 7ILFWAIL OVER FttAAtE WIDM 13 SEE DaPIL 1 t SHEET 6 5DOUBLE fi UN 65MMA1r. OVBtAUWIM SEE OEFaL A'/ 1 2 SHEET 6 S 5 SINGLE /SIDEJJTES )NSMNC UNIT OXO f JS u' Gil Sal. .-Ti: !-r- c%'ti:.-j{ f'__...'.: 9 t/ t/ MM, 0, m FL-15000.4 c ar —Lori n: SNO." 4t Vr 55 fA 36 EXTERIOR 6 r's J 54 IM go pf 12 ck41, 3&0(r MAX 2w DOOR INTERIOR02 PANEL WIDTH 2 rl'\ HORIZONTAL CROSS SECTION V DOOR PANEL 4.M7' I Ln z 7A23 0" 1-sw EXTERIOR INTERIOR (— Q ke rn LATCH STILE TOP I ( SMOOTH STAR) SMOOTH STAR) Ito DOOR PANEL MirSmoothStor 57 qz DAM 02/24/12 sr ao HINGEN.T.S. 56 RAIL K\STILEBOTTOML2VEIMCAL CROSS SECTION Mr. ft. JK 0 SMOOTH STAR) (SMOOTHS \,V DOOR PANEL ;Z —n:LFS aunwe mL FL-15000. 4 SHM 1 2 OF12 Ng" ts al. 14'4- C! EXTERIOR 4 2 caJ* I INTERIOR X WMAX I --"\HORIZONTAL CROSS SECTION FDOOR DOOR PANEL PANEL VADTH ff) 4MT Mr L In EXTERIOR INMIOR LATCH LE "I 0 GO 2FLSER CLASSIC) F94:R "CLASSIC) IAS' DOOR PANEL Fiber Clossic VERTICAL HINGESTILEOT'O"r2 AL CROSS SECTION ore L02/24/12 FlSER CLASSIC) &2( nBERC= Ic) DOOR PANEL SM& N.T.S. 9 ow— or. JK me LFS FL- 15000.4 mm3 ar 12 1/2' GLASSFrGLASS 1/2' MIN. " IrZGIASt ant GLASS THK film 40 1 8' PRIOR 40 G1 TEMPEREDA GI ///// 25' STEEL INTERIOR INTERCEPT SPACER 40 41 SEE NOTE 1 5' INSULATED GLASS W/ SMC LITE FRAME GLAZING DETAIL 19375 MAIL PANawm 7.125 MAX. D.LO. WIDTH P ti AIR SPACE 118. 25' STEEL TEMPERED INTERIOR INTERCEPT GLASS SPACER 40 29 SEE NOTE 1 5' INSULATED GLASS W/ PVC LITE FRAM£ GLAZING DETAIL Is El na:2-67A\\ 1 Tilt= 1/2' MIN. GLASS THK. 1/8' TEMPERED GLASS AIR SPACE 1T18. TE1PERED GLASS SEE NOTE I LHORIZONTAL CROSS SECTION 4 SIDEIJTE PANEL 1 21Sr ugh IAV r"I Imo— Sib• .ff.Y . ;'• C.. I F-- s2s• w i PLASTJC UP LITE FRAME \ PLA5ITC UP LJTE FRAME J EXTRUDED PVC EXTRUDED SMC 1 DM — j l A1T 2 VERTICAL CROSS SECTION SIDEIJTE PANEL Ll_U 4 IRpaSpacing for Item /29 k J41 trio frame 3crow) SIDELTIE PANEL Smooth Star soaa N.T.S. is us follows., From the bottom up on sides; 6.5, 1331' I 1 t I SiI' 1 with (7) more spaced at 9.875' O.C. there one (2) am By, JK screws both top and bottom at 2.125' in from each cw en US 42 SIDELJTE TOP & 807TOM RAIL 3t SIDEIfTE BLANK SIDE STILE comer. ORL"O xa FlNCER JOINTED PONDEROSA PINE SC=0.43 FlNGER JOINTED PONDEROSA PINE. SG-0.43 FL-15000.4 SHOD CF 4 7E 2 I SEE NOTE 2 31 m 14 1 VERTICAL CROSS SECTION 5 2d 4 NOTE 1 `d 117' •: d14:?T•J;i 2 VERIICAL CROSS SECTION 11_5 SEE NOTE 1 Rob N o E$ a; 8 17 i 30$ 20 EXTEHIOB Yi r:. ' ins 1 Ci NOTE 2 3 VERTICAL CROSS SECTION V Shown w/ix sub —buck OPTIONAL SURFACE BOLTS ON ACTIVE PANEL. SEE OF -SIGN PRESSURE CHART) LM: W I. The aidelits Is direct set Into the jamb with (12) 0 m Item 143 a IS x 2' pfh. wood screw. Thera are (4) at each vertical Jamb, from the top down of 13.5 . 31', 48.5' dr 66' There are (2) at the header at z° yam; 02 24 12 Mm N.T.S. 4' from the outside comers of the frame. there ore on e<: JH2) 113 a 18 x 2-1/2' pfh. wood screw of the sill, 4' from the outside comers. ak an LFS arum - FL-15000.42. OPTIONAL SURFACE BOLTS ON ACTIVE PANEL SEE DESIGN PRESSURE CHARD snar 5 OF I z 2 38 1B 0A S' MIN. CSINKDam r rrrr* SEE NOTE 1 i • 1. The sidelite is direct set Into the jamb a a 43 with (12) item 143 o Ie x 2" pfh. wood 1 t1 a z" screw. There are (4) at each vertical 47 tTjamb, from the top down of 13.5", 31 ACTIVE z i o48.5" do 66". There ore (2) at the header at 4" from the outside comers of the a frame. du N;: there ore (2) /13 a IS x 2-1/2" pfh. wood screw of the s111, 4' from the outside comers. yi,:`• Ii,`.v:,^;::: eZ INTERIOR 36 45 41 29 44 DETAIL A" 17 18 OPTIONAL SURFACE BOLTS ON ACTIVE PANEL EI1B4 SEE DESIGN PRESSURE CHART) s G 7JNTERIOFHORIZONTALCROSSSECTIONIa0 6 0A C MN. 22 35 a MA 24 43 8 7 SEE NOTE 1 27 8 7 43 3 i INACTIVE ACTIVE 10 atG1 0 ui i•J. 1, : Cry '• i iV y. t<.:•f:j!.;'u i.'ii !.t` 37 w'`••i•.ri a ^' i• c 13 INTER 36 44 c 4 up 9 10 37 45 DAM 02 24 12 i 1IDR scut N.T.S. 9 5 a" s• en Jt( 18M W. LfS d 01HORIZONTALCROSSSECTIONt2' HORIZONTAL CROSS SECTION xm 66momFL- 15000.4 n L O FMB. fIYP.) Be. (FYP.) 11 13 17 IS'MIN C-SWK 1SMIN 17 C.SWK 73 ' i''+. r xx n rr tz, n 7 7 8 h 8g7Dg WEBIQB t0 R d c gW p a IL 13 2116 A 10 12 16 38S m 38 18 2 HORIZONTAL CROSS SECTION 1CQEBICB 7 1 HORIZONTAL CROSS SECTION Isw1oL3521C.SINK 7 43 34 SEE NOTE 1 1QB 33 43 7 N GI IA 8 w 1. The sidelite Is direct set Into the Jamb with (12) 36 c item J43 o 18 x 2' pfh. wood screw. There are (4) 44 n of each vertical 'jamb, from the top down of 13.5. 13 z 31', 48.5' & 66'. There are (2) at the header at 45 z o° 4' from the outside comers of the from&. there are WL 02 24 12 = 2) 113 a j8 x 2-1/2' pfh. wood screw at the 18 scum N.T.S. 3 sill, 4' from the outside corners. ao, on ,1x m' INTMOR 3 HORIZONTAL CROSS SECTION cut m US 3 DROM NCL. a A7 FL-15000.4 n MW _L OF p I I • B I I ~ _ ore U ~ ',~> •'••....... .' MASONRY ii TYP• HEAD II OPENI G • HEAD I'j RY7 hft j t%%`6n OPENING & JAMBS ASTRAGAL do JAMBS • lIIIIIIU SHOWN OR _$ oASTRAGAL SHOWN FOR II REFERENCE 2X BUCK 6 REFERENCE t. t. 4 ro W 2X BUCK kMULUON II MULLIONJ I I SHOWN FOR II SHOWN FOR I I Bu II REFERENCE B REFERENCE II r U II 0 II No B II B II B n I I B I I 0 Cd a W/SIDELITES ' '' '"' DOUBLE DOOR BUCK ANCHORING 4. — j BUCK ANCHORING a II II 7 .> II 3e II MASONRY II II MASONRY OPENING BSD gAM'OPENING JAMBS o Z c II II 2X BUCKI II 2X BUCK II MULLION II CONCREIEANCHORNOTQ: II SHOWN FOR II a1. Concrete anchor locations at the comers may be acWed to maintain the min. I I REFERENCE I I edge distance to mortar joints. 2 Concrete anchor locations noted as MAX ON CEWW fort be adjusted to moinfafn the rNnedge distance to mortarphts, additional concrete anchors g mayberequiredtoensureMMeAXONCENTWdInwslonareratexceeded. MULLIONNo9I AI Concrete anchortoblaII SHOWN FOR II N lE4R tNCE•:1NIN: REFERENCE CIt0 Ci oII I I u r o2 24 l2 N.T.S. I I I I t JK o v.:...,:•. : ElGO ULTRACON 1/ a' 1.1/ OPENING FRAME CV 2X BUCK SEE - DETAIL 3. •;. 1 i NEW 'R'-'e' 10 DE AtL '2 W/2X BUCK INSTALLATION W/1X BUCK J9 INSTALLATION TYP. HEAD t TYP JAMBS O BUCK DETAIL 51* TYP. SILL DOUBLE QOOR W/SIDann CONCRETE ANCHOR NOTES: 1. Concrete anchor locations at the comers may be odAnted to mointoh the min. edge dsiance to mortar joints. 2. Concrete anchor locations noted as 7AAX. ON CENTER' must be adjusted to nichtch the mh edge dlsfcme to morforjob*, odc ttonot concrete anchors may be required to ensure ftle %tAX. ON C&OW dimernlon ore not exceeded. I Concrete anchor table: i. D_"R:_• A: r` E`.•?.:'_•`.:- M.N'?==•i• WAR Er. M=;M ANE.•E c' N- s_ G._I D- i ASONARYC, 0ACATtiterMENt. i_: EbG CfR :•_ TAP° N a 1/r 1.1/r r r lTw e3/1rTAPCON 1-Tjr r 1-1/2" WOODSCREW INSTALLATION NOTES: I. Mointoln a minlmvm 5/ir edge chfance, i ena wood screws to prevent the spBH61g of wood. THESE (2) ANCHORS REO'D ONLY WHEN DP > 47 PSF f•, i. I MASONRY OPENING FRAME 2X BUCK I T— J W/2X BUCK INSTALLATION W/1X BUCK INSTALLATION TYP. HEAD h JAMBS O BUCK TYP. SILL r h ir rn- i DETAIL v 5' 1 VIEW C"-'C .C. = L- ,- 17EW a'- A' SINGLE DOOR W/SIDFI M 13 49 30 30 W/2X BUCK 13 0 31 INSTALLATION 31 13 W/1X BUCK 48 37 INSTALLATION 10 DETAIL 3" DETAIL '2' 10 ASTRAGAL do SURFACE BOLT STRIKE PLATES O HEAD 10 DETAIL 513 m 31 13 30 DETAIL ' 4' SURFACE BOLT STRIKE PLATE O THRESHOLD nw O i z c L 02 24 12 lA N.T.S. Q on JK C. n: LFS T 1V, C N].r o FL- 15000.4 C Xr 9 or 12 G MASONRY OPENING FRAME TYP. HEAD & JAMBS 2X BUCK- 1SEEDETAIL •I • DETAIL '3' 1 VIEW 'B•—•B• 7SE DETAIL '2' BUCK xhoN BUCATIO $ TION Ill s3 d 14 Typ• SILL SEE DETAIL -4- B. ---j L— A. DOUBLE DOOR CONCRETE ANCHOR NOTES: 1. Concrete anchor locations at the comes may be adjusted to mointoin the mh edge distance to manor)otrds. 2 Concrete anchor locations noted as MAX ON C134W must be o*ated to maintain the min. edge distance to nwarloints, oddlMonal concrete anchors may be required to ensure the MAX ON C84W dimension ore not exceeded 3. Concrete anchor table: IGINf:t{rAlt 1NCE.MfN_CtErCRANCI ACI`!Nl m...Y: •; 1O;71DlA EM:- I1W e TAPCON IIYU TAPCON° 3/16• 1-1/f T 1-1/Y WOOD SCRAM MSTALLATION NOTES sm•e,s distance T"en.r rK•.....-- A I--- Mantas a minlr+ wood screws to ge spitting of wood. MASONRY OPENING FRAME 2X BUCK LE7 W/2X BUCK INSTALLATION w/1X BUCK J9 INSTALLATION TYP. HEAD 3 JAMBS v SEE DETAIL O 5' 14 Typ• SILL 1 B T7 3 ti n 1 60 con nu Ic q uRaz 3$,0 5 mars: V Sz° VIEW A' —A' $IC' A" SINGLE DOOR 49 3p 30 W/2X BUCK INSTALLATION 13 31 3t W/1X BUCK 48 INSTALLATION c z w DETAIL •2' ASTRAGAL k SURFACE BOLT o STRIKE PLATES ® HEAD 31 31 ` swsc 02 24 12 30 0 30 none N.T.S. DETAIL '1' o L JK DETAIL •a' SURFACE BOLT STRIKE PLATE CHIL W. xo LFS THRESHOLD FL-15000.4 JP-UF_LZ i a z Zo 0 o ve I == pi f 188 IB3@ 40.63' aNnz I&V 14-V E z d 27 TYP. 27ATYP. PCr o 4.7 4S 2' 1.910` z 5 oas ws 11.IIVr s N SEE NOTE 1 A 4 uz e f II 22i mm 02 24 12 ASTRAGAL DETAIL NOTE, Mum N.T.S. i oft on 1. THE ASTRAGAL BOLT HIS A 3' THROW AT THE TOP CHL an LFS 3 AND THE BOTTOM. 3 nm a FL-15000.4 0 srta-LLOrI nO Ran OESLRPIION ltateid t FIBER CASSIC (EC) WE SM 0.11• UN. THK MM AST BYiOWA-TBV rM *M dm9N Fy(n%"U 0 Pd nsumm IA SMOOTH STAR SASH 4t PANM sm oor mw. T10L FOT aus BY DERW-TRD wu M F mel. wo py FSERMiASS FC Tip RAIL ROOD COMPOSITE FC LM S EE Mott CW1Pm 4 FC Ma SME ME, S0443 WW 5 1 FC BOTTOM At RWD CDWWff 6 POTIR 7mw IDAM t9Wt ppaw FDtM 7 SMORT REALM CMffZM REARERSIRP FM 6 LONG REACT C016ME,SM WEARETBiiDP FOAM 4' "ja 097' ROL Sim 10 110 + / lG FFW R000 SOO Sim 1t MAS M - A000 PSI WL. CONCRETE CCuflMM M AI] Ot OR IDUOW &M CONMR00 TO AS7M COD o01FL7 r 12 10 v 2 LG PFN MOW SCREW SRE1 13 18+ 2 I LG PFM ROW SMW STEM 14 114 r 2-t 4 RW MW CONEXEM SCREW Sim 15 MMfiE BOTTOM BOOT .090 DOIRDED WM LNITL 6 2X Ra 59 >• 036 IA00 17 WY 1 4• !VW WATEM ROW IB K69($T PASSIGE LOCK - SIMILIE SORES 19 SELF AMMM #GM SAWIE IHRES2MLD ALL& 20 IV ER PONOEROst POff SC•Q/! ROOD IRIXE lAYB s>;•Q4! ROW I@ICE.W® s>D.0 WWD 23 KN06ET ODOM - SKiW' BARE SEMES )BD 24 NLIMC ASMUGKiff ALMMI 2_ ASTRAGAL FLM 809 Sim B ASiRrA FW9t BOLT 110AID ALLRMM 6 IX SM SC >- 035 R000 27 t0 > I-1 LG PAWM STET METAL SCREW Sim 20 9F51Y9RG DOOR WIM SHED 1-31e VANM. 29 6-16 r RaLFS FLATHEAD SCREW OEM 11 Sim 30 SIAEACE BOLT S1T29E PLACE Sim I 10 + 2-1 FHUFS fIATNLAO ROW SLEW STEM, 32 t THK CilLtl1AR 0-4ZNG UK CK- SI MASH LF LATE FMME PVC u MASiiC LP UIE FRA¢ SMC RAW AM PINE SG-43 WOW 36 SDaff SOE SYLE SL'444! ROOD 37 t0 + 1-3 4 LG FM ROOD SCRDY Sim 36 114 2-3/4* PTO D.W OR OW CONCRETE SOO Sim 9 1 4 + 3-3 4 OW PFH CONCETC SCREW SRll 40 S UMNE MAK M 795 SIIICOYE 41 40 r 1 1 PIASCREW REM H Sim 42 57 UM TOP t BORON I SC-0.47 MOW 4J 18 + LG PFH Mott SPEW Sim M OINRTER mmomFina imm Pw MOW 45 I L + .m 0Cl D TIOI MLBRA SIM 46 DES St113•ACE BC.i 54 35 Sim Sim 17 t 4-20 SEX a, W t 4-10 PEWS ETD STEII 46 311v !-1 4 OW PFH CONCRETE SCREW Sim 49 ASTRAGAL SllM PLATE Siim 50 1 4 r 3-1 4 OW PM CMC M SCREW STEM 54 SS TOP RAIL MOOD Colom 55 SS LATCH STIE ROOD COt009lE 56 SS MM SIRE N5W FlrA AK SC-0.43 ROW 57 SS WTi0M MAL TAW COIP091E 0 0 o n 46 SURFACE BOLT AVES. -25' STFFT i IMY I P 7j;= - 7 L 4 20 2 WOOD FRAME 22 FINGER JOINTED PONDEROSA PINE, SGm0.43 SJSV a 1: a. cur u• 31 1 BmO f F 26)S• —•I cZ 30 SURFACE BOLT STRIKE PLATE L125• STEELT g 1 y3yS zWzOCL 1.4iiT INSWING DOOR BOTTOM SWEEP VIM7 .080- MAX. WALL, 035' MIN. WALL INSWING SIDELlTE mv' an JK 15 BOTTOM 90 ICWL R• IFS 0.09" EXTRUDED VINYL WALL MWFLM- 15N°` FL000. 4 R W R W Building Consultants, Inc. B Consulting and Engineering Services for the Building Industry C P.O. Box 230 Vohico. FL 3359S Phone 813.659.9197 Florida Ban of Profe aloml Fsgincets Cenlficate of Authorization No. 9813 Product Category Sub Category Manufacturer Product Name Swinging Therma-Tru Corporation Fiber Classic" / "Smooth Star" Exterior Exterior Door 11 a Industrial Drive 8'0 Inswing w/ and w/out Sidelites Doors Assemblies Edgerton, ON 43517 Fiberglass Door Phone 419 298-1740 Non -Impact" Scope: This Is a Product Evaluation report Issued by R W Building Consultants, Inc. and Lyndon F. Schmidt, P.E. (System ID If 1998) for Therma-Tru Corporation based on Rule Chapter No. 61 G20-3, Method 1 Dot the State of Florida Product Approval, Department of Business & Professional Regulation. RW Building Consultants and Lyndon F. Schmidt, P.E. do not have nor will acquire financial interest in the company manufacturing or distributing the product or in any other entity involved in the approval process of the product named herein. Limitations: 1. This product has been evaluated and is In compliance with the 5th Edition (2014) Florida Building Code (FBC) structural requirements Including the "High Velocity Hurricane Zone" (HVHZ). 2. Product anchors shall be as listed and spaced as shown on details. Anchor embedment to base material shall be beyond wall dressing or stucco. 3. When used In the "HVHT' this product is required to be protected with an impact resistant covering that complies with Section 1626 of the FBC. 4. When used in areas outside of the "HVHZ" requiring wind borne debris protection this product Is required to be protected with an Impact resistant covering that complies with Section 1609.1.2 of the FBC. 5. For 2x stud framing construction, anchoring of these units shall be the same as that shown for 2x buck masonry construction. 6. Site conditions that deviate from the details of drawing FL-15000.4 require further engineering analysis by a licensed engineer or registered architect. 7. Inswing configurations do not meet the water Infiltration requirements for the "HVHZ". Inswing units shall be installed only In non - habitable areas or at habitable locations protected by an overhang or canopy such that the angle between the edge of canopy or overhang to sill Is less than 45 degrees. 8. See drawing FL-15000.4 for size and design pressure limitations. Supporting Documents: 1. Test Report No. TEL 01460337-A,B,C TEL 01460336-A,B,C STTS00001 15427-107362 ATI 67508.01-106-18 ETC 01-741-10701.0 ETC 01-741-10703.0 ETC 01-741-10593.0 TEL 06-1031-3 TEL 06-1031-4 Test Standard ASTM D635-03,ASTM D1929-96 ASTM D2843-99 ASTM D635-03, ASTM D1929-96 ASTM D2843-99 ASTM G26-95 ASTM E84-00a ASTM D1929-96 TAS 202-94 TAS 202-94 TAS 202-94 TAS 202-94 TAS 202-94 Testing Laboratory Signed by Testing Evaluation Lab.,lnc. Lyndon F. Schmidt, P.E. Testing Evaluation Lab.,lnc. Lyndon F. Schmidt, P.E. Sub Tropical Testing Omega Point Laboratories Architectural Testing, Inc. ETC Laboratories ETC Laboratories ETC Laboratories Testing Evaluation Lab.,lnc. Testing Evaluation Lab.,lnc. 2. Drawing No. Prepared by ;,:ai+ °ji"r•,,; No. FL 15000.4 RW Building Consultants. Inc. (CA ff9813) Z,.rr, 3. Calculations Prepared by j a Anchoring RW Building Consultants, Inc. (CA #9813) ASTM El300 Glass Load Lyndon F. Schmidt, P.E. ;et 4. Quality Assurance Certificate of Participation issued by National Accreditation and Manageme6f; Institute, certifying that Therma-Tru Corporation is manufacturing products within a quality assurance program that complies with ISOAEC 17020 and "`,` ` - .., r •^;= Guide 53. Sheet 1 of 1 Lon Hicks, VP Operations William E. Fitch, P.E. Joseph A. Reed, P.E. Wendell W, Haney, P.E. Wendell W, Haney, P.E. Mark D. Pasero, P.E. Wendell W, Haney, P.E. Wendell W. Haney, P.E. Signed & Sealed by Lyndon F. Schmidt, P.E. F. Schmidt, P.E. Lyndon F. Schmidt, P.E. FL PE No. 43409 Z2/2016 CITY OF SANF BUILDING & FIRE PREVEN PERMIT APPLICA Application No: Documented Construction Value: $ 2 Job Address: 4 o Z9 f'l (q kf t-rC"" Xv- Historic District: Yes No Parcel ID: Type of Work: New © Addition Description of Work: P1LLnn6 Plan Review Contact Person: Phone: Residential J Commercial Alteration Repair Demo Change of Use Move 11" Fax: Email: G--LA. Property Owner Information Name Phone: 6+ 1 bu Title: Cw)v-tk4eL-ft, - Street: Resident of property? : City, State Zip: Contractor Information Name RJ Phone: Street: 9 -io f Fax: _ 2-32ti 3 - 2- 11 a - Li 4 6 b City, State Zip: 32-b2-Y State License No.: Architect/ Engineer Information 1= C 0203;-+ 2- Name: Phone: Street: Fax: City, St, Zip: E-mail: Bonding Company: Mortgage Lender: Address: Address: WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN Y UR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. A NOTICE OF COMMENCEMENT MUSI BE RECORDED AND POSTED ON THE JOB SITE BEFORE THE FIRST INSPECTION. IF YOU INTEND TO OBI AIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installatio has commenced prior to the issuance of a permit and that all work will be performed to meet standards of all laws regulating constm ction in this jurisdiction. 1 understand that a separate permit must be secured for electrical work, plumbing, signs, wells, I ools, furnaces, boilers, heaters, tanks, and air conditioners, etc. FBC 105.3 Shall be inscribed with the date of application and the code in effect as of that date: 516 Edition (2014) Florida Building Cod Revised: June 30, 2015 Permit Application Am NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that ma befoundinthepublicrecordsofthiscounty, and there may be additional permits required from other governmental entities such as ater management districts, state agencies, or federal agencies. Acceptance of permit is verification that 1 will notify the owner of the property of the requirements of Florida Lien Law, FS 713 The City of Sanford requires payment of a plan review fee at the time of permit submittal. A copy of the executed contract is reqt ired in order to calculate a plan review charge and will be considered the estimated construction value of the job at the time of subm ttal. The actual construction value will be figured based on the current ICC Valuation Table in effect at the time the permit is issue , in accordance with local ordinance. Should calculated charges figured off the executed contract exceed the actual construction vi lue, credit will be applied to your permit fees when the permit is issued. OWNER'S AFFIDAVIT: I certify that all of the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. Signature of Owner/Agent Date Print Owner/Agent's Name Signature of Contractor/Agent Date 12 c 7-«-z_"1 Print Contractor/Agent's Name Signature of Notary -State of Florida Date S i ,..cry., r r. tnt.4 i@Detc N. PAT SUSI MY Cil.U1.004f FF 120904 t'c, ..•. EXPIRES: August 25, 2018 Bor" Tiru tiomy Pu* Undeamtets Owner/ Agent is Personally Known to Me or Contractor/Agent is 4--- Pers onally Known to Me or ProducedIDTypeofIDProduced1DTypeofIDBELOW IS FOR OFFICE USE ONLY Permits Required: Building Electrical Mechanical Plumbing Gas[] Roof Construction Type: Occupancy Use: Flood Zone: Total Sq Ft of Bldg: Min. Occupancy Load: # of Stories: New Construction: Electric - # of Amps Plumbing - # of Fixtures Fire Sprinkler Permit: Yes No # of Heads Fire Alarm Permit: Yes No APPROVALS: ZONING: UTILITIES: WASTE WATER: ENGINEERING: FIRE: BUILDING: COMMENTS: Revised: June 30. 20 15 Permit Application OAP 9507 State Road 52 123 Miller Road f 9701 Bachman Road Established 1973 Hudson, FL 34669 Valrico, FL 33594 i*je63Orlando, FL 32824 www.RJKlaity.comI727-863-5486 813-661-0707 407-855-206 State License 0 CF-0O20 342 R.J. KiELTY Page: 10, 1 Proposal No: 717-13526 PLUMBING • HEATING • COOLING Proposal Date: 712612017 Prepared For: Starlight Homes Florida, LLC Location: Wyndham Preserve, Sanford 1064 Greenwood Blvd. Suite 124 Model: Odyssey - 1412 Lake Mary FL 32746 We Propose hereby to furnish material and labor - complete in accordance with specifications below for the Sum of: $5,925.00 Payment to be made as follows: 40% Rough In 30% Top Out 30% Finish. NET 10 Days All materials guaranteed to be as specified. All work to be completed in a workman like manner according to standard practices. Any alteration or deviatio from specifications below Involving extra costs w executed only upon written orders, and will become an extra charge over and above the estimate. All agreements contingent upon strikes, ac s or del. beyond our control. Owner to carry fire Aomado, and other necessary Insurance. Our workers are covered by worker's compensatio ' surance. (l ,/, ( - " vWvITHORAV fully AUTHORIZED SIGNATUR THIS PROPOSAL MA BE N IF NOT ACCEPTED IN 30 D YS. We hereby submit specifications a mates for. Master Bath 1 Shower Sterling Accord 60x34 Base 72270100 White With Walls And Moen Chateau TL182 Chrome Valve 1 Toilet Gerber Maxwell 21-912 1.28 White Elongated 1 Lav By Builder With Moen Chateau 64925 Chrome Faucet 2nd Bath 1 Tub Sterling Accord 60x30 71140120 White With Walls And Moen Chateau TL183 Chrome Valve 1 Toilet Gerber Maxwell 21-912 1.28 White Elongated 1 Lav By Builder With Moen Chateau 64925 Chrome Faucet Kitchen 1 Sink By Builder 1 Faucet Moen Integra 67315 Chrome 1 Disposal ISE Badger V With Cord 1 Icemaker Line With Recessed Box 1 Dishwasher Hook Up Utilities 1 Washer Box Yes 2 Hose Bibs Yes 1 Water Heater 50 Gallon Electric NOTE: Backfilling Included For Sewer & Water Only (Slab Backfilling By Others) Backflow Preventers Included EXCLUSIONS NO Permit Fees Included Water Piping In: CPVC 40' Sewer Allowance; Additional $12 per foot 40' Water Allowance; Additional $3 per foot Applies to any direct contract between an owner contractor (RJK) - Notice of Lien Laws - Florida Statutes 713.001-713.37. Acceptance of Proposal - The above prices, specifications and conditions are satisfactory and hereby accepted. You are authorized to do the work as specified. Payment will be made a outlined above. I agree to pay reasonable attorneys fees court costs in the event of legal action. A monthly service charge of 1 1/2% will be added after 3 days. Any sewer taps deeper than 4 1 /2 feet or requires backhoe or dewatering will be an extra charge. 1-nSIGNED:. _1L(L t 41-P GLA/1 n" DATE OF ACCEPTANCE & PAGE 2: l L Branch: Hudson Last Edit By: Last Edit Date: 7/27/2017 T vr\n-,-V 4 N7-04-7S TRI-COUNTY TESTING LABORATORIES, INC- Project \ \I, Irk h(, r11 Contraetor: c a, " I - fit' — el Location: I , r; .: I • J r tMaterial: Date Tested: 3 I'South Maur Stgeet - Winter Garda% Florida 34797 407-65&9656 REPORT OF IN -PLACE DENSITY TESTS Proctor: SpeciflcatiO& / 1 ; ;• l (' 6S 1 OptumanMoisture: '? . Maximum Dry Density: `J Z project No:__ Order No: Report No. Location Depth Incites Dry Density Max. Dry Density Percent of Max. Percettt 1bs cu.R. lbs ouA Density PCP 25.0' I aa W ` a^ 1 to Q to a— O0o aotY tE ro S z Z IPCP 1)exm,a- W- 1—1 -4-iie WYNDHAM PRESERVE - LOT 184 c SPECIFIC PURPOSE SURVEY I N Z- y FORMBOARD) m a y ar o tom( a c WYNDHAM PRESERVE LOT 184 PB 81. PG 93) o o ao o Z, z 00 occ oo-0 0.0m I I I 1 LOT 183 LOT 216 3.0' i N89W'03"E 115.00' NORTH BOUNDARY LINE OF LOT 184 t: I 25.3' 29.7' in ft 60.0061. in C i i o PROPOSED o h a c, I I STORY RESIDENCE N u top 4029 NIGHT HERON DRIVE 11.3 LOT 184 pMODEL8.0 LOT 215 yI27.3' t6 1981 OPHELIA W AREA = 9.3 ELEVATION - T 6.900 S.F. t i GARAGE - RIGHT 1 O FFE= 28.0 NN O I yl O O 2 I 50.0 37.7' fo t 1'0 I s9 , 115.00' S89'43'03ow LOT 185 LOT 214 Building Setbacks Setbacks: Per construction plans for 1MOMAM PRESERVE", City of Sanford, Seminole County, Florida. Front - 25' Rear a 20' Side - 7.5' BUQ.DQVG LAYOUT NOTE: Contractor and owner are to verify all setbacks, building dimensions, and layout shown hereon prior to any construction, and immediately advise GeoPoint Surveying, Inc. of any deviation from information shown hereon. Failure to do so will be at user's sole risk. e LEGEND:ADUSSD—Aeeeas/Droinage/UUIiUes/Sidewalk ar /Sight Distance Easement PRM—Permanent Ref. Monument PCP —Permanent Control Point FP&L—Florida Power h Light FFE—Finish Floor Elevation 11—Water Meter Book 04 —Water Valve V—Flre Hydrant RCM —Recalm ed Water Meter Elev.— Elevation RCM —Reclaimed Water Valve Cone. — Concrete 13—Cable Box SP— Brick Paver m—Telephone Box SW — Sidewalk E—Electric Box FFE— Finished Floor Elevation Qj:Utility Pole CI Curb Inlet Guy Pole GTI— Grote Top Inlet Light Pole P. U.E.—Public Utility Easement t--Guy Anchor RCP Reinforced Cone. Pipe OU--Overhead Utilities PVC — Polyvinyl Chloride 0 —Storm Sewer Manhole NCS— No Comer Sat (Falls in Water) t9—Sanitary Sewer Manhole SF — Square Feet 610ro —Electric Handhole O. U.E.—Dralnoge(Utillty Easement Coo —Clean Out FMGO— MAG NAI &DISK A:V1:4—irrigation Control Valve P. K.—Parker Kolon Nail i'—Sign SIR — Set 1/2' Iron Rod L137768 WI7a—Gate Water Valve SPKO— Set P.K. & Disk 187768 Gas Meter FIR — Found 1/2" Iron Rod L87768 01. —Existing Crode FIP— found 1/2' Iron Pipe L87768 q—Blow—off Valve FPKD— Found P.K. Nail k Disk L87768 — _—Drainage Flow Direction FCM— Found 4'x4' Concrete 10.0—Proposed Deslon Grade SURVEYOR' S NOTES: 1. Current title information on the subject properly had not been fumished to GeoPoint Surveying. Inc, at the time of this plot plan. 2. Roads, walks, and other similar items shown hereon were token from engineering plans and are subject to survey. 3. Elevations shown hereon are in feet and are referenced to the NATIONAL GEODETIC VERTICAL DATUM OF 1922 (NCV029). 4. Proposed grades 4 finished floor elevations shown hereon are from the construction plan for 1V1'NDHAM PRESERVE". City of Sanford Seminole County. Florida. S. This Specific Purpose Survey is for the location and elevation of the formboards only (THIS IS NOT A BOUNDARY SURVEY) DIMENSION NOTE: Proposed building dimensions shown hereon ore of the exterior. PREPARED FOR: ASHTON WOODS FLOOD ZONE: The property shown hereon is on the Federal Emergency Management Agency's Flood Insurance Rate Map Panel Number 12127C-0765H. in Flood Zone " X" DESCRIPTION: LOT 184, according to the plat of "WYNDHAM PRESERVE" thereof as recorded in Plat Book 81, page 93 of the Public Records of Seminole County, Florida ie•• r:r This certifies Nalco eu pf the hereon described property was made undep`my jpii the Standards of 555 Winderley Place, Suite 109 Maitland, FL 32751 L&' ppSs,meets Practice aP bbyy}}pp FWTTdIi Boyrd of Professional Phone: (321) 270-0440 Surveyor Qrat Cfi' ho I%' ' Florida Administrative Fax: (813) 248-2266 code, pL 1:.10 Slit n F)2g2 .71orlda Statutes. Licensed Business No. LB 7768 STAT " ro q GeoPoint s; Surveying, Inc. eS D. 'ei+li;vNe;Dt • M LS6915 RIMPROfESSIOWAr,SURVETOR•C MAPPER N0. ._...._..._.... Drawn: MTP Checked:JDL P.C.: Data File:01tiot ast-Flat Gate: 10/23/17 Dwg; Itr6sonfmt-laltbe Order No.: ram• NOT VALID WITHOUT THE SIGNATURE AND THE ORIGINAL RAISED SEAL Of A ORI SEO SU R AND MAPPER SEC. 17 - TWN. 20 S. - RNG. 31 E. I Field Sk: IV TRI-COUNTY TESTING LABORATORIES, INC. a 31 South Main Street Project Order No:: VQVLWinter Garden, Florida 34787 Report No: 8 407-656-9656 project: Wyndham Preserve Lot 18 Contractor. Starlight Homes Location: Building Pad Material: Tan Sand Date Tested: 10-20-17 REPORT OF W-PLACE DENSITY TESTS Proctor. Specification: Optimum Moisture: Maximum Dry Density: ASTMD-1557 12.2% 105.2 Location Depth Inches Dry rJensity lhs.cu.ft. Max. Dry Density Ibs.cu.ft. Percent of Max. Density Moisture Percent Northeast 0-12 103.5 105.2 98.3 98.6 9.7 9.8 Northwest 0-12 103.8 105.2 105.2 98.0 9.2 Center 0-12 103.1 103.1 105.2 98.5 9.4 Southeast 0-12 103.1 105.2 98.0 9.1 Southwest 0-12 e CITY OF SANFORD BUILDING & FIRE PREVENTION PERMIT APPLICATION Application No:) %— ) y S Documented Construction Value: $ f LpJ Job Address: `I aq I, [r} - t!rrox) Qc u Historic District: Yes No Parcel ID• Residential Commercial Type of Work: New Add`it ion Alteration Repair Demo Change of Use Move Description of Work: NPw J h, rr, /1 7 D /, t , , n A Plan Review Contact Person: Title: Phone: Fax: Email: Property Owner Information L'nName Phone: 1,4 - - 37 Street:) - - P_ j 1 a Resident of property? ; ( City, State Zip: 3 1-( y rr / Contractor Information 1 Name Y C ( Phone: c l Street: C. 2 Fax: City, State Zip: rr State License No.: Architect/Engineer Information Name: Phone: Street: Fax: City, St, Zip: E-mail: Bonding Company: Mortgage Lender: Address: Address: WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOURPAYINGTWICEFORIMPROVEMENTSTOYOURPROPERTY. A NOTICE OF COMMENCEMENT MUST BERECORDEDANDPOSTEDONTHEJOBSITEBEFORETHEFIRSTINSPECTION. IF YOU INTEND TO OBTAINFINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OFCOMMENCEMENT. Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installation hascommencedpriortotheissuanceofapermitandthatallworkwillbeperformedtomeetstandardsofalllawsregulatingconstructioninthisjurisdiction. I understand that a separate permit must be secured for electrical work, plumbing, signs, wells, pools, furnaces, boilers, heaters, tanks, and air conditioners, etc. FBC 105.3 Shall be inscribed with the date of application and the code In effect as of that date: 5" Edition (2014) Florida Building Code Revised: June 30, 2015 Permit Application i NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may befoundinthepublicrecordsofthiscounty, and there may be additional permits required from other governmental entities such as watermanagementdistricts, state agencies, or federal agencies. Acceptance of permit is verification that 1 will notify the owner of the property of the requirements of Florida Lien Law, FS 713. The City of Sanford requires payment of a plan review fee at the time of permit submittal. A copy of the executed contract is requiredinordertocalculateaplanreviewchargeandwillbeconsideredtheestimatedconstructionvalueofthejobatthetimeofsubmittal. The actual construction value will be figured based on the current ICC Valuation Table in effect at the time the permit is issued, inaccordancewithlocalordinance. Should calculated charges figured off the executed contract exceed the actual construction value, credit will be applied to your permit fees when the permit is issued. OWNER'S AFFIDAVIT: I certify that all of the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. Signature of Owner/Agent Date Print Owner/Agent's Name Signature of Notary -State of Florida Date Owner/Agent is Personally Known to Me or Produced ID Type of ID 17gnatureofContractor/Agent Date nt Contractor/Agent's Name Signature of Notary -State of Florida Date PAMELA S TERNUS Commission I GG 110622 Expires August?.2021 Of/t• 8an0adtAu6uEpttNataryBanloes Contractor/Agent i Personally Known to Me or Produced ID T of ID BELOW IS FOR OFFICE USE ONLY Permits Required: Building Electrical Mechanical Plumbing[] Gas[] Roof Construction Type: Occupancy Use: Flood Zone: Total Sq Ft of Bldg: Min. Occupancy Load: # of Stories: New Construction: Electric - # of Amps Plumbing - # of Fixtures Fire Sprinkler Permit: Yes No # of Heads Fire Alarm Permit: Yes No APPROVALS: ZONING: UTILITIES: WASTE WATER: ENGINEERING: FIRE: COMMENTS: BUILDING: Revised: June 30, 2015 Permit Application CITY OF SANFORD BUILDING & FIRE PREVENTION PERMIT APPLICATION Application No: II ,, Documented Construction Value: $ '} 1 (D Job Address: 1 D) % h/, r ht j Parcel ID: Historic District: Yes ElNo Residential] Commercial Type of Work: N = L,'J Alteration Repairp Demo Change of Use Move Description of Work: 150 (Irk /O <: 0 A Plan Review Contact Person: Title: Phone: Fax: Email: Property Owner Information Name Phone: '4 - ZPL47-3 Street:/ Resident of property? : City, State Zip: Contractor Information Name m 1 P{It Phone: Street: _Jock 1 Fax: I'arl Sq"T City, State Zip: In041State 407- License No.: C G2 Architect/ Engineer Information 1( 7(K p Name: Phone: Street: Fax: City, St, Zip: E-mail: Bonding Company: Address: Mortgage Lender: Address: WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOUR PAYINGTWICEFORIMPROVEMENTSTOYOURPROPERTY. A NOTICE OF COMMENCEMENT MUST BE RECORDEDANDPOSTEDONTHEJOBSITEBEFORETHEFIRSTINSPECTION. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. Application is hereby made to obtain a permit to do the work and installations as indicated. 1 certify that no work or installation has commencedpriortotheissuanceofapermitandthatallworkwillbeperformedtomeetstandardsofalllawsregulatingconstructioninthisjurisdiction. 1 understand that a separate permit must be secured for electrical work, plumbing, signs, wells, pools, furnaces, boilers, heaters, tanks, and air conditioners, etc. FBC 105.3 Shall be inscribed with the date of application and the code in effect as of that date: 5" Edition (2014) Florida Building Code Revised: June 30, 2015 Permit Application NOTIC : In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may befoundinthepublicrecordsofthiscounty, and there may be additional permits required from other governmental entities such as watermanagementdistricts, state agencies, or federal agencies. Acceptance of permit is verification that I will notify the owner of the property of the requirements of Florida Lien Law, FS 713. The City of Sanford requires payment of a plan review fee at the time of permit submittal. A copy of the executed contract is requiredinordertocalculateaplanreviewchargeandwillbeconsideredtheestimatedconstructionvalueofthejobatthetimeofsubmittal. The actual construction value will be figured based on the current ICC Valuation Table in effect at the time the permit is issued, inaccordancewithlocalordinance. Should calculated charges figured off the executed contract exceed the actual construction value, credit will be applied to your permit fees when the permit is issued. OWNER'S AFFIDAVIT: I certify that all of the foregoing information is accurate and that all work willbedoneincompliancewithallapplicablelawsregulatingconstructionandzoning. Signature of owner/Agent Date Print Owner/Agent's Name Signature of Notary•State of Florida Date Owner/Agent is Personally Known to Me or Produced ID Type of ID iD aJ17i?g - ofConuactor/Agent Date SS-. Print Contactor/Agent's Name Signature of Notary -State of Florida Date Iuk PAMELA S TERNUS Commission p GG 110622 P` Expires August7.2021 lop not Soma Tin Budget NotarySw*a Contractor/Agent is Personally Known to Me or Produced ID ype of ID BELOW IS FOR OFFICE USE ONLY Permits Required: Building Electrical Mechanical Plumbing[] Gas[] Roof Construction Type: Occupancy Use: Flood Zone: Total Sq Ft of Bldg: Min. Occupancy Load: # of Stories: New Construction: Electric - # of Amps Plumbing - # of Fixtures Fire Sprinkler Permit: Yes No # of Heads Fire Alarm Permit: Yes No APPROVALS: ZONING: UTILITIES: WASTE WATER: ENGINEERING: FIRE: COMMENTS: BUILDING: Revised: June 30, 2015 Permit Application CITY OF SANFORD BUILDING & FIRE PREVENTION PERMIT APPLICATION y Application No: / Documented Construction Value: S 4,636.00 Job Address: 4029 Nay* gt(n Dove. Historic District: Yes No Parcel ID: 17-20-31-502-0000-1840 Residential 0 Commercial Type of Work: New X Addition Alteration Repair Demo Change of Use Move Description of Work: Install New AC with Duct Work and Venting Plan Review Contact Person: Arionna Rosenwinkel Phone: 407-886-3729 ext. 163 Fax: Title: Pre -Construction Coordinator Email: arosenwinkel@energyair.com Property Owner Information Name STARLIGHT HOMES FLA LLC Phone: Street: 1064 Greenwood Blvd Suite 124 City, State Zip: Lake Mary, FL 32746 Resident of property? : NO Contractor Information Name Energy Air Inc (Robert Kulp) Phone: 407-886-3729 Street: 5401 Enegry Air Ct Fax: City, State Zip: Orlando FL 32810 Name: Street: City, St, Zip: Bonding Company: Address: State License No.: CAC1816317 Architect/Engineer Information Phone: Fax: E-mail: Mortgage Lender: Address: WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. A NOTICE OF COMMENCEMENT MUST BE RECORDED AND POSTED ON THE JOB SITE BEFORE THE FIRST INSPECTION. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installation has commenced prior to the issuance of a permit and that all work will be performed to meet standards of all laws regulating construction in this jurisdiction. I understand that a separate permit must be secured for electrical work, plumbing, signs, wells, pools, furnaces, boilers, heaters, tanks, and air conditioners, etc. FBC 105.3 Shall be inscribed with the date of application and the code in effect as of that date: 51' Edition (2014) Florida Building Code Revised: June 30, 2015 Permit Application NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may be found in the public records of this county, and there may be additional permits required from other governmental entities such as water management districts, state agencies, or federal agencies. 1. Acceptance of permit is verification that I will notify the owner of the property of the requirements of Florida Lien Law, FS 713. The City of Sanford requires payment of a plan review fee at the time of permit submittal. A copy of the executed contract is required in order to calculate a plan review charge and will be considered the estimated construction value of the job at the time of submittal. The actual construction value will be figured based on the current ICC Valuation Table in effect at the time the permit is issued, in accordance with local ordinance. Should calculated charges figured off the executed contract exceed the actual construction value, credit will be applied to your permit fees when the permit is issued. OWNER'S AFFIDAVIT: I certify that all of the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. Signature of Owner/Agent Date Print Owner/Agent's Name Signature of Notary -State of Florida Date Owner/Agent is Personally Known to Me or Produced ID Type of ID A/—Z//0000-- 11/14/17 Signature of Con for/Agent Date Robert Kulp Print Contractor/Agent ' Name 11/14/17 Signature of Notary -State of Florida Date Z lic State of Florida Rosenwinkel ssion GG 147038 er w 10112021 Contractor/AgePersonally Known to Me or Produced ID Type of ID BELOW IS FOR OFFICE USE ONLY Permits Required: * Building Electrical Mechanical Plumbing[] Gas[] Roof Construction Type: Occupancy Use: Total Sq Ft of Bldg: Min. Occupancy Load: Flood Zone: of Stories: New Construction: Electric - # of Amps Plumbing - # of Fixtures Fire Sprinkler Permit: Yes No liL•'a l l ENGINEERING: COMMENTS: of Heads UTILITIES: FIRE: Fire Alarm Permit: Yes No WASTE WATER: BUILDING: Revised: June 30, 2015 Permit Application CITY OF SANFORD BUILDING & FIRE PREVENTION PERMIT APPLICATION Application No: Lt Documented Construction Value: S 4.636.00 Job Address: _4017 N+g1nt RU)C.1 l(wt. Historic District: Yes No Parcel ID: 17-20-31-502-0000-1860 Residential 0 Commercial Type of Work: New X Addition Alteration Repair Demo Change of Use Move Description of Work: Install New AC with Duct Work and Venting Plan Review Contact Person: Arionna Rosenwinkel Title: Pre -Construction Coordinator Phone: 407-886-3729 ext. 163 Fax: Email: aoosenwinkel@energyair.com Property Owner Information Name STARLIGHT HOMES FLA LLC Phone: Street: 1064 Greenwood Blvd Suite 124 Resident of property? : NO City, State Zip: Lake Mary, FL 32746 Contractor Information Name Energy Air Inc (Robert Kulp) Phone: 407-886-3729 Street: 5401 EnegryAir Ct Fax: City, State Zip: Orlando FL 32810 Name: Street: City, St, Zip: Bonding Company: Address: State License No.: CAC1816317 Architect/ Engineer Information Phone: Fax: E- mail: Mortgage Lender: Address: WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. A NOTICE OF COMMENCEMENT MUST BE RECORDED AND POSTED ON THE JOB SITE BEFORE THE FIRST INSPECTION. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installation has commenced prior to the issuance of a permit and that all work will be performed to meet standards of all laws regulating construction in this jurisdiction. I understand that a separate permit must be secured for electrical work, plumbing, signs, wells, pools, furnaces, boilers, heaters, tanks, and air conditioners, etc. FBC 105.3 Shall be inscribed with the date of application and the code in effect as of that date: 511 Edition (2014) Florida Building Code Revised: June 30. 2015 Permit Application NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may be found in the public records of this county, and there may be additional permits required from other governmental entities such as water management districts, state agencies, or federal agencies. Acceptance of permit is verification that I will notify the owner of the property of the requirements of Florida Lien Law, FS 713. The City of Sanford requires payment of a plan review fee at the time of permit submittal. A copy of the executed contract is required in order to calculate a plan review charge and will be considered the estimated construction value of the job at the time of submittal. The actual construction value will be figured based on the current ICC Valuation Table in effect at the time the permit is issued, in accordance with local ordinance. Should calculated charges figured off the executed contract exceed the actual construction value, credit will be applied to your permit fees when the permit is issued. OWNER'S AFFIDAVIT: I certify that all of the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. Signature of Owner/Agcnt Date Print Owner/Agent's Name Signature of Notary -State of Florida Date W—,/ /, 11/14/17 Signature ofContr ctor/Agent Date Robert Kulp Print Contractor/Alecnt's Name n 11/14/17 Signature of Notary' -State of Florida 0 Fialphr_ Notary Public State of FloAft Arionna C Rosenwinkel My Commission GG 147038 E cpires 10101Q021 Owner/Agent is Personally Known to Me or Contractor/Agent is _X-, _ Personally Known to Me or Produced ID Type of ID Produced ID Type of ID BELOW IS FOR OFFICE USE ONLY Permits Required: Building Electrical Mechanical Plumbing Gas[] Roof Construction Type: Total Sq Ft of Bldg: Occupancy Use: Flood Zone: Min. Occupancy Load: # of Stories: New Construction: Electric - # of Amps Plumbing - # of Fixtures Fire Sprinkler Permit: Yes No # of Heads Fire Alarm Permit: Yes No APPROVALS: ZONING: COMMENTS: UTILITIES: WASTE WATER: ENGINEERING: FIRE: BUILDING: Revised: June 30, 2015 Permit Application WORK ORDER iAh A- 'A'A'JdR Date: 8/2/2017 144709 Subdivision I Phase I Bld I L/U Blk BILL TO: Starlight Homes - AWH Lot / Sub: Wyndham Preserve 1 1186 4017 Night Heron DrADDRESS: 1064 Greenwood Blvd Ste 124 Job Address: Sanford I F 132773CITY/STATE/ZIP: Lake Mary, FL 32746 City / State / Zip 1981 SModel/Bldg: Order Taken By: Equipment Brand: Carrier 14 Seer Heat Pum R-410a A/H-2 or FurnaceJobContact: S Woolwine A/H-1 or Furnace FB4CNP030L00 Job Phone: 4077301311 Heater or Coil CE2401 C05 Heater or Coil Date Requested: CU-1 CH14NB03000G CU-2 Date Required: T'Stat: TH6220D1002 T'Stat: Filter Base AHU Location N/A 1st FI Int Closet Filter Base AHU LocationPermitInformation: Efficiency 14.00 SEER / 8.2 HSPF Efficiency MUST BE ACCURATE AND COMP A/H-3 or Furnace A/H-4 or Furnace_ Heater or Coil Heater or Coil Bldg. Permit# CU-3 CU-4 Township: Sanford T'Stat: T'Stat: Filter Base Filter Base AHU Location AHU Location Incl. on Builders Permit no Efficiency Efficiency Zoning Brand: Honeywell/Johnstone Vent. Damper Y0150A1017 oty 1EAIPullsPermit: yes Builder calls inspection: yes Zone Kit #1 ZD1 EAI calls inspection: no Zone Kit #2 ZD2 Thermostats ZD3 Ventilation Cost: 319.01 Transformer ZD4 Surge Protector ZD5 ByPass Damper #1 ZD6 B Pass Damper #2 ZD7 PO Numbers Qty Yes No Qty. Yes No Grs.Stamped Stl. 15 X Flue Pipe: X Grs.Stamped Returr 8 X Filter Base X Grs.White S/A Adj. X Mery 8 Filter X Grs. R/A White Alun 1 X Elect. Air Cl. X Kit. Hood Duct: X Conc. Slab: X Kit. Down Draft Duct X Heat Recovery: X fan 80 cfm BF080 2 X Fresh Air: 1 X fan lite BFQF70 X Bath Exh. Duct: X Dryer Vent: 1 X Special Instructions Or Comments: Accounting Department: Job # Invoice Due Date: Estimated Estimated Task - Description Hours Cost 2.20 27.72 Rou hin 2.283.0003-Fabrication Labor 24.63 369.4504-Installation Labor 06-Piping Labor 7.00 119.00 Trim 2 283.00 14-Kitchen Vent Trim 1.162.7102-Material/Tax 1.339.7701-EquipmentlTax 80.00 Permit 70.0009-PermittOther 1.30 16.38011-Delivery Labor 2.60 32.75 Total Contract: 4,636.0020-Pull Material Labor 2.50 42.5012-StartupLabor ENVIRONMENTS FOR Li pv0 p,r r,,k V; 1-1- 04- 6 SITE 10: 30NO LOT:184 BLOCK HOUSE, 4029 STREET: NOW HERON OR CITY: SANFORD STATE FL DP: 32771 COUNTY: SEMINOLE ACCOUNTR OMISTAFL BUILDER: STARLIGHT HOMES SUBOMSION: WYNDHAM PRESERVE COMMUNITY: WA PLAN: NOP 101tY1017 PROGRAM: HERS TESTER: ENVIRONMENTS FOR LMNO PROGRAM IECC: 2008 CLIMATE 210NE: PROPERTY OWNER: PROPERTY ADDRESS: FL, SANFORD TEST: BLOWER DOOR RESULT: PASS TESTER: Daea Revob OATS 01=02016 TEST NAME OORRECTWN NE EO BUILDER VERIFIED RATER VERIFIED WA S.1 Attic Access Panel ssketed and insulated x 53 Athc dm Star sketed and insular x 5.e Recessed Lighung Fixtuna QCAT labeled and sealed to d O) x 5 5 Mole4muse Fan insulated gasketed to the opening x 7.3 Fresh air ventdabon insta0ed per program specs x Bbww Dolor SO To" BO AtbW Room Ptusum Tam BUILDING ORIENTATION PROGRAM VOLUME CODE VOLUME PROGRAM SHELL OOOE SHELL 70 WA 16,163 0 0 PROGRAM CFM 50 CODE CFM 50 PROGRAM ACH 50 CODE ACH SO PROGRAM of Shell CODE d Shd 0 12,156 7 1.106 3.6 Ma1r 6 MetBttm 0 BAm2 0 S*m3 0 Btftm S 0 Rm 1 0 Pin 31 0 1 Othw 0 Bdnn 0 Rm 2 0 CO Datemom EnwW SW Oudfmd andam U000 Package? 40 or s Of Hardwired Lloft Mrl Be CFL Or LED Low Flow fautlma, Ta0eb ft? Thenllme 7 x CadClad Omn Ptopoi LovelRatpdioe Marl hupecdon Maehanldl Sylown Been Laaelon Manlhmlter Name ModM t1 me" a Mom ol Motw M SYSTEM I WATER HEATER GARAGE AO SMITH ENT 50 110 SYSTEM 2 WATER HEATER SYSTEM 3 WATER HEATER SYSTEM a WATER HEATER SYSTEM 1 FURNACE SYSTEM 1 HVAC OUTDOOR UNIT OUTSIDE CARRIER CH14NB030 SYSTEM 1 HVAC INDOOR COIL SYSTEM 1 HVAC AHU (HEAT INTERIOR CARRIER FSeCNP030 SYSTEM FURNACE SYSTEM 2 HVAC OUTDOOR UNIT SYSTEM 2 HVAC INDOOR COIL SYSTEM 2 HVAC AMU (HEAT PUMP SYSTEM 3 FURNACE SYSTEM 3 HVAC OUTDOOR UNIT SYSTEM 3 HVAC INDOOR COIL SYSTEM 3 HVAC AHU (HEAT PUMP) SYSTEMa FURNACE SYSTEM HVAC OUTDOOR UNIT SYSTEM I HVAC INDOOR COIL SYSTEM I HVAC AHU (HEAT PUMP BUILDINO SPMFIGTIONS BUILDING CHARACTERISTICS AS DESIGN -VALUES AS BUILT -VALUES COMMMENT a OF BEDROOMS (REM) NA NA CEILING FLAT REM NA NA SEALED ATTIC (REM) NA NA VAULTED CEILING (REM) NA NA FOUNDATION WALLS REM NA NA EXPOSED FLOOR REM) NA HA ABOVE GRADE WALLS (REM) NA NA DUCT SUPPLY R-VALUE REM NA NA DUCT RETURN R-VALUE (REM) NA NA PROGRAMMABLE THERMOSTATS PRIF) YES WATER HEATER TYPE PRIF WATER HEATER FUEL TYPE PRIF TEST: BLOWER DOOR RESULT: PASS TESTER: Om RaaOa DATE: 01=201e BUILOINO SPECIFICATIONS BUILDING CHARACTERISTICS AS DESIGN -VALUES ASSUILT-VALUES COMMMENT WATER HEATER SIZE. EFFICIENCY 8 LOCATION PRIf) INFILTRATION HOUSE LKG) ACH (REM) NA 3.8 : 3.8 ACH 50 Pasuls FRESH AIR VENTILATION TYPE (PRIF) AIR CYCLER VENTILATION FAN MANUFACTURER (REM) NA NA VENTILATION FAN MODEL a (REM) NA NA VENTILATION FLOW REQUIRED (REM) NA NA VENTILATION EQUIP. RATED CFM REM NA NA VENTILATION 9 OF FANS REM NA NA VENTILATION TIME - HRSIOAY SPECIFIED (REM) NA NA VENTILATION TIME SET BY HVAC CONTRACTOR - MINUTES PER HOUR PRIF FRESH AIR VENTILATION FAN WATTS REM NA NA MEASURED FAN WATTS OR PER MANUFACTURER'S SPECS(PRIF) INTERIOR % OF CFCS (PRIF) DISHWASHER (PRIF) REFRIGERATOR (PRIF) FOUNDATION TYPE (PRIF) SLAB TYPE(PRIF) SLAB AREA (PRIF) SLAB DEPTH (PRIF) SLAB FULL PERIMETER (PRIF) SLAB GRADE(PRIF) FLOW RING(PRIF) HEATING REM NA NA COOLING REM NA NA AIR -SOURCE HP REM NA NA WATER HEATING REM NA NA TEST: DUCT BLASTER RESULT., PASS TESTER: Om Raw DATE: 012320IS TOTAL CONDITIONED FLOOR AREA ° 1 1.981CFASQFT) DUCT LEAKAGE TO OUTSIDE % TARGET TOTAL DUCT LEAKAGE % TARGET 0.00% t2.00% SYSTEM 1 80 FT. SERVED (CFA) 0 1,981 POST CONSTRUCTION SYSTEM t DUCT LEAKAGE TO OUTSIDE 0 15e SYSTEM i DUCT LEAKAGE TO OUTSIDE SYSTEM I DUCT LEAKAGE TO OUTSIDE CFM2M TARGET (CFM25) ACTUAL 83 (% OF CFA) ACTUAL In SYSTEM 1 TOTAL DUCT LEAKAGE SYSTEM 1 TOTAL DUCT LEAKAGE SYSTEM ITOTAL DUCT LEAKAGE (%Of CFM25) TARGET ° 2] e (CFM25) ACTUAL CFA) ACTUAL NaN% 0.00% SYSTEM 2 SO FT. SERVED (CFA) 0 0 SYSTEM 2 DUCT LEAKAGE TO OUTSIDE SYSTEM 2 DUCT LEAKAGE TO OUTSIDE SYSTEM 2 DUCT LEAKAGE TO OUTSIDE CFM25) TARGET ° ° (CFM25) ACTUAL (% OF CFA) ACTUAL SYSTEM 2 TOTAL DUCT LEAKAGE SYSTEM 2 TOTAL DUCT LEAKAGE SYSTEM 2TOTAL DUCT LEAK44E(%OF CFM25) TARGET ° ° ( CFM2$) ACTUAL CFA) ACTUAL SYSTEM 3 60 FT. SERVED (CFA) 0 0 SYSTEM 3 DUCT LEAKAGE TO OUTSIDE SYSTEM 3 DUCT LEAKAGE TO OUTSIDE SYSTEM 3 DUCT LEAKAGE TO OUTSIDE CFIOS) TARGET ° ° ( CFM25) ACTUAL (% OF CFA) ACTUAL SYSTEM 3 TOTAL DUCT LEAKAGE 0 0 SYSTEM 3 TOTAL DUCT LEAKAGE SYSTEM 3 TOTAL DUCT LEAKAGE (% OF CFM2M TARGET ( CF '25) ACTUAL CFA) ACTUAL SYSTEM 4 60 FT. SERVED (CFA) 0 0 SYSTEM 4 DUCT LEAKAGE TO OUTSIDE SYSTEM I DUCT LEAKAGE TO OUTSIDE SYSTEM • DUCT LEAKAGE TO OUTSIDE CFM25) TARGET ° ° ( CFM2.5) ACTUAL (% OF CFA) ACTUAL SYSTEM 4 TOTAL DUCT LEAKAGE SYSTEM 4 TOTAL DUCT LEAKAGE SYSTEM 4 TOTAL DUCT LEAKAGE (% OF CFM25) TARGET ° ° ( CFM25) ACTUAL CFA) ACTUAL TEST: DUCT BLASTER RESULT: PASS TESTER: Da Rnieft DATE: OIMMI! AUILOINQ SPECIFICATIONS OLOU)ING'+CK4PACMRWM ASlOESiGt4=VALI.UES ABJBUILT -VALUES OOMYMENT DUCT LEAKAGE TO OUTSIDE (REM) NA . N , 1, Y "• : 0.032iCF,M25_/ICF,A TOTAL DUCT LEAKAGE REM NA iY ' •+ " • 0.12rCFM25 / CF,A .JW-'A'j' FLOW RING (PROF) FLORIDA ENERGY EFFICIENCY CODE FOR BUILDING CONSTRUCTION Form R405 Duct Leakage Test Report Performance Method Project Name: Wyndham Preserve Builder Name: Starlight Homes Street: 4029 Night Heron Dr Permit Office: City, State, Zip: Sanford, FL 32771 Permit Number: Design Location: Jurisdiction: Duct Test Time: Post Construction r)1)rt I aakana Tact Rac1 dtc CFM25 Duct Leakage Test Values Line System Outside Duct Leakage 1 System 1 63 cfm25(Out) 2 System 2 cfm25(Out) 3 System 3 cfm25(Out) 4 System 4 cfm25(Out) 5 Total House Duct System Sum lines 1-4 63 l.eekage Divide by 1981 Total Coramorad Fbot Area) 0.0318 (On,Out) I hereby certify that the above duct testing performance results demonstrate compliance with the Florida Energy Code requirements in accordance with Section R403.2.2. Digitally signed by Dave Revedo Oate. 2018.01.23 10.52.39 EST CN_Oavo Revode. O=TdpBudd r) /y) EHomoMAI Senaea.OU. y(p,, EMAILADORESS=dave.rovells Rater Of Record: oapoudd.com. C-US Printed Name: Dave Revelle RESNET tt: 4311088 Date: 01 /23/2018 Duct tightness shall be verified by testing to Section 803 of the RESNET Standards by an energy rater certified in accordance with Section 553.99, Florida Statutes. Building Official: Date: Thank you for allowing TopBuild the opportunity to provide the above services for you. Please feel free to contact me with any questions. 36298SEFL FLORIDA ENERGY EFFICIENCY CODE FOR BUILDING CONSTRUCTION Envelope Leakage Test Report Prescriptive and Performance Method Project Name: WYNDHAM PRESERVE Builder Name: STARLIGHT HOMES Street: 4029 Night Heron Or Permit Office: City, State, Zip: Sanford, FL 32771 Permit Number: Design Location: 4029 Night Heron Or (Lot 184), Sanford, FL 32771 Jurisdiction: Cond. Floor Area: 1981 Cond. Volume: 18483 Envelope Leakage Test Results Leakage Characteristics Regression Data: C: n: K CFM(50): 1108 ELA: 61 EgLA: 144 ACH: 3.6 SLA: .03 ACH(50) ' : 3.6 For prescriptive projects, tested leakage must be <=7 ACH(50). For performance projects, tested leakage must be <= the ACH(50) shown on Form R405-2014 for this project. Sinqle or Multi Point Test Data HOUSE PRESSURE FLOW: 1 50 Pa 1108 cfm 2 0 Pa 0 cim 3 0 Pa 0 cfm 4 0 Pa 0 cfm 5 0 Pa 0 cfm 6 Pa cfm R402.4.1.2 Testing.The building or dwelling unit shall be tested and verified as having an air leakage rate of not exceeding 7 air changes per hour in Climate Zones 1 and 2. Testing shall be conducted with a blower door at a pressure of 0.2 inches w.g. (50 Pascals). Testing shall be conducted by either individuals as defined in Section 553.993(5) or (7). Florida Statutes or individuals licensed as set forth in Section 489.105(3)(f). (g), or (i) or an approved third party. A written report of the results of the test shall be signed by the party conducting the test and provided to the code official. Testing shall be performed at any time after creation of all penetrations of the building thermal envelope. During testing: 1. Exterior windows and doors, fireplace and stove doors shall be closed, but not sealed, beyond the intended weatherstripping or other 2. Dampers including exhaust, intake, makeup air, backdraft and flue dampers shall be closed, but not sealed beyond intended infiltration 3. Interior doors, if installed at the time of the test, shall be open; 4. Exterior doors for continuous ventilation systems and heat recovery ventilators shall be closed and sealed; 5. Heating and cooling systems, if installed at the time of the test, shall be turned off. and 6. Supply and return registers, if installed at the time of the test, shall be fully open. I hereby certify that the above envelope leakage performance results demonstrate compliance with Florida Energy Code requirements in accordance with Section R402.4.1.2. Digitally signed by Dave Revelle C Date: 2018.01.23 10:52:44 EST n /yl me Revelle, O=TopBuild Hoe SHomeServices, OU, EMAILAODR ESS=dave.revelle Signature: Otopbuild.com, C=US Printed Name: Dave Revelle Date: 01/23/2018 Testing shall be conducted by either individuals as defined in Section 553.993(5) or (7). Florida Statutes or individuals licensed as set forth in Section 489.105(3)(f), (g), or (i) or an approved third party. A written report of the results of the test shall be signed by the third party conducting the test and provided to the code official. BUILDING OFFICIAL: DATE: Thank you for allowing TopSund the opportunity to provide the above services for you. Please feel free to contact me with any Questions. 102SM17 362989EFL ZTopBuild- TopBuild Home Services, Inc. — Performance Testing Certification TopBuild Home Services, Inc. has conducted BPI and/or RESNET/HERS testing on the following property. The information and results are outlined below. (Note: This document does not certify compliance with the entirety of the 2009 IECC. It certifies the results of the performance testing only). Builder. Starlight Homes Subdivielon: Wyndham Preserve Property Owner: Total Conditioned Floor Area: 1,981 ft 2 Permit Date/No.: Conditioned Volume: 18,483 ft 3 IECC Version: 2009 Property Address: 4029 Night Heron Dr, Sanford, FL 32771 Testing Performed 2009 IECC (Sec. 402.4.2.1 — Testing Air Leakage) Blower Door Test 01/23/2018 Measured Air Leakage: 1108 CFM @50Pa Result: PASS Air Infiltration: 3.6 Confirmed ACH ACH 50 Target 5 7 2009 IECC (Sec. 403.2.2 — Testing Duct Leakage) Duct Blaster Test 01=018 System 1 Duct Leakage: N/A Result: N/A Confirmed Leakage: 0.00% DL % Target 5 12.00% Phase Post Construction CFA: 1,981 ft 2 System 2 Duct Leakage: N/A Result: N/A Confirmed Leakage: N/A DL % Target 5 N/A Phase N/A N/A System 3 Duct Leakage: N/A Result: N/A Confirmed Leakage: N/A OL % Target 5 N/A Phase NIA N/A Digitally signed by Dave Revelle Date: 2018.01.23 10.52:31 EST Rater Of Record- (+ Yn /, CN=Dave Revelle.O=TopBuild RESNET #: 4311088 Home Services, OU, EMAILAOORESS=dave.revelle 01/23/2018 a topbuild.com, C=US BPI Certification #: N/A Thank you for allowing TopBuild Home services, Inc. the opportunity to provide the above services for you Please feel free to oontact me v4lh any questions Sincerely, Dave Revelle Cell: (386) 681-7452 4 dave.revelle®topbuild corn p J10a1rOAOw-1% 475 N Williamson Blvd. Daytona Beach, FL 32114 (866) 912-7233 % Na 798489 77ds Ibmr, was yrwrarW tom EFL Acilact M&Wer, propo* of Top&dM Home S-1004 I- t c''corrwTlarP` e.., cli 1 N 25.00. S 89'43'03" in11 U Uz 10 U N ^ FBI ^ O3o 3I Q cn E a. o0 v O Z I PCP FINAL BOUNDARY .SURVEY WYNDHAM PRESERVE - LOT 184 z a Olt uWYNDHAMPRESERVE LOT 184 o J -,,, PB 81, PG 93) w o00 v Z%z c c c dv 'o -0 0 m iP 1 25.3' LOT 183 LINE OF LOT 184 LOT 216 SIR 29.7' i i wyU y E ai o A/C; h in N I•" I N PAD, fp w ICONC WALK E, 11.3 1 STORY OI o I RESIDENCE LOT 184 p LOT 215 127.3' COVERED n 4029 PORCH NIGHT HERON 8.0 wAREA = 9. 3 DRIB z , 6, 900 S.F. t I G o FFE= 27.63' W H cYi O CONCRETE DRIVEWAY N N Nin p 50. 0 37.7' t0 Z I SIR I 13. 0 2s ? s 115.00' S89W 0.Y Building Setbacks Setbacks: Per construction plans for WYNDHAM PRESERVE", City of Sanford, Seminole County, Florida. Front = 25' Rear = 20' Side = 7.5' LOT 185 BUnMING LAYOUT NOTE: Contractor and owner are to verify all setbacks, building dimensions, and layout shown hereon prior to any construction, and immediately advise GeoPoint Surveying, Inc. of any deviation from information shown hereon. Failure to do so will be at user's sole risk. rcr, - roof menc iLEGEND:ADUSSD-Access/Drainage/Utilities/Sidewalk LB -Licenseded8FP-BaekflowPreveneven sterSi9 ht Distance Easement S -Survey PRM -Permanent Ref. Monument R -Reported PCP -Permanent Control Point D -Description FP&L -Florida Power & Light P -plot FFE -Finish Floor Elevation D. . -Deed Book Water Meter O.R. - Official Records Book D4 -Water Valve P.B.- Plat Book tf--Fire Hydrant Pg.-Page RCU -Reclaimed Water Meter Elev.-Elevation RCD4-Reclaimed Water Valve Conc. -Concrete Cable Box BP -Brick Paver m -Telephone Box SW -Sidewalk El -Electric Box FFE -Finished Floor Elevation 0-Utility Pole CI -Curb Inlet Guy Pole GTI -Grote Top Inlet Light Pole P.U. E.-Public Utility Easement E--Guy Anchor RCP -Reinforced Conc. Pipe OU--Overhead Utilities PVC -Polyvinyl Chloride o-Storm Sewer Manhole NCS-No Comer Set (Falls in Water) m-Sanitary Sewer Manhole SF -Square Feet DfHo -Electric Handhole D.U. E.-Drains a Utility Easement Coo -Clean Out FMGD-MAG NAI &DISK CV04-Irrigation Control Valve P.K.- Porker Kolon Nail I* -Sign SIR -Set 1/2" Iron Rod LB7768 WD4-Gate Water Valve SPKD -Set P.K. & Disk LB7768 Gas Meter FIR -Found 1/2" Iron Rod L87768 1 . -Existing Grade FIP-Found 1/2" Iron Pits LB7768 cl-Blow-off Valve FPKD-Found P.K. Nail &Disk LB7768 -&---Drainage Flow Direction FCM -Found 4"x4" Concrete t 0.0 -Proposed Design Grade Description I Date I Dwn.ICk'd I P.C.IOrder No. SURVEYOR'S NOTES: 1. Current title information on the subject property had not been fumished to GeoPoint Surveying, Inc. at the time of this survey, and is subject to title review and/or abstract. GeoPoint Surveying, Inc. makes no representations or guarantees pertaining to easements, rights -of - way, set back lines, reservations, agreements, and other similar matters. 2. This survey is limited to above ground visible improvements, and that nothing below the ground was located including, but not limited to foundations (footings), utilities, etc. 3. Elevations shown hereon are in feet and are referenced to the NATIONAL GEODETIC VERnCAL DATUM OF 1929 (NGVD29). 4. This Survey is subject to matters shown an the plat of DRAM PRESERVE% City of Sanford Seminole County, Florida. 5. Additions or Deletions to survey maps or reports by other than the signing party or parties is prohibited without the written consent of the signing party or parties. 6. This survey is intended to be displayed at 1" 20'. 7. All boundary line dimensions are field measured unless otherwise noted. LOT 214 DEMENSION NOTE: Proposed building dimensions shown hereon are of the exterior. PREPARED FOR ASHTON WOODS FLOOD ZONE: The property shown hereon is on the Federal Emergency Management Agency's Flood Insurance Rate Map Panel Number 12127C-0765H. in Flood Zone "A" DESCRIPTION: LOT 184, according to the plat of " WYNDHAM PRESERVE" thereof as recorded in Plat Book 81, page 93 of the Public Records of Seminole County, Florida Last Date of Field Survey: 1 22 2018 555 Winderley Place, Suite 109 This certifies that a survey of the hereon described property Maitland, FL 32751 was made under my supervision and meets the Standards of Phone: (321) 270-0440 Practice set forth by the Florida Board of Professional Fax: (813) 248-2266 Surveyors & Mappers in Chapter 5J-17, Florida Administrative Licensed Business NO. LB 7768 code, pursuant to Section 472.027, Florida Statutes. / GeoPoint Surveying, Inc. 9mes D. Leviner LS6915 Drawn: MTP Checked:JDL P.C.: Data FlIe:8r6sonEast-Plat ORIDA PROFESSIONAL SURVEYOR & MAPPER NO . ................. NOT VALID WITHOUT THE SIGNATURE AND THE ORIGINAL Date: 1/ 27/18 Dwg:9rIssonEast-1ot184 Order No.: ED SEAL OF A FLORIDA LICENSED SURVEYOR AND MAPPER SEC. 17 - TWN. 20 S. - RNG. 31 E. I Field Bk: r--