The URL can be used to link to this page

Home My WebLink About3780 Orlando Dr - BC02-001610 (LOWES - NEW CONSTRUCTION) DOCUMENTSy, C7 C PERMIT ADDRESS ®y Ly tc& SUBDIVISION in CONTRACTOR ADDRESS I I PHONE NUMBER PROPERTY OWNER ADDRESS 0 0 L' I I I I 1. N c 2.,8(66 PHONE NUMBER GSS 4060 ELECTRICAL CONTRACTOR Ej-H tMECHANICALCONTRACTORC, J'A k PLUMBING CONTRACTOR MISCELLANEOUS CONTRACTOR PERMIT NUMBER FEE - - MISCELLANEOUS CONTRACTOR PERMIT NUMBER FEE PERMIT # o Z - I n In DATE IZldl PERMIT DESCRIPTION 1 tl tl-) PERMIT VALUATIONS, cm., 00 SQUARE FOOTAGE 1-701 CAD C s Component Performance Method for Commercial Buildings Form 40OB-97 ENERGY EFFICIENCY CODE FOR BUILDING CONSTRUCTION Florida Department of Community Affairs FLA/COM-97 Version 2.2 PROJECT NAME_Lowes - Sanford, FL ADDRESS: Sanford, FL OWNER: Lowes AGENT: BUILDING TYPE: _Mercantile (Retail) CONSTRUCTION'CONDITION: New construction DESIGN COMPLETION: _Finished Building CONDITIONED FLOOR AREA: _130480 MAX. TONNAGE OF EQUIPMENT PER SYSTEM: COMPLIANCE CALCULATION: PERMITTING OFFICE: Sanford CLIMATE ZONE: _5 PERMIT NO: M - b( JURISDICTION NO: 691500 235 NUMBER OF ZONES: 4 METHOD B DESIGN CRITERIA RESULT NO ENVELOPE CALCULATIONS PERFORMED FAILED LIGHTING INTERIOR LIGHTING 229008.00 504629.76 PASSES LIGHTING CONTROL REQUIREMENTS PASSES HVAC EQUIPMENT COOLING EQUIPMENT 1. EER 11.00 8.20 PASSES IPLV 11.00 7.50 PASSES 2. EER 11.00 8.50 PASSES IPLV 11.00 7.50 PASSES 3. EER 12.00 8.90 PASSES IPLV 12.00 8.30 PASSES 4. EER 11.00 8.90 PASSES IPLV 11.00 8.30 PASSES HEATING EQUIPMENT 1. Et 1.00 N/A 2. Et 1.00 N/A 3. Et 1.00 N/A AIR DISTRIBUTION SYSTEM INSULATION REQUIREMENTS 1. No Ducts 0.00 0.00 N/A 2. No Ducts 0.00 0.00 N/A 3. Unconditioned Space 4.20 4.20 PASSES 4. Unconditioned Space 4.20 4.20 PASSES REHEAT SYSTEM TYPES USED NO REHEAT SYSTEM is USED WATER HEATING EQUIPMENT 1. EF 1.00 0.88 PASSES PIPING INSULATION REQUIREMENTS 1. Non -Circulating 1.00 1.00 PASSES COMPLIANCE CERTIFICATION: I hereby certify that the plans and Review of the plans and specifica- specifications.covered by this calcu- tions covered by this calculation lation are in compliance with the Florida Energy Efficiency Code. PREPARED BY: DATE: I hereby certify that this building is in compliance with the Florida Energy Efficiency Code L E)WNEAGENT: OW 9 DATE:- A - OZ indicates compliance with the Florida Energy Efficiency Code. Before construction is completed, this building will be inspec,ed for compliance in accordanc with Section 553.908, Florida S atutes. BUILDING OFFICIAL: DATE: I hereby certify(*) that the system design is in compliance with Energy Efficiency Code. SYSTEM DESIGNER REGISTRATIOAT%STA ARCHITECT +l MECHANICAL: PLUMBING'.;= ELECTRICAL: "T 1;,;, r LIGHTING /,,hx',.e . of Signature is required where Florida law re ire desigrP.,tp;'b by registered design professionals. Typed names and registrai on be used where all relevant information is contained on sign*"e s,- --- v / ida BUILDING ENVELOPE SYSTEMS COMPLIANCE CHECK 401------- GLAZING --ZONE 1------------------------------------------------ v- Elevation Type U SC VLT Shading Area(Sgft) East Commercial 0.92 .8 .8 None 357 Total Glass Area in Zone 1 = 357 401.------GLAZING--ZONE 2------------------------------------------------ v- Elevation Type U SC VLT Shading Area(Sgft) Adjacent Commercial 1.26 0.01 None 0 Total Glass Area in Zone 2 = 0 401.------GLAZING--ZONE 3------------------------------------------------ v- Elevation Type U SC VLT Shading Area(Sgft) Adjacent Commercial 1.26 0.01 None 0 Total Glass Area in Zone 3 = 0 401.------GLAZING--ZONE 4------------------------------------------------ v- Elevation Type U SC VLT Shading Area(Sgft) Adjacent Commercial 1.26 0.01 None 0 Total Glass Area in Zone 4 = 0 Total Glass Area = 357 402.------WALLS--ZONE 1------------------------------------------------ Elevation Type U Insul R Gross(Sgft) North 12" cmu with 2" int ins. 0.14 0 3696 East 12" cmu with 2" int ins. 0.14 0 9984 South 12" cmu with 2" int ins. 0.14 0 3696 Total Wall Area in Zone 1 = 17376 402.------WALLS--ZONE 2------------------------------------------------ Elevation Type U Insul R Gross(Sgft) North 12" cmu with 2" int ins. 0.14 0 4632 South 12" cmu with 2" int ins. 0.14 0 3528 West 12" cmu with 2" int ins. 0.14 0 8160 Total Wall Area in Zone 2 = 16320 402.------WALLS--ZONE 3------------------------------------------------ Elevation Type U Insul R Gross(Sgft) South 12" cmu with 2" int ins. 0.14 0 1032 West 12" cmu with 2" int ins. 0.14 0 2232 Total Wall Area in Zone 3 = 3264 402.------WALLS--ZONE 4------------------------------------------------ Elevation Type U Insul R Gross(Sgft) Adjacent NO WALL 0.000 0 0 Total Wall Area in Zone 4 = 0 Total Gross Wall Area = 36960 403.------DOORS--ZONE 1------------------------------------------------ Elevation Type U Area(Sgft) Adjacent No doors 0.00 0 Total Door Area in Zone 1 = 0 403.------DOORS--ZONE 2------------------------------------------------ Elevation Type U Area(Sgft) is Adjacent No doors 0.00 0 Total Door Area in Zone 2 = 0 403.------DOORS--ZONE 3 ------------------------------------------------ Elevation Type U Area(Sgft) Adjacent 4" Glass Door with Steel Frame .3 0 Total Door Area in Zone 3 = 0 403.------DOORS--ZONE 4 ------------------------------------------------ Elevation Type U Area(Sgft) Adjacent No doors 0.00 0 Total Door Area in Zone 4 = 0 Total Door Area = 0 404------- ROOFS --ZONE I ------------------------------------------------ Type Color U Insul R Area(Sgft) Mtl Bldg Roof/R-19 Batt White .051 19 66708 Total Roof Area in Zone 1 = 66708 404.------ROOFS--ZONE 2 ------------------------------------------------ Type Color U Insul R Area(Sgft) Mtl Bldg Roof/R-19 Batt White .051 19 93750 Total Roof Area in Zone 2 = 93750 404.------ROOFS--ZONE 3 ------------------------------------------------ Type Color U Insul R Area(Sgft) Mtl Bldg Roof/R-19 Batt White .051 19 3854 Total Roof Area in Zone 3 = 3854 404.------ROOFS--ZONE 4 ------------------------------------------------ Type Color U Insul R Area(Sgft) Mtl Bldg Roof/R-19 Batt White .051 19 175 Total Roof Area in Zone 4 = 175 Total Roof Area = 164487 405.------FLOORS-ZONE 1 ------------------------------------------------ Type Insul R Area(Sgft) Slab on Grade/Uninsulated 6 66249 Total Floor Area in Zone 1 = 66249 405.------FLOORS-ZONE 2 ------------------------------------------------ Type Insul R Area(Sgft) Slab on Grade/Uninsulated 6 93528 Total Floor Area in Zone 2 = 93528 405.------FLOORS-ZONE 3 ------------------------------------------------ Type Insul R Area(Sgft) Slab on Grade/Uninsulated 6 3854 Total Floor Area in Zone 3 = 3854 405.------FLOORS-ZONE 4 ------------------------------------------------ Type Insul R Area(Sgft) Slab on Grade/Uninsulated 6 175 Total Floor Area in Zone 4 = 175 Total Floor Area = 163806 406.------INFILTRATION --------------------------------------------------- I CHECK Infiltration Criteria in 406.1.ABCD have been met. A MECHANICAL SYSTEMS CHECK HVAC load sizing has been performed. (407.1.ABCD) 407 COOLING SYSTEMS----------------------------------------------- Type No Efficiency IPLV Tons 1. Air'Cooled ( >= 65,000 Btu/h 1 11 11 235.00 2. Air Cooled ( >= 65,000 Btu/h 1 11 11 40.00 3. Air Cooled ( >= 65,000 Btu/h 1 12 12 6.00 4. Air Cooled ( >= 65,000 Btu/h 1 11 11 10.00 408.------HEATING SYSTEMS----------------------------------------------- Type No Efficiency BTU/hr 1. Electric Resistance 1 1 122880 2. No Heating System 0 0 0 3. Electric Resistance 1 1 10200 4. Electric Resistance 1 1 0102400 409.------VENTILATION Ventilation Criteria in 409.1.ABCD have been met. 1CHECK 410.-----AIR DISTRIBUTION SYSTEM---------------------------------------- CHECK Duct sizing and design have been performed. (410.1.ABCD) AHU Type Duct Location R-value 1. Packaged Constant Volume No Ducts 0 2. Packaged Constant Volume No Ducts 0 3. Packaged Constant Volume Unconditioned Space 4.2 4. Air Conditioners Unconditioned Space 4.2 CHECK Testing and balancing will be performed. (410.1.ABCD) 411.-----PUMPS AND PIPING -ZONE ----------------------------------------- Basic prescriptive requirements in 411.1.ABCD have been met. PLUMBING SYSTEMS 411------ PUMPS AND PIPING -ZONE Type 1. Circulating 411------ PUMPS AND PIPING -ZONE Type 1. Circulating 411------ PUMPS AND PIPING -ZONE Type 1. Non -Circulating 411------ PUMPS AND PIPING -ZONE Type 1. Circulating R-value/in Diameter Diameter Thickness 0 0 0 2 --------------------------------------- R-value/in Diameter Thickness 0 0 0 3 --------------------------------------- R-value/in Diameter Thickness 4 .75 1 4 --------------------------------------- R-value/in Diameter Thickness 0 0 0 412.-----WATER HEATING SYSTEMS -ZONE 1 ---------------------------------- Type Efficiency StandbyLoss InputRate Gallons j a 412.-----WATER HEATING SYSTEMS -ZONE 2---------------------------------- --- Type Efficiency StandbyLoss InputRate Gallons 412.-----WATER HEATING SYSTEMS -ZONE 3---------------------------------- --- Type Efficiency StandbyLoss InputRate Gallons 1. <=12 kW 1 0 30717 40 412.-----WATER HEATING SYSTEMS -ZONE 4---------------------------------- --- Type Efficiency StandbyLoss InputRate Gallons ELECTRICAL SYSTEMS CHECK 413.-----ELECTRICAL POWER DISTRIBUTION---------------------------- ----- --- Metering criteria in 413.1.ABCD have been met. 414.-----MOTORS --------------------------------------------------- ----- --- Motor efficiencies in 414.1.ABCD have been met. 415.-----LIGHTING SYSTEMS -ZONE 1--------------------------------------- --- Space Type No Control Type 1 No Control Type 2 No Watts Area(Sgft) Type C(Mas 1 Central Contro 1 Central Contro 1 196040 123420 Total Watts for Zone 1 = 196040 Total Area for Zone 1 = 123420 415------ LIGHTING SYSTEMS -ZONE 2--------------------------------------- --- Space Type No Control Type 1 No Control Type 2 No Watts Area(Sgft) Accounting 1 Central Contro 1 None 3996 6380 Total Watts for Zone 2 = 3996 Total Area for Zone 2 = 6380 415.-----LIGHTING SYSTEMS -ZONE 3--------------------------------------- --- Space Type No Control Type 1 No Control Type 2 No Watts Area(Sgft) Type C(Mas 1 Central Contro 1 24620 24254 Total Watts for Zone 3 = 24620 Total Area for Zone 3 = 24254 415.-----LIGHTING SYSTEMS -ZONE 4--------------------------------------- --- Space Type No Control Type 1 No Control Type 2 No Watts Area(Sgft) Toilet and 1 Stepped-3 Leve 2 4352 680 Total Watts for Zone 4 = 4352 Total Area for Zone 4 = 680 Total Watts = 229008 Total Area = 154734 CHECK Lighting criteria in 415.1.ABCD have been met. 16. Operation/maintenance manual will be provided to owner.(102.1) U ` ham, Inc.. Consulting Engineers, Surveyors,&. Landscape Architects P.O. Box 1105 • 265 Kenilworth Avenue • Ormond Beach, Florida 32174 386) 672-9515 • FAX (386) 573-6554 • LB#'0003612 • LC# 0000357 Visit us at: www:uphaminc.coiri , January 27, 2003 City of Sanford Building Division y P. O. Box 1788 Sanford, FL.32772-1788 Re_: Lowe 's Home Improvement Warehouse F 3780 S. Orlando Drive Sanford, FL 32771 To. - Dan M:. Florian, CBO The finished floor elevation of the structure located' at 3780.S: Orlando•Drive Lot 3, Live Oak Center) meets or exceeds the requirements set. forth in the. , City of Sanford Code Chapter 6, Sec. 6-7(a): , Sincerely, r . William S Hart, PSM #3905 J• i` i' M v rt ` is C:VNy Documents\lowes senford\finislwd floor elm ion.doc I-tUtKAL1:MtKUhNUT MANAUt:MtNI AUt:NL;T O.M.B. No. 3067-0077 NATIONAL FLOOD INSURANCE PROGRAM Expires July 31, 2002 --;; ELEVATION CERTIFICATE Important: Read the instructions on Daces I.7. SECTION A - PROPERTY OWNER INFORMATION FalisuranceCarpai- Use',", BUILDING OWNER'S NAME _ _ , ... , ; Policy Number-7-- Lowe's Home Centers, Inc. BUILDING STREETADDRESS (Including Apt, Unit, Suite, and/or Bldg. No.) OR P.O. ROUTE AND BOX NO. Company ; t- NAIC Number ' 3780 S. Orlando Drive :' r c'" -r CITY STATE ZIP CODE Sanford FL 32771 PROPERTY DESCRIPTION (Lot and Block Numbers, Tax Parcel Number, Legal Description, eta) BUILDING USE (e.g., Residential, Non-residential, Addition, Accessory, eta Use a Comments area, I necessary.) Non -Residential - LATI UDE/LONGTTUDE (OPTIONAL) HORIZONTAL DATUM: SOURCE: 0 GPS (Type): _ 9 - ##.#Ar or ##.#a #f!7 NAD 1927 NAD 1983 USGS Quad Map Other. SECTION B - FLOOD INSURANCE RATE MAP (FIRM) INFORMATION B1. NFIP CON7VIl1Nff Y NAME & COMMUNITY NUMBER W- COUNTY NAME W. STATE d imm I Seminole FL ` B4. NAP AND PANEL B5. SUFFIX B7. FIRM PANEL B9. BASE FLOOD ELEVATION(S) NUMER 86. FlRM INDEX DATE EFFECTNSPEASED DATE B8. FLOOD ZONE(S) Zane AO, use depth of flooding) 12117CO(?45 E 4117f95 4117/95 X 39fl B10. Indicate the source of the Base Flood Elevation (BFE) data or base flood depth entered in B9. FIS Profile ® FIRM Community Determined Other (Describe): B11. Indicate the elevation datum used for the BFE in B9: ® NGVD 1929 NAVD 1988 Otimer (Describe): B12. Is the building located in a Coastal Barrier Resources System (CBRS) area or Oterwise Protected Area (OPA)? Yes ® No Designation Date _ SECTION C - BUILDING ELEVATION INFORMATION (SURVEY REQUIRED) . C1. Building elevations are based on: Construction Drawings' ' Building Under Construction* ® Finished Constriction A new Elevation Certificate will be required when construction of the building is complete. CZ Building Diagram Number I (Select the building diagram most similar to the building for which this certificate is being completed - see pages 6 and 7. 9 no diagram accurately represents the building, provide a sketch or photograph) C3. Elevations — Zones Al-A30, AE, AH, A (with BFE), VE, V1430, V (with BFE), AR, ARIA, AR/AE, AR/A1 •AW, AR/AH, ARIAO Complete Items C3.a4 below according to the buikflrg diagram specified in Item C2. State the datum used. 9 the datum is di ferent from the datum used for the BFE in Section B, convert the datum to that used for the BFE. Shore field measurements and datum conversion calculation. Use the space provided or the Comments area of Section D or Section G, as appopriate, to document the datum conversion. Datum NGVD 29 ConversiayCormnents Elevation reference mark used Does the elevation reference marts used appear on the FIRM? Yes ® No o a) Top of bottom floor (including basement or enclosure) 48. 2 0) o b) Top of next higher floor WA . o c) Bottom of lowest horizontal structural member (V canes only) o d) Attached garage (top of slab) WA _1t(m) e g . ° • , a '' o e) Lamest elevation of machinery and/or equipment UP Qn servicing the building (Describe in a Comments area) _ fl (m) E F • r . , t ' o f) Lowest adaoent (finished) grade (LAG) 47.8 R(m) i o g) Highest a4 ( grade (HAG) 48. RAM y 3 M • ?• .. . •• ` ' o h) No. of permmanerd openings (flood vents) within 11L above adjacent grade WA ;!;•;t1 itp I3,.`` o ) Total area of all permanent openings (flood vents) in C3.h NIA sq. in. (sq. cm) . +n,,,,,+<•• SECTION D - SURVEYOR, ENGINEER, OR ARCHITECT CERTIFICATION This certification is to be signed and sealed by a land surveyor, engineer, or architect authorized by law to certify elevation information. 1 certify that the information in Sections A, B, and C on this certificate represents my best efforts to interpret the date available. I understand that any false statement may be punishable by fine or imprisonment under 18 U.S. Code, Section 1001. CERTIFIERS NAME VWbn S Hart LICENSE NUMBER 3905 TITLE Professional Surveyor and Mapper COMPANY NAME Upham Inc. - ADDRESS CITY STATE.— , ZIP CODE 255Kenilworth Avenue _ - OrmordBeach R 32174 DATE TELEPHONE 127103 ( 386)672-9515 .•: FEMA Form 81-31, JUL 00 SEE REVERSE SIDE FOR CONTINUATION REPLACES ALL PREVIOUS EDITIONS — era+ r f; i ; ,t-..-- IMPORTANT: In these spaces, copy the corresponding information from Section A. I FQr Inswame Can6aim 3780 S. Orlando Drive " CRY STATE ZIP CODE C npany WUC Number , Sarnrad _ . - _ _ , • _ _.. .... FL 32771 M _ . . w;:.•v:.....:.....: «_ . J SECTION D - SURVEYOR, ENGINEER, OR ARCHITECT CERTIFICATION (CONTINUED)....• Copy both sides ofthis Elevation Certificate for (1) cormunily, drdal, (2) insurance agentkornpany, and (3) building owner. _ COMMENTS WO 020618 Fle: Sanford Lowre's Check here if attachments SECTION E - BUILDING ELEVATION INFORMATION (SURVEY NOT REQUIRED) FOR ZONE AO AND ZONE A (WITHOUT BFE) Fa Zone AO and Zone A (wilhout BFE), complete Items E1 through E4. If the Elevation Certificate is intended for use as supporting information far a LOMA or LOMR-F; Section C rnrst be completed. I - ..... _ .. .. _ _.__ ... Ell. Building Diagrarn Number _(Select ft building diagram most simlar to the buikiug for which this certificate is being completed - see pages 6 and 7. If no diagram accurately the buuldug, provide a sketch or photograph.) , EZ The top d m flthebott000r (including basement or enclosure) of the buildup is _ t(m) _in.(on) above or belm (check one) the highest adjacent grade. (Use natural grade, if available). - E3. For Building Diagrams 68 with openings (see page 7), the next higher floor or elevated floor (elevation b) d the building is _ t(m) _in.(on) above the highest adjacent grade. Complete items C3.h and C3J on iront of form. E4. For Zane AO only: If no flood depth number is available, is the top of the bottom floor elevated in accordance with the s floodplain management ordnance? Yes No UnknaNn. The oral oWal must certify this iribmation in Section G. • • I' SECTION F _ PROPERTY OWNER (OR OWNER'S REPRESENTATW CERTIFICATION The properly owner or owner's autamed representative who cornpletes Sections A. B, C (Iterns C3h and C3.i only), and E for Zone A (without a FEMAmissued or oommunity- issued BFE) a Zane AO rust sign here. The statements in Sections A, B, C, and E are correct tote best d rry knauledkle.`_. PROPERTY OWNER'S OR OWNER'S AUTHORIZED REPRESENTATIVE'S NAME - ADDRESS CITY STATE DP CODE SIGNATURE DATE TELEPHONE COMMENTS Check here if attachments SECTION G - COMMUNITY INFORMATION (OPTIONAL) The local dficlai whb is authorized by lawn or ordinance to administer ft communiys tloodplain management ordnance can complete Sections A, B, C (or E), and G d finis Elevation Cerl fete: Canplete ft applicable itern(s) and sign belay. _ G1. The information in' ectionCwas taken from other documentation that has been signed and embossed by a licensed surveyor, engineer, or architect who is authorized by state or bcal law to ca* elevation Wm natim. (Indicate the source and date d the elevation data in the Cornrrnents area below.) G2. A oanrx *' dfidal completed Sedm E for a building located in Zone A (willW a FEMAassued or coa nunityassued BFE) or Zone A0. G3. The fdlouring inbm-k ion (!tans G4-G9) is provided for corununily floodplain managerent purposes. CA. PERMR NUN®ER W. DATE PF.RNIIT ISSUM W. DATE CERTIFICATE OF COMPLIAME10MIPANCY ISSUED t , Z. y . . _.. .. .. „• .. •'tin - • G7. This pernit has been issued fo:. New ConsIndon Substantial Improvement ... _ .».._... _ G8. Elevation d as -built lowest floor (including basement) of the building is - ` ILM . _ Daturn: G9. BFE or('n Zone AO) depth of flooding at the building site is: _• _ R(m) Datum: LOCAL OFFICIAL'S NAME TITLE COMMUNITY NAME TELEPHONE .. SIGNATURE I.. DATE M ::i+,.. . . :'- COMMENTS, - - - - -- - - - - ----- — r r`':.."ak,t • - : `" „' ' Check here daltachmenis ' FEMA Form 81.31, JUL 00 - REPLACES ALL PREVIOUS EDITIONS Z. 2i; •{ •'.;M» ..-.. ,'r. f-a r r 7 ' t • .,_ rS. ; n:.f r , ,; x CITY OF SANFORD MECHANICAL PERMITAPPLICATION 1.". 'r ...W.° Permit Number. 6 2- 1(n10 Date: Z-^ O Z The undersigned hereby applies for a permit to install the following equipment: Owners Name: 'Ol e S Address of Job: _520D 5- 091-4 V r-> D A VS Mechanical Contractor: r I` f`iG cf 7 Residential Non -Residential it I I_ iL ' / i - Job Valuation: r.'o Application1 1 TOTAL DUE: fir ++ By signing this application, I am stating that t am in compliance with City of Sanford Mechanical Code. /n Applicant Signature State License Number a BUILDING DIVISION OF COMMUNITY & ECONOMIC DEVELOPMENT DEPARTMENT REQUEST FOR AFTER HOURS INSPECTIONS PROCEDURE In the event that a permitted construction project requires after hours or weekend inspections, the following provides the guidelines for requesting this service. TO BE COMPLETED BY THE REQUESTING CONTRACTOR DATE: 10// /0 - PERMIT NUMBER: 0= PROPERTY ADDRESS: TYPE OF INSPECTION INSPECTION NAME_ DATE NEEDED 10 BUILDING MECHANICAL FIRE Cc // TIME NEEDED PLUMBING_ ELECTRICAL Fees: Weekend and Holiday Inspections: $48.00 ner hour with a 4 hour minimum. Weekday inspections: $48 00 per hour with a 2-hour minimum for inspections requested after 5:00p.m. and before 8:00 a.m. In order to obtain an after hours inspection, the following shall be met: 1. The request will be made in writing and brought to the Building Department and fees paid before noon on the day that the inspection/inspections are needed. If the inspection service is requested for a weekend, the request and fee will be paid before noon on the Friday preceeding the weekend The approval from the Building Official is required prior to requesting the inspection service. 2. The term after hours shall mean that time after 5:00 p.m. and prior to 8:00 a.rrm 3. Any additional time over two (2) hours will be billed in one- (1) hour increments. 4. Any additional time over four (4) hours will be billed in one- (1) hour increments. 5. If the inspection is already on record for the particular day in question, there must be an emergency reason given to and approved by the Building Official before any fees are collected. REASON: CONTRACTOR SIGNATURE DATE /19/10/o2 APPROVED BUILDING OFFICIAL: S t DATE: IV-29 BUILDING DIVISION OF COMMUNITY & ECONOMIC DEVELOPMENT DEPARTMENT REQUEST FOR AFTER HOURS INSPECTIONS PROCEDURE In the event that a permitted construction project requires after hours or weekend inspections, the following provides the guidelines for requesting this service. TO BE COMPLETED BY THE REQUESTING CONTRACTOR DATE: I oA /02 PERMIT NUMBER: O, PROPERTY ADDRESS:. TYPE OF INSPECTION: INSPECTION N, DATE NEEDED 1/fio C/n19o7do BUILDING MECHANICAL FIRE own Le It PLUMBING ELECTRICAL TIME NEEDED S/oo fQ.y, Fees: Weekend and Holiday Inspections: $48.00 per hour with a 4 hour minimum. Weekday inspections: $48 00 per hour with a 2-hour minimum for inspections requested after 5:00 p.m. and before 8:00 a.m. In order to obtain an after hours inspection, the following shall be met: 1. The request will be made in writing and brought to the Building Department and fees paid before noon on the day that the inspection/inspections are needed. If the inspection service is requested for a weekend, the request and fee will be paid before noon on the Friday preceeding the weekend. The approval from the Building Official is required prior to requesting the inspection service. 2. The term after hours shall mean that time after 5:00 p.m. and prior to 8:00 a.m 3. Any additional time over two (2) hours will be billed in one- (1) hour increments. 4. Any additional time over four (4) hours will be billed in one- (1) hour increments. 5. If the inspection is already on record for the particular day in question, there must be an emergency reason given to and approved by the Building Official before any fees are collected. REASON: CONTRACTOR SIGNATURE APPROVED BUILDING OFFICIAL: DATE: IV-29 I C; 74 - --1 & - DATE CITY OF SANFORD PERNIIT APPLICATION eagallwamb Permit No.: lJ 2 - 18 to LDate: Job Address: CFAA900 M SA+I i Fi- Permit Type: t/' Building Electrical Mechanical Plumbing Fire Alarni/Sprinkler Description of Work: Wktr- Additional Information for Electrical & Plumbing Permits Electrical: _Addition/Alteration _Change of Service — Temporary Pole _New AMP Service (# of AMPS ) Plumbing/Residential: Addition/Alteration New Construction (One Closet Plus Additional) Plumbing/Commercial: Number of Fixtures Number of Water & Sewer Drainage Lines Number of Gas Lines Occupancy Type: _Residential Xcommercial _ Industrial Total Sq Ftg: Value of Work: $ Z-5,0= Type of Construction: Parcel No.: -[-U-16,0-'goo roZUo- Flood Zone: Number of Stories: Number of Dwelling Units: Go-3p_9Soo - 0%8t' (Attach Proof of Ownership & Legal Description) Owner/Address/Phone: I-Olcl tS owlE- G£TE s I[L , O 1$Ei 000tao F o ' t3ox 11 l 1 Contractor/Address/Phone:_ MAVto5" Co JSM G ,ry,4 IJC- 04 S' 'F^ - State License Number. G CQ C- OSZO31¢. Contact Person: I SS '``< Phone & Fax Number: 5 U 3 -(V80 -2Z4,'5 6 03 4060 - Z 54-3Title Holder (If other than Owner): t X Address: Bonding Company: IS Address: Mortgage Lender: Pt Address: Architect/ Engineer Address: P.O. wis Phone No.:-3e(P- Ct7Z -is/ 5, Fax No.: 3 bU - (073 - t'p§E Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installation has commenced prior to the issuance of a permit and that all work will be performed to meet standards of all laws regulating construction in this jurisdiction. I understand that a separate permit must be secured for ELECTRICAL WORK, PLUMBING, SIGNS, WELLS, POOLS, FURNACES, BOILERS, HEATERS, TANKS, and AIR CONDITIONERS, etc. OWNER' S AFFIDAVIT: I certify that all of the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may be foundinthepublicrecordsofthis. county, and there may be additional permits required from other governmental entities such as water management districts, state agencies, or federal agencies. 0 Acceptance of permit is verification that I will notify the owner of the property of the requirements of Florida. Lien Law, FS 713. A_ 7-% U - 0 :)- igna a of er/Agent Date Sign ture of Print weer/Agent' ame Print Contra Signature of tary-State of Florida Date Signature of KATHRYN K. SIMMS Notary Publk State of Florida My CommtPersonally eucp. Nov. 1, 2003 CNo. CC8W4 Owner/ Agent is Known to Me or Produced ID ZAgent Agent' Name try - State of Florida KATHRYN K. SIMMS Notary Public, State of Florida My tmaan, a*. Nov.1, 2003 Comm. NoXCC886314 J • n Date 0 n Z Date L 4 4 L; Contractor/ Agent is Personally Known to Me or Produced ID t APPLICATION APPROVED BY: Special Conditions: fr?V& Date: % - 17- - I n vim .,.., .. .. ....... NAME i IFS '' S teMCE OF COMMENCEMENT Permit No. Arim.20 • boX Tax Folio No. // - Z o - 30 - 300 - OZ bo - 0000 State of Florida S} WI 0 ' 43 - `E F - o oop ounty of Seminole ? II - Z 0 - 3 - 3 o c - o/ g, C, - oO C. c The undersigned hereby gives notice that improvement will be made to certain real property, and in accordance with Chapter 713, Florida Statutes, the following information is provided in this Notice of Commencement. 1. Description of property: (legal description of the property and street address if available) SEE .4TTA(HCI—" 2. General description of improvement: Co»7"IIL/Z pf;, BOILb/0C4 1-.,'1rf-/ Sr3VW&j.lrq!X `i9ULiTlC S. PR VC 3. Owner information a. Name and address Lot -as".- Home Ct/u7- S AX- . 7• U'oX ////. 'VoRn-/ J/CKCS i Zoy 4).C.5G-00p1 b. Interest in property OWNEIZ c. Name and address of fee simple titleholder (if other than Owner) L-> 4. Contractor a. Name and address 14AYt0B (A Ca4SrWC4)t9 , IftI G U S . 0 33ex>1 b. Phone number Fax number O _ Z 5. M Surety a. Name and address b. Phone number Fax number C. Amount of bond Lender a. Name and address /c b. Phone number Fax number 7. Persons within the State of Florida designated by Owner upon whom notices or other documents may be served as provided by Section 713.13(1)(a)7., Florida Statutes: a. Name and address 0/4- b. Phone number Fax number 8. In addition to himself or herself Owner designates IZ 1 C-H A 12 b Ci C>b rn,40 of LptaI S H0rn2 CEJ. MMS _ WC . to receive a copy of the Lienor's Notice as provided in Section 713.13(1)(b), Florida Statutes. a. Phone number 5 t l - q 43, - /q (ol Fax number (v 3 • / y (o 9. Expiration date of notice of commencement (the expiration date is I year from the dat f recording less a different date is specified) Z. a ZW'04 I atdre of Ownerj'/IIIG "aA. Sworn to (or affirmed) and subscribed before me this alit day of n c , 20 OoL , by 4"6Ael !,J we, no/a/S Personally Known OR Produced Identification JUN 2 6 2002 Type of Identification Produced NARYWgE KOINE, CLERK OF CIRCUIT COURT CERTIFIED COPYC—LEW OF MINGLE COUNTY INARYANNE MORfi>aBK04445p(3 0850 FILE NUM 2002900213 CLERK OF CIRGUIT ,COURT RECORDED 06je6/EOOE 1Er3Poi?5 PN SEMINOLE COMM E1AR1 signature of Notary Public, State of Bide N e ' REC0RD1N9 Fg 15.00 _ Commission Expires:. Rw BY N Holden — — OFFICIAL SEAL' Not NorthkCl line iflllgLIl N Igg181Aw M 101INalgnn111 Ann H. Miller mba he _ 12/2 LEGAL DESCRIPTION (LOWE'S SE SANFORD): PARCEL A A PORTION OF THE MOSES E. LEVY GRANT, SECTION 37, A PRIVATE CLAIM AS SHOWN ON THE TOWNSHIP PLAT AND APPROVED ON SEPTEMBER 2, 1852, SAID GRANT ALSO KNOWN AS THE "SANFORD GRANT", AND ALSO KNOWN AS SECTION 11, ON VARIOUS DEEDS, ALL BEING IN TOWNSHIP 20 SOUTH, RANGE 30, EAST, SEMINOLE COUNTY, FLORIDA. BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS: AS A POINT OF REFERENCE AND THE POINT OF BEGINNING COMMENCE AT THE NORTHEAST CORNER OF BOULEVARD PLAZA SUBDIVISION AS RECORDED IN PLAT BOOK 58, PAGES 47 AND 48 OF THE PUBLIC RECORDS OF SEMINOLE COUNTY, FLORIDA, RUN THENCE NORTH 63 DEGREES 59 MINUTES 37 SECONDS WEST ALONG THE NORTH LINE OF SAID SUBDIVISION FOR A DISTANCE OF 400.00 FEET; THENCE SOUTH 25 DEGREES 38 MINUTES 37 SECONDS WEST A DISTANCE OF 100.00 FEET; THENCE NORTH 63 DEGREES 59 MINUTES 37 SECONDS WEST FOR A DISTANCE OF 760.61 FEET TO THE EAST RIGHT-OF-WAY LINE OF LIVE OAK BOULEVARD (A 60 FOOT RIGHT-OF-WAY); THENCE NORTH 25 DEGREES 41 MINUTES 50 SECONDS EAST ALONG SAID EASTERLY RIGHT-OF-WAY LINE, A DISTANCE OF 21.63 FEET TO A POINT OF CURVATURE, CONCAVE SOUTHWESTERLY AND TO THE LEFT, SAID CURVE HAVING A RADIUS OF 830.00 FEET, A CENTRAL ANGLE OF 59 DEGREES 14 MINUTES 46 SECONDS, A CHORD BEARING OF NORTH 03 DEGREES 55 MINUTES 33 SECONDS WEST, A CHORD DISTANCE OF 820,52; THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 858.25 FEET TO THE POINT OF TANGENCY THEREOF; THENCE NORTH 33 DEGREES 32 MINUTES 56 SECONDS WEST FOR A DISTANCE OF 6.77 FEET TO THE SOUTH LINE OF HIDDEN LAKE PHASE 111, UNIT IV, SUBDIVISION AS RECORDED IN PLAT BOOK 28, PAGES I AND 2; THENCE SOUTH 7§ DEGREES 34 MINUTES 47 SECONDS EAST ALONG THE SAID SOUTH LINE FOR A DISTANCE OF 692.52 FEET TO THE SOUTHEAST CORNER OF SAID SUBDIVISION; THENCE SOUTH 64 DEGREES 21 MINUTES 07 SECONDS EAST, FOR A DISTANCE OF 595.17 FEET; THENCE SOUTH 25 DEGREES 39 MINUTES 24 SECONDS WEST, FOR A DISTANCE OF 306.09 FEET TO A CURVE CONCAVE NORTHWEST AND TO THE LEFT, SAID CURVE HAVING A CENTRAL ANGLE OF 09 DEGREES 11 MINUTES 08 SECONDS, A RADIUS OF 200.00 FEET, A CHORD BEARING OF NORTH 77 DEGREES 12 MINUTES 28 SECONDS EAST, A CHORD DISTANCE OF 32.03 FEET; THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 32.06 FEET TO A POINT OF REVERSE CURVATURE CONCAVE SOUTHEASTERLY AND TO THE RIGHT, SAID CURVE HAVING A CENTRAL ANGLE OF 43 DEGREES 02 MINUTES 30 SECONDS, A RADIUS OF 200.00 FEET, A CHORD BEARING OF SOUTH 85 DEGREES 51 MINUTES 51 SECONDS EAST, A CHORD DISTANCE OF 146.74 FEET; THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 150.24 FEET TO THE POINT OF TANGENCY THEREOF; THENCE SOUTH 64 DEGREES 20 MINUTES 36 SECONDS EAST FOR A DISTANCE OF 96.77 FEET TO THE WEST RIGHT-OF-WAY LINE OF U. S. HIGHWAY 17-92 (RIGHT-OF-WAY VARIES); THENCE SOUTH 20 DEGREES 47 MINUTES 00 SECONDS WEST ALONG THE SAID WEST RIGHT-OF-WAY LINE FOR A DISTANCE OF 32.81 FEET; THENCE SOUTH 28 DEGREES 16 MINUTES 47 SECONDS WEST FOR A DISTANCE OF 197.90 FEET; THENCE SOUTH 16 DEGREES 29 MINUTES 25 SECONDS EAST FOR A DISTANCE OF 40.24 FEET TO A CURVE CONCAVE NORTHWESTERLY AND TO THE RIGHT, SAID .CURVE HAVING A CENTRAL ANGLE OF 00 DEGREES 16 MINUTES 22 SECONDS, A RADIUS OF 5654.65 FEET, A CHORD BEARING OF SOUTH 22 DEGREES 13 MINUTES 03 SECONDS WEST, A CHORD DISTANCE OF 26.91 FEET; THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 26.91 FEET; THENCE NORTH 64 DEGREES 20 MINUTES 36 SECONDS WEST LEAVING SAID WEST RIGHT-OF-WAY LINE OF U. S. HIGHWAY 17-92, FOR A DISTANCE OF 298.95 FEET; THENCE SOUTH 25 DEGREES 38 MINUTES 50 SECONDS WEST FOR A DISTANCE OF 190.77 FEET; THENCE SOUTH 64 DEGREES 21 MINUTES 11 SECONDS EAST FOR A DISTANCE OF 71.71 FEET; THENCE SOUTH 24 DEGREES 34 MINUTES 30 SECONDS WEST FOR A DISTANCE OF 56.07 FEET; THENCE SOUTH 64 DEGREES 21 MINUTES 1 I SECONDS EAST FOR A DISTANCE OF 250.00 FEET TO A POINT ON THE AFORESAID WEST RIGHT-OF-WAY LINE OF U. S. HIGHWAY 17-92, SAID POINT ALSO BEING ON A CURVE CONCAVE NORTHWESTERLY AND TO THE RIGHT, SAID CURVE HAVING A CENTRAL ANGLE OF 00 DEGREES 30 MINUTES 17 SECONDS, A RADIUS OF 5669.65 FEET; A CHORD BEARING OF SOUTH 25 DEGREES 06 MINUTES 38 SECONDS WEST, A CHORD DISTANCE OF 49.94 FEET; THENCE ALONG THE ARC OF SAID CURVE FOR A DISTANCE OF 49.94 FEET TO THE POINT OF BEGINNING. THE ABOVE DESCRIBED PARCEL CONTAINS 21.907 ACRES MORE OR LESS. Page I of 2 FILE NUM 2002900213 OR BOOK 04445 PAGE 0851 di PARCEL B A PORTION OF THE MOSES E.•LEVY GRANT, SECTION 37, A PRIVATE CLAIM AS SHOWN ON THE TOWNSHIP PLAT AND APPROVED ON SEPTEMBER 2, 1852, SAID GRANT ALSO KNOWN AS THE "SANFORD GRANT", AND ALSO KNOWN AS SECTION 11, ON VARIOUS DEEDS, ALL BEING IN TOWNSHIP 20 SOUTH, RANGE 30, EAST, SEMINOLE COUNTY,-FLORIDA. BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS: AS A POINT OF REFERENCE AND THE POINT OF BEGINNING COMMENCE AT THE SOUTHWEST CORNER OF HIDDEN LAKE PHASE III, UNIT IV, RECORDED IN PLAT BOOK 28, PAGES 1 AND 2, OF THE PUBLIC RECORDS OF SEMINOLE COUNTY, FLORIDA, RUN THENCE SOUTH 78 DEGREES 34 MINUTES 47 SECONDS EAST ALONG THE SOUTH LINE OF SAID SUBDIVISION FOR A DISTANCE OF 145.47 FEET; THENCE SOUTH 11 DEGREES 33 MINUTES 00 SECONDS WEST LEAVING SAID SUBDIVISION LINE FOR A DISTANCE OF 70.02 FEET; THENCE SOUTH 78 DEGREES 34 MINUTES 47 SECONDS EAST FOR A DISTANCE OF 224.22 FEET TO A POINT ON THE WEST RIGHT-OF-WAY LINE OF LIVE OAK BOULEVARD (A 60 FOOT RIGHT-OF-WAY), SAID POINT BEING ON A CURVE CONCAVE WESTERLY AND TO THE RIGHT, SAID CURVE HAVING A CENTRAL ANGLE OF 31 DEGREES 52 MINUTES 22 SECONDS, A RADIUS OF 770.00 FEET, A CHORD BEARING OF SOUTH 15 DEGREES 15 MINUTES 32 SECONDS EAST, A CHORD DISTANCE OF 422.83 FEET; THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 428.34 FEET; WHENCE SOUTH 78 DEGREES 58 MINUTES 50 SECONDS WEST LEAVING SAID WEST RIGHT-OF-WAY LINE FOR A DISTANCE OF 346.08 FEET; THENCE NORTH 1 1 DEGREES 01 MINUTE 10 SECONDS WEST FOR A DISTANCE OF 627.45 FEET TO THE POINT OF BEGINNING. THE ABOVE DESCRIBED PARCEL CONTAINS 4.072 ACRES MORE OR LESS. Prepared by: Upham, Inc. Engineers, Surveyors and Landscape Architects 265 Kenilworth Ave. Ormond Beach, FL 32174 i Page 2 of 2 FILE'NUM 2002900213 OR BOOK 04445 PAGE 0852 CITY OF SANFORD PERMIT APPLICATION Permit No.:CR v Jo— Date: 4/ 1 8/ 0 2 JobAddress:3780 S OrlaU o Dr San_fnrr], FT, 37773-5614 Parcel No.: 1129 39 399 018E , 93— (Attach Proof of Ownership &Legal Description) Description of Work: New commercial rotas}- st-r c;ture n Type of Construction: Flood Zone: X u if (' Valuation of Work: $.1 1 Odo Occupancy Type: _Residential Commercial Industrial Number of Stories: 1 Number of Dwelling Units: Zoning: Total Square Footage: 17 0 , 6 8 Owner. Lowe' s Home Centers Inc. Address: P.O. BOX 1111 City: North W; 1 ke3horn State: 1naZiP' 28651;i PhoneNo.: 336_658_ 000 Fax No.:336 6r$ 325' Contractor: MPc AK Gol Address: 1W S• IL+.f1(ljr[J City: L-&V-Fr1J"0 hone No.: V8 3 — it 50 ` Z i Contact Person: tAVwAgAo i Title Holder (If other than Owner): _ Address: Bonding Company: TBD Address: Mortgage Lender: N A Address: kie- s State: Ft. Zip:33f.501 State License No.: LC-1(- 046?.0 t 13 Fax No.: IBU3 — (0 80 — 7-443 Phone No.: Architect: Taylor Scott Architects, Inc. Phone No.: 918-587-8600 Address:1437 S. Boulder Ave., Tulsa, OK 74.119-360$,,No.: 918-587-8601 Application is hereby made to obtain a permit to do the work and installations as indicated. 1 certify that no work or installation has commenced prior to the issuance of a permit and that all work will be performed to meet standards of all laws regulating construction in this jurisdiction. 1 understand that a separate permit must be secured for ELECTRICAL WORK, PLUMBING, SIGNS, WELLS, POOLS, FURNACES, BOILERS, HEATERS, TANKS, and AIR CONDITIONERS, etc. OWNER'S AFFIDAVIT: 1 certify that all ofthe foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may be found in the public records of this county, and there may be additional permits required from other governmental entities such as water management districts, state agencies, or federal agencies. Acceptance of permit is verification that I will notify the owner of the property o the requirements of Florida Lien Law, FS 713. OZ &//I I ca Signature 9wnedAgent Date acute of Contra nt Date Roger W. Strcula P.E. S Print9wner/Agent's Na me Print Cont gent's Name Signature of Notary -State of Florida Date Si ature of Notary -State of Wrida Date MARILEE COLLINS NOTARY PUBLIC STATE OF FLORIDA COMMISSION NO. CC9M149 Ownw/Agent is nL Personally Known to Me or Produced ID APPLICATION APPROVED BY: Special Conditi JO ANN M. JOHNSON 4 # MY COMMISSION * CC 92IMS EXPIRES: March 23, 2004 Bondad Thru Budget Notary Services Con—ctor/Agentis —PersoMe or yC Prrjo duced ID -- b B 4—Z(l - - 7 Date: —1 7 "A 4•63' 019w •O COUNTY OF SEMINOLE IMPACT FEE STATEMENT STATEMENT NUMBER: 02100005 DATE: July 05, 2002 BUILDING APPLICATION #: 02-10000568 BUILDING PERMIT NUMBER: 02-10000560 UNIT ADDRESS: 3780 ORLANDO DR 11-20-30-300-0180-000O TRAFFIC ZONE:022 JURISDICTION: SEC: TWP: RNG: SUF: PARCEL: SUBDIVISION: TRACT: PLAT BOOK: PLAT BOOK PAGE: BLOCK: LOT: OWNER NAME: ADDRESS: APPLICANl NAME: LUWES HOME IMPROVEMNET ADDRESS: P O BOX 1111 NORTH WILKSBORO SANFORD FL LAND USE: L8WLS HOM[ TYPE USE: WORK DESCRI|`TI(X;C CITY'SAN[ORD FEE BENEFIT RATE UNIT CALC UNIT TOTAL DUE TYPE DIST SCHED RATE UNITS TYPE i ROADS- CO -WIDE ORD Retail 1O0K-299999 Oft... ROADS -COLLECTORS NORTH ORD 1,101.57 170.620 10OOnsft 187,949.07 Retail 1O0K-299999 Sqft 222.95 170.820 100Onsft 38,039.72 FIRE RESCUE N/A 0V LIBRARY N/A CH 8LS N/A 00 PARK3) N/A O LAW N/A 0 yRAINAGE N/A 0(/ AMOUNT DUE 225,989.59 STAT[MLNl RECEIVED BY: _\ Wt°_SIGNATURE: PLEASE PRINT NAME) DATE: ' NOTE TO TORECEIVING SIGNaTORY/APPLICANT: FAILURE TO NOTIFY OWNER AND K ENSURE TIMELY PAYMENT MAY RESULT IN YOUR LIABILITY FOR THE FEE. *h, \\ DISTRIBUTION: 1-BLDG DEPT 3-APPLICANT 2- FINANCE 4-LAND MANAGEMENT PERSONS ARE ADVISED THAT THIS IS A STATEMENT OF FEES DUE UNDER THE SEMINOLE COUNTY ROAD. " FIRE/RE8CUE LIBRARY AND/OR EDUCATIONAL PERSONS ARE ALSO ADVISED THAT ANY RIGHTS OF THE APPLICANT.OR OWNER., TO APPEAL THE CALCULATION OF ANY OF THE ABOVE MENTIONED IMPACT FEES T BE EXERCISED BY FILING A WRITTEN REQUEST WITHIN 45 CALENDAR OF THE RECEIVING SIGNATURE DATE ABOVE BUT NOT LATER THAN CERTIFICATEOCCUPANCY OR OCCUPANCY. THc EQU- T OR REVIEW MUST MEET THE REQUIREMENTS OF THE COUNTY LAND DEVELOPMENT CODE. COPIES OF RULES GOVERNING APPEALS MAY BE PICKED UP OR REQUESTED,. FROM THE PLAN IMPLEMENTATION OFFICE: 1101 EAST FIRST STREET, SANFORD FL, 32771; 407-685-7356. PAYMENT SHOULD BE MADE TO: SEMINOLE CO Y OR CITY BUILDING DE ME NT 1 1 EAST FI Sl ST EE SANFORD, FL 02771 PAYMENT SHOULD BE BY CHECK OR MONEY ORDER AND REFER ENCE THE COUNTY BUILDINGPERMIT NUMBER AT THE TOP LEFT OF THIS STATEMENT, THIS STATEMENT IS NO LONGER VALID IF,A BUILDING PERMIT ISNOT*** ISSUED WITHIN 60 CALENDAR DAYS OF IVING SIGNATURE DATE ABOVE DETAIL OF CALCULATION AVAILABLE UPON REQUEST. CALL 407-665-7356. OF SANFORD CITY OF SANFORD FIRE DEPARTMENT FEES FOR SERVICES HONE # 407-302-1091 * FAX #: 407-330-5677 DATE: e< PERMIT #: 11 BUSINESS NAME / PROJECT: ADDRESS: 44 4 PHONE NO.:I 1S""raJ FAX NO.( 33% tA 3a 6-7 CONST. INSP. [ ] C / O INSP.:[ ] REINSPECTION [ ] PLANS REVIEW Q F. A. [ J F.S. [ ] HOOD [ ] PAINT BOOTH [ ] BURN PERMIT J TENT PERMIT ] TANK PERMIT [ ] OTHER TOTAL FFEEE S .s- "3, L`I 3y 0 (PER UNIT SEE BELOW) 0+ COMMENTS: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. see PI, Address / Bldg. # / Unit # Square Footage Fees per Bldg. / Unit I Poe 0 Fees must be paid to Sanford Building Department, 300 N. Park Ave., Sanford, FI. 32771 Phone # -407- 330-5656. Proof of Payment must be made to Fire Prevention division before any further services can take place. I certify that the above is true and correct and that I will comply with all applicable codes and ordinances n of the City ASAnford, Florida. Sanford Fire Prevention Division ,,,Aoplicant's 941 Z 8636802509 MARCOBAY CONST. 364 PO4 JUN 27 '02 10:53 June 26, 2002 Mr Howard Bayless Marcobay Construction 16 S. Ktntucky A-vc Lakeland, FL 33801 I've calculated your permit fees for the Lowe's project located at 3780 Orlando Dr The feel applied to date are: APPLICATION FEE -BUILDING 1000 FIRE IMPACT - NONRES 5.88846 FIRE INSPECT -NEW CONST 3,413.60 3`Z .' PERMIT FEES POLICE IMPACT - NONRES 37,549.60 RADON GAS TAX FEE 853.40 RECOVERY FD/CI RT. PGM 853 40 WATER JUPACT-COMMERCIAL 3,909.00 SEWER TWACT:CONINIERCIAL 10,200.00 TOTAL FEES DUE Mf O d' this does not include road impact fees) Prior to releasing your permit we will treed: 1) Road Impact Statement from Seminole County Road Impact Fee Divtsion 407)665-7474 so we may attach the impact few to yow building permit. 2) Notice of Commencement recorded 10 Seminole County. i) Pro -construction meeting with a all subcontractors proemv if you have any questions. please contact me at (407)330-5660. 1 bank you, Jo-Arrrr Johnson City of Sanford Enain ms Prod iannlns wvanmem Jo -Ann Johnson PMn4 Tocwdcw 7pp N Pori Av"Wr PO. got 1711 Tv I4071370-SM SN1Di7 FL 32M F" t4071 770 5077 E•mao pnnsaq a.Nnb+O.P.vi 8636802509 MARCOBAY CONST. 364 P01 JUN 27 102 10:52 M.4af0BAY CONSTRUCTION Facsimile Transmittal This document is being sent TO: NAME: -joiwr'l -sb1-Wb>j COMPANY. GoTw\ C'f GAbj;oolo FAX NUMBER: q-1- '530-5 6-7 -7 Number of pages including cover f Date: OZ This document is being sent FROM: Howard D. Bayless Marcobay Construction, Inc Special Instructions Marcubay Construction, Inc. 116 South Kentucky Ave. L..ikeland. Florida 33803 963) 680-22193 (803) 680-2443 fax 8636802509 MARCOBAY CONST. C. BUILDING CONSTRUCTION 364 P02 JUN 27 '02 10:52 3300 Concrete Footings 120,478 3302 Interior Slabs on Grade 265,494 4200 Masonry (includes Grout, Rebar, Etc.) 515,747 51 U0 Structural Steel, Joist & Girders, Metal Deck S377,482 90 Tons Structural Steel 1.630 Squares of Metal Deck 98,700 Erection 5200 Interior Metal Studs, Drywall, Vinyl Base, Acoustical Ceilings,Ceramic 40,068 5250 Exterior Metal Studs and Gypsum Board 29,500 5260 EIFS (include 1/2" Dens Glass Gold) 24,365 5270 Standing Seam Metal Roof 4,350 5275 Aluminum Canopies 8,190 5500 Miscellaneous Metals in 5100 6000 Rough Carpentry (ie Roof Nailcrs, 5/8" Exterior Plywood) 51,327 7210 Exterior Wall Insulation 11,969 7500 Elastomeric Roofing (include Sheet Metal Work) 285,690 7501 Prefinished Metal Roofing 58,700 7800 Caulking and Sealants S12,000 8100 Wood/Metal Doors and Frames (include Hardware) 19,600 8350 Overhead/Strip Doers/Loading Dock Equipment 24,205 8400 Storefront, Glass and Glazing 12,500 8405 Automatic Doors S47,610 9901 Interior Painting 71,000 9902 Exterior Painting 47,388 10500 Toilet Partitions and Toilet Accessories S7 556 13123 Shade Structure & Retractable Shade System 73,200 15500 Fire Protection System (Interior Work and Riser) NA 15510 Fire Pump NA 15400 Plumbing (Interior Work) 59,900 15600 HVAC 253,990 16400 Electrical 515,000 RBVc004WI DIVISH I0 8636802509 MARCOBAY CONST. 364 P03 JUN 27 '02 10:52 16450 Generator Generator Enclosure Misc. Fuel Tax Freight 16960 Staging Area Concrete Apron 16965 Garden Center SIab 16970 Garden Center Fence and Gates 16975 Staging Area Fence and Gates BUILDING CONSTRUCTION SUBTOTAL vzv! 0/.06-01 001 velaM (Nm i S) 40,000 11.700 1,725 3,475 600 57,500 NA 34,995 52,341 9.141 3,110,596 Fxj5 &*40w- C4,,4o,C, WIMP 0 PAGE a OF f] June 26, 2002 Mr. Howard Bayless Marcobay Construction l 16 S. Kentucky Ave. Lakeland, FL 33801 I've calculated your permit fees for the Lowe's project located at 3780 Orlando Dr. The fees applied to date are: APPLICATION FEE -BUILDING 10.00 FIRE IMPACT — NONRES 5,888.46 FIRE INSPECT -NEW CONST 3,413.60 PERMIT FEES 23,931.00 POLICE HAPACT - NONRES 37,549.60 RADON GAS TAX FEE 853.40 RECOVERY FD/CERT. PGM. 853.40 WATER DAPACT:COMMERCIAL 3,900.00 SEWER UAPACT:COMMERCIAL 10,200.00 TOTAL FEES DUE 86,599.46 this does not include road impact fees) Prior to releasing your permit we will need: l) Road Impact Statement from Seminole County Road Impact Fee Division 407)665-7474 so we may attach the impact fees to your building permit. 2) Notice of Commencement recorded in Seminole County. 3) Pre -construction meeting with a all subcontractors present. If you have any questions, please contact me at (407)330-5660. lz Thank you, Jo -Ann Johnson City of Sanford Engineering and Planning Department M1MiW , Jo -Ann Johnson Permit Technician 300 N. Park Avenue P.O. Box 1788 Tel: (407) 330-5660 Sanford, FL 32772 Fax: (407) 330.5677 E-mail: johnsonjOci.sanford.fl.us DEVELOPMENT FEE WORKSHEET CITY OF SANFORD UTILITY - ADMIN. P. 0. BOX 1788 SANFORD, FL 32772-1788 Project' Name: G b five ,s I ! c 'v7FZ l /C ZDate: Owner/Contact Person: Phone: Address: 3 7 L,9,,,4a (JQ Type of Development: 1) RESIDENTIAL Type of Units (single family or multi -family): Total Number of Units: Type of Utility Connection individual connections or central water meter & common sewer tap): Water Meter Size (3/4", 1", 2", etc.): REMARKS: 2) NON-RESIDENTIAL Type of Units (commercial, industrial, etc.): Total Number of Buildings: Number of Fixture Units each building): Type of Utility Connection individual connections or central water meter & common sewer tap): water Meter Size (3/4" 1", 2", etc.) REV I S E D r 6 C 0e7el. a t "'V . REMARKS: V*762 /`7674A w+'-?y 7/9P i9•.V4 SEw& 7 9P 7-o QE 10c-r1-_ R y 4rv&4`A"? CONNECTION FEE CALCULATION: W'g'T e 1/`7Pyc7 f6E _ 3 500 y,io 0 o'713L UU Name - Signature Pc,,Z /L7 t ) watea atcm Im act t'cc:: Equivalent Residential Connection (ERC) - 300 Gallons Per Day (GPO) Residential - 650/Unit - Single family structure, or multi -family unitcontainingsormore. 487.50/Unit - Multi-familythreeunit (or Mobile mllome unit containinglessthanthree (3) bedrooms. (This category isbasedonjudgement/assumption, estimation that such family units on average require 751 - 225 GPoofthewaterandsewerserviceofanaverage single family unit.) Commercial I 5650/ERU - Fixture unit schedule from Southern Plumbing Codewillbeused. One ERU will be charged for connection and up to twenty (2) fixture units. For projects having more than twenty (20) fixture units the Impact Fee will be determined byincrementsof251basedonmultiplesoffive (5) fixture units above the twenty (20) fixture unitbaseforthefirstERU. (Example: twenty-five25) fixture units will be rated as 1.25 eru; twenty-six (26) fixture units will be rated as 1.5ERU.) 2) Sewer System Impact Fees Equivalent Residential Connections - 270 Gallons Per Day (GPD) Residential - 1700 Unit - Single family structure, or multi -family unit containing three (3) bedrooms or more. 51275/Unit - Multi -family unit or Mobile Home unit containinglessthanthree (3) bedrooms. (This category is based on judgement/assumption/estimation that such family units on average require 751 of water and sewer service of an average single family unit.) Commercial - Industrial - Institutional 1700/ERU - Fixture unit schedule from Southern Plumbing Codewillbeused. One ERU will be charged for connection and up to twenty (20) fixture units. For projects having more than twenty (10) fixture units the Impact Fee will be increments of 251 based on multiples of five (5) fixture units abovethetwenty (20) fixture unit base for the firstERU. (Example: twenty-five (25) fixture units will be rated as 1.25 ERU; twenty-six (26) fixture units will be rated as 1.5 ERU.) W' 1-7FJ. Vs (1. Y 6So V 4 1 7V V TABLE 709.1 DRAINAGE FIXTURE UNITS FOR FIXTURFR Amn nenr roc For traps larger than 3 inches. use Table 709.2.'- b A showerhead over a bathtub or whirlpool bathtub attachments does not increase the drainage fixture unit value. See Sections 709.2 through 709.4 for methods of computing unit value of fixtures not listed in Table 709.1 or for rating of devices with intermittent flows. Trap size shall be consistent with the fixture outlet size. For the purpose of computing loads on building drains and sewers. water closets or urinals shall not be rated at a lower drainage fixture unit unless the lower valuesareconfirmedbytesting. TABLE 709.2 DRAINAGE FIXTURE UNITS FOR FIXTURE DRAINS OR TRAPS RAIN OR inches) 11/4 II/2 2 21A 3 4 For SI: I inch = 25.4 rnrn. DRAINAGE FIXTURE UNIT VALUE 4. 1 *ram 2 3 4 5 6 O Standard Plumbing Code4M997 lt)4.- CITY OF SANFORD PLANS REVIEW COMMENT SHEET DATE G PROJECT: ADDRESS: CONTRACTOR: OWNER: PLANS REVIEWED BY: COMMENTS: r _ I 1 S* t A o e r- I PERSON NOTIFIED: DATE: NO ONE NOTIFIED: DATE RESPONSE RECEIVED: Xe/ W.%& eA ••`, 1rc- .0 a v l Cb %-.At 0--c- CITY OF SANFORD PLANS REVIEW COMMENT SHEET DATE PROJECT: ADDRESS: CONTRACTOR: OWNER: PLANS REVIEWED BY: site uld 6g- d 33 a -do- -4/ It aft' 7 nro f;(A- 30 cvidv_ CLPar- .oac PERSON NOTIFIED: - - r DATE: w-&_, \,J PHONE: FAX: NO ONE NOTIFIED: DATE RESPONSE RECEIVED: 06/13/2002 13:41 r•• .0 9185878601 TAYLOR SCOTT ARCH PAGE 02 June 12, 2002 Mr. Bob Bott Deputy Building Official City of Sanford 407-302-9417 Reference: Lowes Horne improvements warehouse 3780 South Orlando Dr., Sanford, FL. Subject: Plan Review Comments I would like to take this opportunity to thank you on behalf of Taylor Scott Architects for your assistance and cooperation in reviewing our plans for the above referenced project. Below you will find our responses to the comments you've made and the comments from Timothy Robles, Fire Protection Inspector. ARCHIITEC7 URAL 1) The Cover sheet indicates that we are using 14FPA-101 1997. Florida uses the 2001 Florida Fire Code. The notation has been changed to reflect the 2001 Florida Fire Code. 2) Sheet A-1.1 shows RTU #1 within 10' of the of the parapet wall. RTUs within 10' of a parapet wall must bave a 42" guard. RTU #3 also looks to be within the 10'.. RTU # 1 has been relocated to be 14'-0" from the front parapet wall. RTU #3 is located behind a parapet wall that is higher than 42" 3) Sheet T-1.0 indicates that we have calculated our exit width using .19" per occupant. The Florida Code requires .2" per occupant. The cover sheet has been revised to reflect the change in exit width multiplier and the required exit widths. 4) The break away door openings (02B) show a width of 177". Is this correct? The two inside doors provide an 84" clear opening and each side door has a clear opening of 46 1/2". This allows a 5 1/2" jamb/door width at the wall, and 2" door width for the interior door. 5) Door 01E needs and exit light. A light will be provided. 6) The trash compactor door needs a fire closer. A fire/beat activated latch will be added. 7) Panic Hardware on the gates needs to be resolved. The Gate Schedule will be revised to indicate panic hardware. 8) The egress in the garden center does not take into account all of the exits. The additional exits were added on the cover sheet. 1437 SOUTH BOULDER SUITE 800, TULSA, OK 7a119-3809 9 (918) 587-ee00 9 FAX 587-0001 06/13/2002 13:41 9185878601 TAYLOR SCOTT ARCH PAGE 03 i; ,- low T4VL OR SCC)T'I ARCI-111 ECTS. INC, v AJN vP Ca 9) The stand-alone water fountain should be noted as being the accessible drinking fountain. .3 C\. Per Brian Sander at HEI, the Water fountains and the electric water coolers are H/C accessible. See the cut sheets provided. r 10) Emergency lighting must be added in the main electrical room over the electric panels and at the sprinkler room. The lights in the electrical and sprinkler rooms are tied into the emergency lighting circuits. 11) The Shunt trip locations must be shown on the plans. 1 The only shunt trip is in the generator and is shown on Detail 2, Sheet E-7. 12) Mr. Bott has asked if we have a smoking breakroom. There are no smoking breakrooms. 13) Egress out of the rear of the store near the transformer is bad. People would leave it smoky building and be in a more dangerous location with a running generator and a transformer. A 6' high chain -link fence will be provided along the exit path, extending just beyond the generator. A 3' clearance p It: will be maintained from the generator, and the fence will include a gate for electrical access to the generator. 14) Striping on the garden center floor is required. Note 9.01 on Sheet A-1.0 calls out for painting the unobstructed path with OSHA yellow paint. 15) The generator shunt trips must be located on the plans and be sear the other *bunts. The only shunt trip is in the generator and is shown on Detail 2, Sheet E-7. 16) The transformers must be grounded per Section 250-30, paragraph 3. All transformers are grounded and are noted per NEC 250, shown on Detail 1, Sheet E-3 (Grounding and Bonding Details). IRE PROTECTION 1) Comment 3.5: Extinguishing requirements The required number of extinguishers will be provided to meet NFPA 410 approval. 2) Comment 5.1: Utilities All doors leading to the fire alarm control room will be labeled "MAIN FIRE ALARM PANEL INSIDE" 3) Comment 5.2; HVAC All HVAC units on roof will be labeled for fire personal. 4) Comment S — Fire Sprinklers A sign will be placed above fire test header reading "Do not use For Test Purposes Only". The property will be monitored as required by a U.L. listed Central Station 5) Comment 3-6.1: Key Box A key box will be mounted 7' above the door to the fire room using model #3270. 143'r SOUTH BOULDER SUITE 800, TULSA, OK 74119-3809 9 (910) 587-8800 9 FAX 587-6601 06/13/2002 13:41 r 9185878601 TAYLOR SCOTT ARCH PAGE 04 0 Respecdwly, Greg Davis, A.I.A. Taylor Scott Architects, Inc. 1437 SOUTH BOULDER SUITE 600, TULSA, OK 74119-3609 • (918) 587-8600 9 FAX 587-8601 06/13/2002 13:41 9185878601 TAYLOR SCOTT ARCH PAGE 01 FAX Date 6/13102 Attention Bob Bott Company City of Sanford Sanford FL Phone 407-302-9417 Fax 407-330-5677 E-mail Quantity Description Code Response Letter Remarks Bob, From Gregory A. Davis, AIA TSA Project # 0119027 Project Name Sanford, FL Routing Fax - 4 pages, including this cover Copy Please see the attached code response letter provided. Please call me to confirm that the permit is ready to pick up. You can call me or Bruce Horgen at toll free 877-584-8600. Thank you, Signed 1437 S. Boulder • Suite $00 • Tube, OK • 74119 - www.taylorscott.com - (918) 587-9600 - Fax (918) 587-8601 June 19, 2002 City of Sanford 300 N. Park Avenue Sanford, Florida 32772-1788 Power of Attorney I, Howard Bayless, hereinafter referred to as the "License Holder," the President of Marcobay Construction, Inc., hereinafter referred to as the "Company", hereby appoint Drew Brady as Attorney -in -Fact of the License Holder/Company, in order to: a) Sign and submit building permit applications b) Obtain building permit c) Obtain the certificate of occupancy from the City of Sanford on behalf of the License Holder/Company: LICENSE HOLDER: i' Print Title: Company Nlme-ARarobay Construction, Inc. Mailing Address: 116 S. Kentucky Avenue Lakeland, Florida 33801 Telephone No.: 863-680-2293 Fax No.: 863-680-2443 E-mail Address: hbavlessCaD_marcobay.com State of Florida County of Polk WITNESSES: Sign: Print Name: Sign: AAj Print Name: "7W"W N W • S10" 95 The foregoing instrument was acknowledged before me this 19th day of June 2002, by Howard Bayless, the President of Marcobay Construction, Inc., a Florida corporation, on behalf of the corporation. He is personally known to me and did not take oath. TAMMY TRITTON Notary Public 0Notary Public, State of Florida Commission Expires: June 28, 2004 My Comm; exp. June 28, 2004 Comm. No. CC950448 116SOUTH KENTUCKY AVENUE LAKELAND, FLORIDA 33801 863) 680 2293 FAX (863) 680-2443 CG C052034 W W W. M A RC O B AY. C O M CG CO22914 Usulham' 1n''c. Con tin En irieers Surveyors & Landscape Architects P. O.-Pox 1105 • 265 Kenilworth Avenue • Ormond Beach; Florida 32174 386) 672-9515 • FAX (386) 673-6554 •; LB# 0003612 • LC# 0000357 ` Visit us at: www.uphaminc.com. April 18, 2002 ' Mr: - Robert Bott Plans Examiner City of Sanford ` 300• N. Park Avenue Sanford, FL 32772 Re: Lowe's Home Improvement,Warehouse 3780 S. Orlando'Drive " Dear Mr. Bott: Submitted is the application -and supporting material for•the review for -the building permit on behalf of Lowe's Home Centers, Inc., The site •development has been approved: by Planning and, Engineering, permit numbers 02-448 and 021449. The Development Order will be.issued upon receipt of the SJRWMD permit on May••7. - - - Attached is a copy•of the.City's submittal requirements: with the items noted. The , Utilities Department has received- copies of the FDEP water. and wastewater -permits. Lowe' s-.has. received a revised roadway 'impact fee statement -by the County .for approximately $ 174,000. A'copy will be supplied upon payment to the County. - The property is still under the ownership of VOSR Industries and WGML/PRN/JDF Real Estate, Investments. • Attached' is a copy• of each landowner's verification of ownership.,- Lowe's is scheduled to close on the property prior to ;April 30. Ili' addition, attached ista copy of a letter of authorization for Lowe's to act as agent on' ' their' behalf. Should you•have any questions;'dali me. You may also contact the Architect, Bruce Horgen, at Taylor Scott Architects at (918) 587-8600 ext. -232. Sincerely, ' - 1 l Rogei W. Strcula, PE President Cc: Michael W. Reynolds, Lowe's Companies, Inc:. Jim Robertson, Lowe's Companies, Inc. - Bruce Horgen, Taylor Scott Architects CAMy DocumentsUowes sanford southeasAbldg permit review city.doc , a: - f J City of Sanford Building Division r Submittal Requirements for Commercial Building Permit 1. Two (2) boundary and building location surveys showing setbacks from all structures to property lines. 2. Two (2) complete sets of construction design drawings drawn to scale. Complete sets to include: a. Approved site plan by Planning & Zoning Commission b. Foundation plan indicating footer sizes for all bearing walls. Provide side view details of these footers with reinforcement bar replacement. b. Floor plan indicating interior wall partitions and room identification, room dimensions, door, window, and/or opening sizes, and tenant separation and fire resistant walls. Need complete UL design noted. C. An elevation of all exterior walls - east, west, north, and south, including finish floor elevations. d. Structure details signed and sealed by engineer. e. Architectural drawings signed and sealed by architect. f. Electrical drawings signed and sealed by engineer, if over 600 AMPS. g. Mechanical drawings signed and sealed if 15 tons or more and/or $5,000.00 IL Plumbing drawings signed and sealed and shall comply with Florida Accessibility Code. L Plans shall also show: 1. square footage 2. type of construction 3. occupancy classification (group) 4. occupant load 5. sprinklers, standpipes and alarm systems 6. fire protection requirements and NFPA requirements 7. Life Safety Code 101 3. Three (3) sets of completed Florida Energy Code Forms - signed and sealed by architect or engineer. 4. Soil analysis and/or soil compaction report. if soils ap ear to be unstable or if structure is to be built on fill, a report may be requested by the Building Official or his representative. 5. Other submittal documents: 13`i C. %-" a. Utility letter or approval when public water supply and/or sewer system connection to be made. NIA b. Septic tank permit issued by Seminole County Health Dept. poN E C. Arbor permit when trees to be removed from property. Contact the Engineering Dept. for details regarding the arbor ordinance and permit. SFsE l-S-r"CER d. Seminole County Road Impact fee statement. v e. Property ownership verification. 6. Application to be completed thoroughly and signatures provided by a licensed and insured contractor and property owner. If electrical, mechanical, or plumbing permits have not been issued, inspections will not be scheduled or made and subcontractors will be subject to penalty under city ordinances. G pf.aT C2. AG"Tc>li. t.4 trr *-i E'T Date 4 -$Z meter/Agent Signature Roger W. Strcula P.E. VOSR INDUSTRIES, INC. January 18, 2002 Mr. Rod Pakzadian Sr. Water Resource Engineer III St. Johns River Water Management District 975 Keller Road Altamonte Springs, FL 32714-1618 Re: Live Oak Center/Lowe's Home Improvement Warehouse Sanford, Seminole County Application NO.4-117-81632-1 Dear Mr. Pakzadian: This letter is in response to your continent one per the RAI letter dated January 18. This is to inform you that VOSR Industries, Inc. is the landowner of that portion of property per County Tax Parcel No. 11-20-30-300-0260-0000 and that I, J.W. Doyle, President, am the landowner or authorized representative of the landowner of the referenced tax parcel number. I, as the landowner or authorized representative of the landowner, hereby authorize St. Johns Water Management District to issue the permit for this referenced project to Lowe's Home Centers, Inc. as indicated on Page 2a of the District application. Sincerely, PERSONALLY KNOWN TO ME PRODUCED IDENTIFICATION IN WITIIFSS WHEREOF, I HAVE HEREUNTO SET MY HAND AND SEAL OF THE TARY PUPJ-IC ! . TATE OF ,il,rf , AT LARGE MY COMMISSION EXPIRES: COMMISSION NUMBER: G?c 7GU-5rV2 Nwvrvww state of Florida iMYComm. UP: 07110)02 SOS East New York Ave. Com"; CC7E0603 Suite 1 Deland, FL 32724 Phone 904-738-9555 Fax 904-738-2210 WGML, LLC Tel: (407)- 788-6555 Fax: (407)- 682-6194 January 22, 2002 Rod Pakzadian Senior Water Resource Engineer III St. Johns River Water Management District 975 Keller Road Altamonte Springs, Florida 32714-1618 860 S.R 434 North, Suite 7 Altamonte Springs, F132714 Re: Live Oak Center/Lowe's Home Improvement Warehouse Application Number 4-117-81632-1 Dear Mr. Pakzadian: This letter is in response to comment one (1) of your RAI letter to Roger Strcula, PE, of Upham, Inc., dated January 18, 2002. This letter shall serve to inform you that the following Florida Limited Partnerships: WGML Real Estate & Investments, Ltd. PRN Real Estate cR Investments, Ltd. JDF Real Estate R Investments, Ltd., are the sole owners of those two properties, located off Live Oak Blvd., in Sanford, Seminole County, Florida, which are described as per Seminole County Tax Parcel Numbers 11-20-30-300- 0 1 8F-000 and 11-20-30-300-018G-000. I, H. Scott Gold, am the authorized representative of the owners of the referenced tax parcels, and I hereby authorize St. John's Water Management District, to issue the permit for the Love's Home Improvement Warehouse, Application Number 4-117-81632-1 Lowe's Home Center, Inc., as indicated on Page 2a of the District application. STATE OF FLORIDA COUNTY OF SEMINOLE I IN WITNESS WHEREOF, H. Scott Gold being personally known to me, and I have hereunto set my hand and seal on the above date. Notary Public JIJDITH kSCHNEIDER My Commission Expires r MY COMMISSION I DD 010391 aV t EXPIRES: June 10, 2M yr ry, Bonded Tuv NQ%q P,4* Underw k rs u UNIVERSAL ENGINEERING SCIENCES Consultants in: Geotechnioal Engineering • Threshold Inspection Environmental Sciences • Construction Materials Testing November 30, 2001 Upham, Inc. 265 Kenilworth Avenue Ormond Beach, Florida 32174 Attention: Roger Strcula, P.E. Reference: Additional Geotechnical Services Lowe's Development - SE Sanford US 17/92 and Lake Mary Boulevard Sanford, Seminole County, Florida Project No. 70092-004-01 Report No. 201326 Dear Mr. Strcula: Offices in Orlando Gainesville Fort Myers Rockledge St. Augustine Daytona Beach West Palm Beach Jacksonville Ocala Tampa " Debary Universal Engineering Sciences Inc. (UES) has completed the additional geotechnical exploration for the proposed Lowe's development in southeast Sanford, Seminole County, Florida. The scope of our exploration was planned in conjunction with you and authorized by you. This report supplements Report No. 196229, issued earlier this month. In this report, we present the results of the geotechnical exploration specifically between the proposed building and Live Oak Boulevard. The far northwest corner of the building and the adjacent access road are planned in the existing stormwater retention pond. The scope of this supplemental evaluation is to evaluate the conditions where fill will be required and provide recommendations for constructing the embankment. 1.0 FIELD EXPLORATION We explored the subsurface conditions in the pond. where fill is anticipated with three wash borings from our flat bottom boat. The locations of the borings are shown on the attached Boring Location Plan marked as PB-1, PB-2 and PB-3. Because the water is too deep for our track rig and too shallow for our barge mounted rig, we performed our evaluation with the intent on discovering the relationship between the water, the surface "muck," and firm sand. SPT boring data was not obtainable. We performed the probe borings by advancing a slender, hollow pipe connected to a pump to penetrate the near surface soils below water. We subjectively identified the transitions between the top of the muck or mud line and the top of firm sandy soil. We used this data in preparing recommendations for site preparation for the pond reclamation portion of the project. ' 2.0 FINDINGS Generally, we encountered 1 to 2Y2 feet of water, followed by 1 to 4 feet of muck, and then light gray sand to depths of 20 feet. The results of the boring. logs and the boring locations are shown in Appendix A of this report. Page 1 of 2 3532 Maggie Blvd. 9 Orlando, FI 32811 • (407) 423-0504 • Fax (407) 423-3106 Project No. 70092-004-01 Report No. 201326 3.0 SITE PREPARATION We are anticipating several feet of fill will be required in this area to bring the site up to final grade. To accomplish this task, we recommend the following site preparation procedures: Lower the level of the water within the pond to at least 2 feet below the bottom of the muck soils. Based upon today's water level, this corresponds to approximately 7 feet. We recommend verifying the bottom of the muck soils just priorto beginning dewatering to verify these assumptions. If the water level is significantly deeper, modifications to this general plan may need to be reviewed. 2. Excavate all of the organic soils from beneath the embankment and beyond the north and west perimeters by a 1 horizontal to 1 vertical ratio. For example, if the muck is 5 feet deep at the west edge of the proposed embankment, extend the over excavationIandmuckremoval5additionalfeettothewest. 3. Place fill material to final subgrade, as required. The fill should consist of "clean," fine sand with less than 5 percent soil fines. You may use fill materials with soil fines between 5 and 10 percent, but strict moisture control may be required. Place fill in uniform 10- to 12-inch loose lifts and compact each lift to a minimum density of 95 percent of the Modified Proctor maximum dry density. If compaction becomes a problem due to site constraints, No. 57 stone may be substituted and the requirement for density testing can be waived. 4. Construct the pavement and building as planned. We appreciate the opportunity to have worked with you on this project and look forward to a continued association. Please do not hesitate to contact us if you should have any questions, or if we may further assist you as your plans proceed. Respectfully submitted, ` UNIVERSAL ENGINEERING SCIENCES, INC. r• Bruce H. Woloshin, P.E. P.E. No. 36734• r 0- Manager - Geotechnical-Engineering BHW:si Distribution: Client (10) ., Attachments: Appendix A - Boring Location Plan and Boring Logs Page 2 of 2 APPENDIX A 1 N 0 I N cn to O z ZONED GENERAL COMMERCIAL (CC-2) PROPOSED REALIGNMENT OF MASSEY CADILLAC - OLDS EXISWC DRIVEWAY AND RELOCATION OF A PORAON HIDDEN LAKE SUBDIVISON OF EXISTING STORM WATER POND (SUBJECT TO APPROVAL ZONED SINGLE-FAMIL Y BY LAND O)WER) RESIDENAAL (SR-1) I595_2D' S 6421'38' E S,anS I 1 I I I i I 69Y' PB-2 B-5 A L- XISANG IEXIS77NGCETRAC CAB-1! POND s j9. E 1 i O 0 O I r I EX/SANG LEFT IN STORMWA TER B - 7 RIGHT IN/OUT 2.5 AC 19 B-1 0 ONL Y (PROPOSED I FULL MEDIAN PB-3 xv I OPENING W1rH SIGNAL BY R WAL-MART) eB-8 4AB-'6 AB tY N s4 es2' w AB-lY O OU>2ARCEL AB-17 3 I10 STORM WATER ® 08-9 0 W N U tir\ .3.0 AC \ to I I 2 B-14 O v Q B-10 AB-7 ABQ3 m I ZW 12 OUTPARCEL 1.5 AC I ti zAB B- 5 I V ZONED GENERAL ` O O O 56' 75,03 s zsne•3D• w I COMMERCIAL (GC-2) AB-10 B-11 ri14 zso.o R LEFT IN/OUT RICH /N/OUT O B- n_AB-8 O O -414 400 R I I z I PROPOSED LEFT /N RIGHT IN/OUT ONL Y ...... I I SUBJECT TO FDOT PERMIT) 0 200 SCALE, FEET LEGEND V Al-f-HUXIMAIE STANDARD PENETRATION TEST LOCATION POND BORING LOCATION THIS PLAN TAKEN FROM PLAN PROVIDED BY CLIENT I I EXIS77MG I IBOULEVARDPLAZA SHOPPING CENTER ZONED GENERAL COMMERCIAL (CC-2) I I II II II I REVISED 12/4/01 - ADDED POND BORING LOCATION PB-1 THROUGH PB-3 i o z 0 in N v Q U Z W o W o 1jJ N Q o Ia o a. a o N m i m c 6 z C z WY W o aa. Ill Ix OjLL Z Q O m z m C- U) %- j Z OI- Q O O Q<U YJO O Q 0 a 2 U(1)ZW Z U) < U Z_ I U W cm p r O 0 Q m i LL U) QW 0 DV) UNIVERSAL ENGINEERING SCIENCES FIGURE: A-1 Project No. 70092-004-01 Report No. 201326 Boring Logs Boring 7 Depth SoilINumberfeet) Description PB-1 0 - 2.5 Water 2.5 - 3.5 Muck 3.5 - 20 Light gray SAND PB-2 0 - 1.0 Water 1.0 - 4.0 Muck 4.0 - 20 Light gray SAND PB-3 0 - 1.0 Water 1.0 - 5.0 Muck 5.0 - 20 Light gray SAND A - 2 LEGAL DESCRIPTION: PARCEL A A PORTION OF SECTION 37,-SANFORD GRANT", MOSES E. LEVY GRANT, I TOWNSHIP 20 SOUTH, RANGE 30 EAST, SEMINOLE COUNTY, FLORIDA. BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS: AS A POINT OF REFERENCE AND THE POINT OF BEGINNING COMMENCE AT THE NORTHEAST CORNER OF BOULEVARD PLAZA SUBDIVISION AS RECORDED IN MAP BOOK 58, PAGES 47 AND 48 OF THE PUBLIC RECORDS OF SEMINOLE COUNTY, FLORIDA, RUN THENCE NORTH 63 DEGREES 59 MINUTES 37 SECONDS WEST ALONG THE NORTH LINE OF SAID SUBDIVISION FOR A DISTANCE OF 400.00 FEET; THENCE SOUTH 25 DEGREES 38 MINUTES 37 SECONDS WEST A DISTANCE OF 100.00 FEET; THENCE NORTH 63 DEGREES 59 MINUTES 37 SECONDS WEST FOR A DISTANCE OF 760.61 FEET TO THE EAST RIGHT-OF-WAY LINE OF LIVE OAK BOULEVARD (A 60 FOOT RIGHT-OF-WAY); THENCE :NORTH 25 DEGREES 41 MINUTES 50 SECONDS EAST ALONG SAID W I EASTERLY RIGHT-OF-WAY LINE, A DISTANCE OF 21.63 FEET TO A POINT OF CURVATURE, CONCAVE SOUTHWESTERLY AND TO THE LEFT, SAID CURVE HAVING A RADIUS OF 830.00 FEET, A CENTRAL ANGLE OF 59 DEGREES 14 MINUTES 46 SECONDS, A CHORD BEARING OF NORTH 03 DEGREES 55 MINUTES 33 SECONDS WEST, A CHORD DISTANCE OF 820.52; THENCE ALONG THE ARC OF 3 SAID CURVE A DISTANCE OF 858.25 FEET TO THE POINT OF TANGENCY THEREOF; THENCE NORTH 33 DEGREES 32 MINUTES 56 SECONDS WEST FOR A DISTANCE OF 6.77 FEET TO THE SOUTH LINE OF HIDDEN LAKE PHASE III, ol UNIT IV, SUBDIVISION AS RECORDED IN MAP BOOK 28, PAGES 1 AND 2; THENCE SOUTH 78 DEGREES 34 MINUTES 47 SECONDS EAST ALONG THE SAID SOUTH LINE FOR A DISTANCE OF 692.52 FEET TO THE SOUTHEAST CORNER OF SAID SUBDIVISION; THENCE SOUTH 64 DEGREES 21 MINUTES 07 SECONDS EAST, FOR A DISTANCE OF 595.17 FEET; THENCE SOUTH 25 DEGREES 39 MINUTES 24 SECONDS WEST, FOR A DISTANCE OF 306.09 FEET TO A CURVE CONCAVE NORTHWEST AND TO THE LEFT, SAID CURVE HAVING A CENTRAL ANGLE OF 09 DEGREES 11 MINUTES 08 SECONDS, A RADIUS OF 200.00 FEET, A CHORD 205' BEARING OF NORTH 77 DEGREES 12 MINUTES 28 SECONDS EAST A CHORD DISTANCE OF 32.03 FEET; THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 32.06 FEET TO A POINT OF REVERSE CURVATURE CONCAVE SOUTHEASTERLY AND TO THE RIGHT, SAID CURVE HAVING A CENTRAL ANGLE OF 43 DEGREES 02 MINUTES 30 SECONDS, A RADIUS OF 200.00 FEET, A CHORD BEARING OFmSOUTH85DEGREES51MINUTES51SECONDSEAST, A CHORD DISTANCE OF 1146.74 FEET; THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 150.24 FEET TO THE POINT OF TANGENCY THEREOF; THENCE SOUTH 64 DEGREES 20 MINUTES 36 SECONDS EAST FOR A DISTANCE OF 96.77 FEET TO THE WEST RIGHT-OF-WAY LINE OF U. S. HIGHWAY 17-92 (RIGHT-OF-WAY VARIES); THENCE SOUTH 20 DEGREES 47 MINUTES 00 SECONDS WEST ALONG THE co SAID WEST RIGHT-OF-WAY LINE FOR A DISTANCE OF 32.81 FEET, THENCE SOUTH 28 DEGREES 16 MINUTES 47 SECONDS WEST FOR A DISTANCE OF N O 197.90 FEET; THENCE SOUTH 16 DEGREES 29 MINUTES 25 SECONDS EASTIFORADISTANCEOF40.24 FEET TO A CURVE CONCAVE NORTHWESTERLY I W I AND TO THE RIGHT, SAID CURVE HAVING A CENTRAL ANGLE OF 00 DEGREES o v n cr m 16 MINUTES 22 SECONDS, A RADIUS OF 5654.65 FEET, A CHORD BEARING r^- _ ^ i L OF SOUTH 22 DEGREES 13 MINUTES 03 SECONDS WEST, A CHORD DISTANCE n OF 26.91 FEET; THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 3 n vi 26.91 FEET, THENCE NORTH 64 DEGREES 20 MINUTES 36 SECONDS WEST o N LEAVING SAID WEST RIGHT-OF-WAY LINE OF U. S. HIGHWAY 17-92, FOR Ao `! DISTANCE OF 298.95 FEET; THENCE SOUTH 25 DEGREES 38 MINUTES 50Io o SECONDS WEST FOR A DISTANCE OF 190.77 FEET; THENCE SOUTH 64 I0 a DEGREES 21 MINUTES 11 SECONDS EAST FOR A DISTANCE OF 71.71 FEET; W w oz z g C, THENCE SOUTH 24 DEGREES 34 MINUTES 30 SECONDS WEST FOR A DISTANCE OF 56.07 FEET; THENCE SOUTH 64 DEGREES 21 MINUTESujI- f15, 11 SECONDS EAST IQ- (L N N N N FOR A DISTANCE OF 250.00 FEET TO A POINT ON THE AFORESAID WEST In RIGHT-OF-WAY LINE OF U. S. HIGHWAY 17-92, SAID POINT ALSO BEING ON A CURVE CONCAVE NORTHWESTERLY AND TO THE RIGHT, SAID CURVE HAVING A CENTRAL ANGLE OF 00 DEGREES 30 MINUTES 17 SECONDS, A RADIUS OF 5669.65 FEET; A CHORD BEARING OF SOUTH 25 DEGREES 06 MINUTES 38 SECONDS WEST, A CHORD DISTANCE OF 49.94 FEET; THENCE ALONG THE ARC OF SAID I CURVE FOR A DISTANCE OF 49.94 FEET TO THE POINT OF BEGINNING_ I THE ABOVE DESCRIBED PARCEL CONTAINS 21.907 ACRES MORE OR LESS. sT RWN-WAT iao' I PARCEL B BEING A PORTION OF SECTION 37, 'SANFORD GRANT", MOSES E. LEVY GRANT, TOWNSHIP 20 SOUTH, RANGE 30 EAST, SEMINOLE COUNTY, FLORIDA, BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS: AS A POINT OF REFERENCE AND THE POINT OF BEGINNING COMMENCE AT THE SOUTHWEST CORNER OF HIDDEN LAKE PHASE 111, UNIT IV, RECORDED IN MAP BOOK 28, PAGES 1 AND 2, OF THE PUBLIC RECORDS OF SEMINOLE COUNTY, FLORIDA, RUN THENCE SOUTH 78 DEGREES 34 MINUTES 47 SECONDS EAST ALONG THE SOUTH LINE OF SAID SUBDIVISION FOR A DISTANCE OF 145.47 FEET, THENCE SOUTH 11 DEGREES 33 MINUTES 00 SECONDS WEST LEAVING SAID SUBDIVISION LINE FOR A DISTANCE OF 70.02 FEET; THENCE SOUTH 78 DEGREES 34 MINUTES 47 SECONDS EAST FOR A DISTANCE OF 224.22 FEET TO A POINT ON THE WEST RIGHT-OF-WAY LINE OF LIVE OAK BOULEVARD A 60 FOOT RIGHT-OF-WAY), SAID POINT BEING ON A CURVE CONCAVE WESTERLY AND TO THE RIGHT, SAID CURVE HAVING A CENTRAL ANGLE OF 31 DEGREES 52 MINUTES 22 SECONDS, A RADIUS OF 770.00 FEET, A CHORD BEARING OF SOUTH 15 DEGREES 15 MINUTES 32 SECONDS' WEST, A CHORD DISTANCE OF 422.83 FEET, THENCE ALONG THE ARC OF SAID CURVE A DISTANCE OF 428.34 FEET, THENCE SOUTH 78 DEGREES 58 MINUTES 50 SECONDS WEST LEAVING SAID WEST RIGHT-OF-WAY LINE FOR A DISTANCE OF 346.08 FEET; THENCE NORTH 11 DEGREES 01 MINUTE 10 SECONDS WEST FOR A DISTANCE OF 627.45 FEET TO THE POINT OF BEGINNING. THE ABOVE DESCRIBED PARCEL CONTAINS 4.072 ACRES MORE OR LESS. LnWE S' Improving Home Imprwemenr Box 1111, N. Wilkesboro, NC 28656 (Highway 268 East, East Dock, N. Wilkesboro, NC 28659) (336) 658-2182 Fax (336) 658-2616 Michael.W.Reynolds@Lowes.com Site Development — Southern Division October 16, 2001 Mr. Russell L. Gibson, AICP Land Development Manager City of Sanford 300 N. Park Avenue Sanford, FI 32771 Re: Lowe's Home Improvement Warehouse 3780 S. Orlando Drive Dear Mr. Gibson: This letter is to authorize Mr. Roger W. Strcula, P.E., of Upham, Inc. to act as agent on behalf of Lowe's Home Centers, Inc. for the purposes of executing applications for this project. Please advise if you have any questions. Thank You. Sincerely, LOWE'S p6MPANIES, C. Michael W. Reynolds Sr. Site Development Manager Cc: Roger Strcula, P.E. File SANFORD FIRE DEPARTMENT FIRE PREVENTION DIVISION 300 N. Park Ave., Sanford, Fl. 32771 / P. O. Box 1788, Sanford, Fl. 32772 407 302-1022 I FAX (407) 330-5677 Pager (407) 918-0388 Plans Review Sheet Date: May 24, 2002 Business Address: 3780 S. Orlando Drive Occ. Ch. 36 Mercantile (170,680 sq. ft type IV construction) Business Name: Lowe' s Home Center Ph. (336) 658-4000 Fax (336)658-3257 Contractor: Unknown (Pending) Architect: Taylor Scott Architects, INC Ph. (918) 587-8600 Fax (918) 587-8601 Reviewed [ ] W ev_iewed with comment[ J Rejected [ Reviewed by: Timothy Robles, Fire Protection Inspector/Plans Examiner Comment: Plans reviewed as Mercantile Occupancy. FD reserves right to require applicable code requirements if occupancy use changes. Sprinkler plans to be submitted for review, permitting, and inspections. _ ff separate certified contractor doesuderground fireline, plans to be submitted for review permitting, and inspections.,Sealed letter from Engineer of Recor t t'ng des'gn criteria to sprinkler.system needs to be submitted with construction plans. Fire Alarm plans to be submitted for review, permitting, and inspections. Fire alarm design and tune shall be snecired as Per N.F.P.A.#72 1 Application — New Building. Type IV unprotected, 170,680 sq ft with automatic fire sprinklered 1.2Mixed —Shall comply with 6.1.1.4 1.3 Special Definitions — Special Purpose Bulk Merchandise 1.4 Classification of Occupancy — Class "A " Mercantile 1.5 Classification of Hazard of Contents —High Hazard, per 36.1.5.2 1.6 Minimum Construction — N/R 2.2 Means of Egress Components — O.K.(816" of combined EXIT space) 2.3 Capacity of Egress —O.K. (Engineered per plans T-1.0) SANFORD FIRE DEPARTMENT FIRE PREVENTION DIVISION 300 N. Park Ave., Sanford, Fl. 32771 / P. O. Box 1788, Sanford, Fl. 32772 407302-1022 /FAX (407) 330-5677 Pager (407) 918-0388 2.4 Number of Exits — O.K, Fire Department Will Field Verify 2.5 Arrangement of Egress — O.K., Per L.S.0 36-2.6>200 ft. maximum travel distance. Per L. S. C. 36-2.5. 2> dead end corridors shall not exceed 50 ft. 2.6 Travel Distance - O.K. Complies with L.S. C. 2000 ed. 2.7 Discharge from Exits — O.K., will field verify 2.8 Illumination of Means of Egress — O.K.; will field verify 2.9 Emergency Lighting Fire Department will require emergencyligh tn Electrical room_& fire Controlroom. Fire department will field verify andn MAIN ELECTRICAL SHUT OFF' 2.10 Marking of Means of Egress — O.K.; will field verify (see page T-1.1.) 2.11 Special Features — O.K. 3.1 Protection of Vertical Openings — Fire Dept. will require inspection to verify "smoke blocking" 3.2 Protection from Hazards - Building has afire sprinkler system through out. (E.S.F.R. K-25 fire sprinkler heads for the high rack combustible storage)& dry system two (2) outside areas in case offreezing. 3.3 Interior Finish — Class "A or B 3.4 Detection, Alarm and Communications Systems — afire protection engineer shall provide design criteria as per NFPA #72 3.5 Extinguishing Requirements — as per NFPA #10 the following applies: 1- 40 A rated Fire Extinguisher every 75 ', . > Totaling (44) 1) Foam fire extinguisher for high chlorine storage area 0 SANFORD FIRE DEPARTMENT FIRE PREVENTION DIVISION 300 N. Park Ave., Sanford, Fl. 32771 / P. O. Box 1788, Sanford, Fl. 32772 407 302-1022 I FAX (407) 330-5677 Pager (407) 918-0388 Three (3) "C" rated. Fire Extinguisher required for two (2) electrical rooms & Fire Pump Room 3.6 Corridors — N/A 4 Special Provisions 5 Building Services 5.1 Utilities — Label all doors leading to the fire alarm control room" MAIN FIRE ALARM PANEL INSIDE" 5.2 HVAC — as per LSC 7-2 (duct detectors shall provide shut down) field test required. Label( #`s; numbers) for all HVAC units on rooffor fire personal. 5.3 Elevators, Escalators, Conveyors (4A-47) — N/A 5.4 Rubbish Chutes, Incinerators, and Laundry Chutes — N/A Fire Sprinklers: Required Sanford City Code — Chapter 9 Also Place Sign above Fire Test Header Reading "Do not use For Test Purposes Only' (place sign above 5" STOM Monitoring: Required by a U.L. listed Central Station for all mandated fire Sprinklered prope(31J.Y UL/FMphone junction box required) Other: NFPA 1 3-5.1 Fire Lanes — Required if building is more than 150' from street; exception: Building has fire sprinkler system; (however a CLEAR AREA will be dedicated for Emergency services and Fire Department ambulance required) 3-6.1 Key Box —Required; will field verify (Mount 7 ft. above door to fire control room) SEE APLICATIONATTACUED . Model# 3270 Required, 0 3-7.1 Bldg. Address Number Posted and Legible — Required; will field verify (See placement of address numbers on Plans) M Tuesday, January 21, 200310:31 AM Jan 21 03 11:40a Terry James 407 302-1022 p.2 p.04 2,-710 6) ( kor,dl4lj)t— INDEM.N11rY Ali RUMENT Phis hxdcmnity Agrcemcnt is made this day of Jtu lmmy, 2W, Wwccml Lowe*s Stores Inc., a North Carolina corporation, (heroin callus-Lowc's ' . with o1Tcw al Highway 268 Nast, North W illccaboro 28o5c) and the City of Sanford (herein calla) -City'), State Or Florida. WHEREAS, Luwc's is engaital in tic fixtures, marchandising awl equipment installation It l,uwc's home Improvement Warehouse (herein called 'Store") located at 37,M) South Orlando Drive, Samford, Florida 32773 and (tesirer: to continue to tlo so prior to the issuance of 111e Ixxmancnt Ccrtificatc of0Luupancy; and WIIrREAS, the City has requested an indwnnification from I owes Union liability reg:utfin", _ 11c.011) and safety ol'the setup personnel in the Store prior to the issuance or ow lxi-nimic of certilicatc orAcx:uptutcy. NOW '111F.REFORF, in considursdion of the above stated pn;lnises and other good and valuable consideration, the parties, apm- as follows: I. la cA s;iduration or the city permitting l owe's to install fixtures. maad ao" and equipment in the Story: prior to issuance of the permanent Certificate of O t;Lupanuy, Lowe's hereby agrees to indcmni ry the City and to hold it hamticss against any loss. claim. cost, damage. or expanse. inctudinb reasonable attorlwy (con and court costs, which it may sustain, %uffcr or incur by rrawn orally rights, actions, and slain en filed, or cumnumu:cxl a nainst the City arising Gilt of tlmc installation of fixtures. uand/or equigmmcnt in the. Slums: prior to the issuanee of the pcxmancut Ccxtificate or(h:cupancy by the city. 2. ilmis ImILmnily Agreement %hall terminate and ht. or no [unlmer lbrce or effect imnmodintely upon the issu:mcc of the permanent Certi riwtc of Otxupancy by the City. 3. All notiem to Luwc's hercundcT shall be given by ccrtifitxl mail, return receipt reyuoslud. at the addreaw first above mentioned. 4. ' rhk Al reencnt shall not Fmc assigncxl. IN WITNESS WHEREOF, the parties hereto have exceutcxl this ASresuniG tl the day and year first above written. A7TF. ST• LOWK S S'l'OKPIS, INC. A North Carolina Corporation OF CITY OF SANFORD 11y: Zj..! Print Name: `c bQ e (- A "Q,+ Title:_. L>_`i_ Tuesday, January 21, 200310:31 AM Jan 21 03 11:40a Terry Jesse% 407 302-1022 p.3 CKNOWLItDCENIMM STATE OF r DC4& COUNTY OF ( 11K 1'hc fim:goinn in.tttimcrtt was acknowledged bulorc ntc this sY day ul'.lunuary, 24W, hyRi -loyd=rl as of Lowc's Stores. Inc., a NoWs Carolina Corporation, who ie perronally kvwxMi to one or hit,; Iuoduco_d as idcntificatiwt. _ TAMUYTMTMN Notary Public NNW publk, Sate of Florlm W Con. a*. Am 28. W Print:.. Varm h1ftim GOP. No. CC=W My C'ammissiwt lixpires: (A(_'^ ti'rA'1% OF FLORIDA COUNTY OF SEMINOLE The lorcgning instrument was mknowlcdged bet'ore me this 2191--day of January, 2003. by 50--._, :tc 1 Cictlt)f the City of Sanford, Stair ol-Florida, who is pcmnally known to me or :ts produceW m identification. Print: D` t?. J :4 O V! in Vj Sg o.ro Nw O V COA w 5. p.03 BUILDING DIVISION OF COMMUNITY & ECONOMIC DEVELOPMENT DEPARTMENT REQUEST FOR AFTER HOURS INSPECTIONS PROCEDURE In the event that a permitted construction project requires after hours or weekend inspections, the following provides the guidelines for requesting this ice. TO BE COMPLETED BY THE REQUESTING CONTRACTOR l jZ DATE: 01410 I PERMIT ER: d PROPERTY ADDRESS: 5150 CRAA00 TYPE OF INSPECTION: BUILDING tl PLUMBING MECHANICAL ELECTRICAL INSPECTION NAME Aa C'E", DATE NEEDED 10 TIME NEEDED `I Fees: Weekend and Holiday Inspections: $48.00 per hour with a 4 hour minimum. Weekday inspections: $48.00 per hour with a 2-hour minimum for inspections requested after 5:00 p.m. and before 8:00 a.m. In order to obtain an after hours inspection, the following shall be met: 1. The request will be made in writing and brought to the Building Department and fees paid before noon on the day that the inspection/inspections are needed. If the inspection service is requested for a weekend, the request and fee will be paid before noon on the Friday preceeding the weekend The approval from the Building Official is required prior to requesting the inspection service. 2. The term after hours shall mean that time after 5:00 p.m. and prior to 8:00 a.m 3. Any additional time over two (2) hours will be billed in one- (1) hour increments. 4. Any additional time over four (4) hours will be billed in one- (1) hour increments. 5. If the inspection is already on record for the particular day in question, there must be an emergency reason given to and approved by the Building Official before any fees are collected. REASON: CONTRACTOR: — CONTRACTOR SIGNA' APPROVED BUILDING OFFICIAL: DATE:-1 G' (-1-0 a IV-29 BUILDING DIVISION OF COMMUNITY & ECONOMIC DEVELOPMENT DEPARTMENT REQUEST FOR AFTER HOURS INSPECTIONS PROCEDURE In the event that a permitted construction project requires after hours or weekend inspections, the following provides the guidelines for requesting this service. TO BE COMPLETED BY THE REQUESTING CONTRACTOR DATE: IO 117 l D a - PERMIT NUMBER: a /0 PROPERTY ADDRESS: D or et.?do Or, TYPE OF INSPECTION: BUILDING -X PLUMBING MECHANICAL ELECTRICAL FIRE INSPECTION NAME i c DATE NEEDED !o .2 0 TIME NEEDED Fees: Weekend and Holiday Inspections: $48.00 per hour with a 4 hour minimum. Weekday inspections: $48.00 per hour with a 2-hour minimum for inspections requested after 5:00 p.m. and before 8:00 a.m. In order to obtain an after hours inspection, the following shall be met: 1. The request will be made in writing and brought to the Building Department and fees paid before noon on the day that the inspectiordinspections are needed. If the inspection service is requested for a weekend, the request and fee will be paid before noon on the Friday preceeding the weekend. The approval from the Building Official is required prior to requesting the inspection service. 2. The term after hours shall mean that time after 5:00 p.m. and prior to 8:00 a.m. 3. Any additional time over two (2) hours will be billed in one- (1) hour increments. 4. Any additional time over four (4) hours will be billed in one- (1) hour increments. 5. If the inspection is already on record for the particular day in question, there must be an emergency reason given to and approved by the Building Official before any fees are collected. REASON: CONTRACTOR: &Vlo)e e CONTRACTOR SIGNATURE APPROVED BUILDING OFFICIAL: DATE: \ C, Ni -Ur} IV-29 BUILDING DIVISION OF COMMUNITY & ECONOMIC DEVELOPMENT DEPARTMENT REQUEST FOR AFTER HOURS INSPECTIONS PROCEDURE In the event that a permitted construction project requires after hours or weekend inspections, the following provides the guidelines for requesting this service. TO BE COMPLETED BY THE REQUESTING CONTRACTOR DATE: IO 62 /O 2- PERMIT NUMBER: 02 PROPERTY ADDRESS: 37 EEO TYPE OF INSPECTION: INSPECTION NAME - I DATE NEEDED O BUILDING _X MECHANICAL FIRE TIME NEEDED PLUMBING ELECTRICAL Fees: Weekend and Holiday Inspections: $48.00 per hour with a 4 hour minimum. Weekday inspections: $48.00 per hour with a 2-hour minimum for inspections requested after 5:00 p.m. and before 8:00 a.m. In order to obtain an after hours inspection, the following shall be met: I . The request will be made in writing and brought to the Building Department and fees paid before noon on the day that the inspection/inspections are needed. If the inspection service is requested for a weekend, the request and fee will be paid before noon on the Friday preceeding the weekend. The approval from the Building Official is required prior to requesting the inspection service. 2. The term after hours shall mean that time after 5:00 p.m. and prior to 8:00 a.m. 3. Any additional time over two (2) hours will be billed in one- (1) hour increments. 4. Any additional time over four (4) hours will be billed in one- (1) hour increments. 5. If the inspection is already on record for the particular day in question, there must be an emergency reason given to and approved by the Building Official before any fees are collected. REASON: CONTRACTOR: rplogo^te CONTRACTOR SIGNATURE APPROVED BUILDING OFFICIAL: DATE: Qb I-) - 0 a IV-29 BUILDING DIVISION OF COMMUNITY & ECONOMIC DEVELOPMENT DEPARTMENT REQUEST FOR AFTER HOURS INSPECTIONS PROCEDURE In the event that a permitted construction project requires after hours or weekend inspections, the following provides the guidelines for requesting this service. TO BE COMPLETED BY THE REQUESTING CONTRACTOR DATE: PERMIT NUMBER: 02 — PROPERTY ADDRESS: 3 TYPE OF INSPECTION: INSPECTION NAME DATE NEEDED 5 BUILDING X, PLUMBING MECHANICAL ELECTRICAL FIRE TIME NEEDED Fees: Weekend and Holiday Inspections: $48.00 per hour with a 4 hour minimum. Weekday inspections: $48.00 per hour with a 2-hour minimum for inspections requested after 5:00 p.m. and before 8:00 a.m. In order to obtain an after hours inspection, the following shall be met: 1. The request will be made in writing and brought to the Building Department and fees paid before noon on the day that the inspection/inspections are needed. If the inspection service is requested for a weekend, the request and fee will be paid before noon on the Friday preceeding the weekend. The approval from the Building Official is required prior to requesting the inspection service. 2. The term after hours shall mean that time after 5:00 p.m. and prior to 8:00 a.m 3. Any additional time over two (2) hours will be billed in one- (1) hour increments. 4. Any additional time over four (4) hours will be billed in one- (1) hour increments. 5. If the inspection is already on record for the particular day in question, there must be an emergency reason given to and approved by the Building Official before any fees are collected. REASON: CONTRACTOR: 1Uff -00-/ o CONTRACTOR SIGNATURE APPROVED BUILDING OFFICIAL: DATE: l 0 - IV-29 CITY OF SANFORD ELECTRICAL PERMIT APPLICATION Permit Number: - I In In Date: 02 The undersigned hereby applies for a permit to install the following electrical: owner's Name: L w s 14brne C: 4eX15,-UnC - Address of ,fob: Eiectrical Contr, Residential: Non -Residential: By Signing this application I am stating that I am in comolianee with City of Sanf Electrical Code. n Applicant's Signature State License Num:)er Pal TAYLOR SCOTT ARCHITECTS, INC. September 9, 2002 Mr. Bob Bott Deputy Building Official City of Sanford Sanford, Florida 300 N. Park Avenue I!TftSanford, FL 32772 Reference: Lowe's Home Improvement Warehouse 3780 S. Orlando Drive - Sanford, FL Subject: Building revisions and Garden Center Irrigation plans - Revision #5 Dear Mr. Bott would like to take this opportunity to thank you on behalf of Lowe's and Taylor Scott Architects for your assistance with our drawing submittals. We have made minor revisions to the plans and have added Garden Center Irrigation plans into our construction documents and are forwarding these to you for your review. Please rind enclosed two revised sets of construction documents revised sheets only). Please let me know as soon as possible if this submittal is lacking any information to process our request and I will see that it gets delivered to you immediately. We greatly appreciate your effort and cooperation on this project during this busy time of year, and look forward to working with you and your staff as the project moves forward. We would be happy to answer any questions over the phone at any time via our toll free line (877) 584-8600, or if you prefer, you may fax comments directly to our office at (918) 587-8601. Respectful] , Bruce Horgen Taylor Scott Architects, Inc. Encl.: Two sets of revised Constriction Documents (revised sheets only) cc: File 1437 SOUTH BOULDER SUITE 800, TULSA, OK 74119-3609 9 (918) 587-8600 • FAX 587-8601 Robert E. Evans, Inc. Lowes Home Improvement Warehouse #1657 3780 Orlando Drive Sanford FL. 32773 772-473-1258 772-562-8404 1 M r Robert E. Evans, Inc. 1204 19th Place Vero Beach, Fla. 32960 Phone: 772A73-1258 FAX: 772-562-8404 State Lic. NEF0000358 FIRE ALARM SUBMITTAL LOWES HOME IMPROVEMENT WAREHOUSE #1657 3780 Orlando Drive Sanford, FL. 32773 Engineer of Record Page Interworks, P. A. Engineers and Consultants 320-B Tenth Street N. Wilkesboro, NC. 28659-1645 PH. # 336-667-4225 Prepared by Robert E. Evans Engineering Tonwrows Needs Today- Panel ID: 15495 Location: SK1) I Control Room Model: Volts: Silent Knight 5495 Power Expander 24 VDC Max Circuit Current: Max Panel Current: 3 Amps 6 Amps Ckt.# Circuit Name Current Draw Standby Alarm Wire AWG Ohms Per Type 1000 Ft. Length(ft) Actual One -Way Ohms Volts @ EOL Drop 1 5495(1) Circuit 1 0.000 0.660 16 Solid 5.08 220 2.24 1 22.52 6.15% 2 5495(1) Circuit 2 0.000 0.735 16 Solid 5.08 400 4.06 21.01 12.45% 3 5495(1) Circuit 3 0.000 1.784 12 Solid 2.01 500 2.01 20A1 14.94% 4 5495(1) Circuit 4 0.006 0.015 16 Solid 5.08 445 4.52 23.93 0.28% Aux 5495(1) Aux Power Out a000 0.030 16 Solid 5.08 112 1.14 23.97 0.14% 5495 5495 Power Expander 0.075 0.175 3.224 Amps) Total Output Power Required Total Standby Current (Amps) 0.081 3.399 Total Alarm Current (Amps) Alarm Time In Minutes / 60 (5 Mins) Total Alarm AH Required Wire resistance is taken from Chapter 9 Table 8 of the National Electric Code (NFPA70). Resistance shown is calculated at 75 degrees Centigrade (167 degrees Farenheit) Standby Time In Hours 60 0.083 Total Standby AH Required 4.860 0.283 Total Combined AH Required 5.14 Multiply By The Derating Factor 1.20 Minimum Battery AmpHours Required 6.17 Panel ID: Location: lControl 5495(SK2) Room Model: Volts: Silent Knight 5495 Power Expander 24 VDC Max Circuit Current: Max Panel Current: 3 Amps 6 Amps Ckt.# Circuit Name Current Draw Standby Alarm Wire AWG Ohms Per Type 1000 Ft. Length(ft) Actual One -Way Ohms Volts @ EOL Drop 1 5495(2) Circuit 1 0.000 0.660 14 Solid 3.19 540 3.45 21.73 9.47% 2 5495(2) Circuit 2 0.000 2.360 12 Solid 2.01 375 1.51 20.44 14.82% 3 5495(2) Circuit 3 0.000 1.888 12 Solid 2.01 400 1.61 20.96 12.65% 4 5495(2) Circuit 4 0.006 0.015 16 Solid 5.08 10 0.10 24.00 0.01% Aux 5495(2) Aux Power Out 0.000 0.000 16 Solid 2.01 0.00 24.00 0.00% 5495 5495 Power Expander 0.075 0.175 4.923 Amps) Total Output Power Required Total Standby Current (Amps) 0.081 5.098 Total Alarm Current (Amps) Alarm Time In Minutes / 60 (5 Mins) Total Alarm AH Required Wire resistance is taken from Chapter 9 Table 8 of the National Electric Code (NFPA70). Resistance shown is calculated at 75 degrees Centigrade (167 degrees Farenheit) Standby Time In Hours 60 0.083 Total Standby AH Re uired 4.860 0.425 Total Combined AH Required 5.28 Multiply By The Derating Factor 1.20 Minimum Battery AmpHours Required 6.34 AN 2003 Panel ID: Location: I 5495(SK3) Control Room Model: Volts: Silent Knight 5495 Power Expander 24 VDC Max Circuit Current: Max Panel Current: 3 Amps 6 Amps Ckt.# Circuit Name Current Draw Standby Alarm Wire AWG Ohms Per Type 1000 Ft. Length(ft) Actual One -Way Ohms Volts @ EOL o oDrop 1 5495(3) Circuit 1 0.000 2.124 12 Solid 2.01 410 1.65 20.50 14.59% 2 5495(3) Circuit 2 0.000 1.180 12 Solid 2.01 600 2.41 21.15 11.86% 3 5495(3) Circuit 3 0.000 0.540 14 Solid 3.19 480 3.06 22.35 6.89% 4 5495(3) Circuit 4 0.006 0.015 16 Solid 5.08 10 0.10 24.00 0.01 % Aux 5495(3) Aux Power Out 0.000 0.000 12 Solid 2.01 0.00 24.00 0.00% 5495 15495 Power Expander 0.075 0.175 3.859 Amps) Total Output Power Required Total Standby Current (Amps) 0.081 4.034 Total Alarm Current (Amps) Alarm Time In Minutes / 60 (5 Mins) Total Alarm AH Required Wire resistance is taken from Chapter 9 Table 8 of the National Electric Code (NFPA70). Resistance shown is calculated at 75 degrees Centigrade (167 degrees Farenheit) Standby Time In Hours 60 0.083 Total Standby AH Required 4.860 0.336 Total Combined AH Requiredl 5.20 Multiply By The Derating Factor 1.20 Minimum Battery AmpHours Required 1 6.24 Panel ID: Location: lControl 5495(SK4) Panel Room Model: Volts: Silent Knight 5495 Power Expander 24 VDC Max Circuit Current: Max Panel Current: 3 Amps 6 Amps Ckt.# Circuit Name Current Draw Standby Alarm Wire AWG Ohms Per Type 1000 Ft. Length(ft) Actual One -Way Ohms Volts @ EOL Dro P 1 5495(4) Circuit 1 0.000 1.696 1#14 Solid 3.19 280 1.79 20.97 12.62% 2 5495(4) Circuit 2 0.000 1.696 14 Solid 3.19 260 1.66 21.19 11.72% 3 5495(4) Circuit 3 0.000 0.684 14 Solid 3.19 640 4.08 21.21 11.64% 4 5495(4) Circuit 4 0.000 0.000 14 Solid 3.19 0 0.00 24.00 0.00% Aux 5495(4) Aux Power Out 0.000 0.000 12 Solid 2.01 0.00 24.00 0.00% 5495 15495 Power Expander 0.075 0.175 4.076 Amps) Total Output Power Required Total Standby Current (Amps) 0.075 4.251 Total Alarm Current (Amps) Alarm Time In Minutes / 60 (5 Mins) Total Alarm AH Required Wire resistance is taken from Chapter 9 Table 8 of the National Electric Code (NFPA70). Resistance shown is calculated at 75 degrees Centigrade (167 degrees Farenheit) Standby Time In Hours 60 0.083 Total Standby AH Required 4.500 0.354 Total Combined AH Required 4.85 Multiply By The Derating Factor 1.20 Minimum Battery AmpHours Required 5.83 Panel ID: Location: 5495(SK5) IRear Electric Room Model: Volts: Silent Knight 5495 Power Expander 24 VDC Max Circuit Current: Max Panel Current: 3 Amps 6 Amps Ckt.# Circuit Name Current Draw Standby Alarm Wire AWG Ohms Per Type 1000 Ft. Length(ft) Actual One -Way Ohms Volts @ EOL Dro P 1 5395(5) Circuit 1 0.000 1.548 1#12 Solid 2.01 520 2.09 20.76 13.48% 2 5495(5) Circuit 2 0.000 1.888 12 Solid 2.01 400 1.61 20.96 12.65% 3 5495(5) Circuit 3 0.000 1.674 14 Solid 3.19 320 2.04 20.58 14.24% 4 5495(5) Circuit 4 0.006 0.015 14 Solid 3.19 10 0.06 24.00 0.00% Aux 5495(5) Aux Power Out 0.000 0.000 12 Solid 2.01 0.00 24.00 0.00% 5495 15495 Power Expander 0.075 0.175 5.125 Amps) Total Output Power Required Total Standby Current (Amps) 0.081 5.300 Total Alarm Current (Amps) Alarm Time In Minutes / 60 (5 Mins) Total Alarm AH Required Wire resistance is taken from Chapter 9 Table 8 of the National Electric Code (NFPA70). 1 Resistance shown is calculated at 75 degrees Centigrade (167 degrees Farenheit) Standby Time In Hours 60 0.083 Total Standby AH Required 4.860 0.442 Total Combined AH Required 5.30 Multiply By The Derating Factor 1.20 Minimum Battery AmpHours Required 6.36 Panel ID: Location: 5495(SK6) I Rear Electric Room Model: Volts: Silent Knight 5495 Power Expander 24 VDC Max Circuit Current: Max Panel Current: 3 Amps 6 Amps Ckt.# Circuit Name Current Draw Standby Alarm Wire AWG Ohms Per Type 1000 Ft. Length(ft) Actual One -Way Ohms Volts @ EOL o oDrop 1 5495(6) Circuit 1 0.000 2.124 12 Solid 2.01 360 1.45 20.93 12.81 % 2 5495(6) Circuit 2 0.000 1.362 14 Solid 3.19 340 2.17 21.05 12.31 % 3 5495(6) Circuit 3 0.000 1.082 14 Solid 3.19 400 2.55 21.24 11.51 % 4 5495(6) Circuit 4 0.006 0.015 16 Solid 5.08 10 0.10 24.00 0.010/0 Aux 5495(6) Aux Power Out 0.000 0.000 12 Solid 2.01 1 1 0.00 1 24.00 0.00% 5495 15495 Power Expander 0.075 0.175 4.583 I(Amps) Total Output Power Required Total Standby Current (Amps) 0.081 4.758 Total Alarm Current (Amps) Alarm Time In Minutes / 60 (5 Mins) Total Alarm AH Required Wire resistance is taken from Chapter 9 Table 8 of the National Electric Code (NFPA70). Resistance shown is calculated at 75 degrees Centigrade (167 degrees Farenheit) Standby Time In Hours 60 0.083 Total Standby AH Required 4.860 0.397 Total Combined AH Required 5.26 Multiply By The Derating Factor 1.20 Minimum Battery AmpHours Required 6.31 Panel ID: Location: 5495(SK7) IRear Electric Room Model: Volts: Silent Knight 5495 Power Expander 24 VDC Max Circuit Current: Max Panel Current: 3 Amps 6 Amps Ckt.# Circuit Name Current Draw Standby Alarm Wire AWG Ohms Per Type 1000 Ft. Length(ft) Actual One -Way Ohms Volts @ EOL o oDrop 1 5495(7) Circuit 1 0.000 1.504 14 Solid 3.19 340 2.17 20.74 13.59% 2 5495(7) Circuit 2 0.000 1.888 12 Solid 2.01 320 1.29 21.57 10.12% 3 5495(7) Circuit 3 0.000 1.888 12 Solid 2.01 360 1.45 21.27 11.38% 4 5495(7) Circuit 4 0.006 0.015 16 Solid 5.08 10 0.10 24.00 0.01 % Aux 5495(7) Aux Power Out 0.000 0.000 1 #12 Solid 2.01 1 0.00 24.00 0.00% 5495 5495 Power Expander 0.075 0.175 5.295 Amps) Total Output Power Required Total Standby Current (Amps) 0.081 5.470 Total Alarm Current (Amps) Alarm Time In Minutes / 60 (5 Mins) Total Alarm AH Required Wire resistance is taken from Chapter 9 Table 8 of the National Electric Code (NFPA70). Resistance shown is calculated at 75 degrees Centigrade (167 degrees Farenheit) Standby Time In Hours 60 0.083 Total Standby AH Required 4.860 0.456 Total Combined AH Required 5.32 Multiply By The Derating Factor, 1.20 Minimum Battery AmpHours Required 1 6.38 Panel ID: Location: 5495(SK8) IRear Electric Room Model: Volts: Silent Knight 5495 Power Expander 24 VDC Max Circuit Current: Max Panel Current: 3 Amps 6 Amps Ckt.# Circuit Name Current Draw Standby Alarm Wire AWG Ohms Per Type 1000 Ft. Length(ft) Actual One -Way Ohms Volts @ EOL o oDrop 1 5495(8) Circuit 1 0.000 0.684 14 Solid 3.19 540 3.45 21.64 9.82% 2 5495(8) Circuit 2 0.000 0.684 14 Solid 3.19 640 4.08 21.21 11.64% 3 5495(8) Circuit 3 0.000 0.000 12 Solid 2.01 0.00 24.00 0.00% 4 5495(8) Circuit 4 0.000 0.000 12 Solid 2.01 0.00 24.00 0.00% Aux 5495(8) Aux Power Out 0.000 0.000 12 Solid 2.01 0.00 24.00 0.00% 5495 15495 Power Expander 0.075 0.175 1.368 Amps) Total Output Power Required Total Standby Current (Amps) 0.075 1.543 Total Alarm Current (Amps) Alarm Time In Minutes / 60 (5 Mins) Total Alarm AH Required Wire resistance is taken from Chapter 9 Table 8 of the National Electric Code (NFPA70). Resistance shown is calculated at 75 degrees Centigrade (167 degrees Farenheit) Standby Time In Hours 60 0.083 Total Standby AH Re uired 4.500 0.129 Total Combined AH Required 4.63 Multiply By The Derating Factor 1.20 Minimum Battery AmpHours Required 5.55 Project Information Project Name: Lowes #1657 Project ID: 0 Prepared By: Robert E. Evans, Inc. Date: 12/19/02 Ckt. Number: Ckt. Name: 1 5495(1) Circuit 1 Panel ID: 5495 (SK1) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 4 Wheelock AS-2475W Wall Horn/Strobe 0.000 0.165 0.000 0.660 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsil 0.000 1 0.660 Ckt. Number: 2 Ckt. Name: 5495(1) Circuit 2 Panel ID: 5495 (SK1) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 2 Wheelock AS-2475W Wall Horn/Strobe 0.000 0.165 0.000 0.330 3 Wheelock RSS-2475W Wall Strobe 0.000 0.135 0.000 0.405 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 1 0.735 Ckt. Number: Ckt. Name: 3 5495(1) Circuit 3 Panel ID: 5495 (SK1) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 6 Wheelock AS-24100C Ceiling Horn/Strobe 0.000 0.258 0. 000d 1 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 Unused 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Totals 0.000 Ckt. Number: 4 Ckt. Name: 5495(1) Circuit 4 Panel ID: 5495 (SK1) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 1 Silent Knight 5495 Power Supply Trip 0.006 0.015 0.006 0.015 0 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.006 0.015 Ckt. Number: Aux Panel ID: 5495 (SK1) Ckt. Name: 5495(1) Aux Power Out Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm 1 Wheelock MGBR-2410 10" Bell 0.000 0.030 0.000 0.030 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 0.030 Ckt. Number: Ckt. Name: 1 5495(2) Circuit 1 Panel ID: 5495(SK2) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 4 Wheelock AS-2475W Wall Horn/Strobe 0.000 0.165 0.000 0.660 0 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 0.660 Ckt. Number: 2 Ckt. Name: 5495(2) Circuit 2 Panel ID: 5495(SK2) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 0 Unused 0.000 0.000 0.000 0.000 10 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 2.360 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 2.360 Ckt, Number: Ckt. Name: 3 5495(2) Circuit 3 Panel ID: 5495(SK2) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 8 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 1.888 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 1.888 Ckt. Number: Ckt. Name: 4 5495(2) Circuit 4 Panel ID: 5495(SK2) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 1 Silent Knight 5495 Power Supply Trip 0.006 0.015 0.006 0.015 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.006 1 0.015 Ckt. Number: Aux Panel ID: 5495(SK2) Ckt. Name: 5495(2) Aux Power Out Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsil a000 0.000 Ckt. Number: Ckt. Name: 1 5495(3) Circuit 1 Panel ID: 5495(SK3) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 9 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0. 000AUnused0.000 0.000 0.000 Unused 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Totals 0.000 Ckt. Number: 2 Panel ID: 5495(SK3) Ckt. Name: 5495(3) Circuit 2 Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm 5 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 1.180 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 1.180 Ckt. Number: Ckt. Name: 3 5495(3) Circuit 3 Panel ID: 5495(SK3) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 4 Wheelock RSS-2475W Wall Strobe 0.000 0.135 0.000 0.540 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 0.540 Ckt. Number: Ckt. Name: 4 5495(3) Circuit 4 Panel ID: 5495(SK3) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 1 Silent Knight 5495 Power Supply Trip 0.006 0.015 0.006 0.015 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.006 0.015 Ckt. Number: Aux Panel ID: 5495(SK3) Ckt. Name: 5495(3) Aux Power Out Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 0.000 Ckt. Number: Ckt. Name: 1 5495(4) Circuit 1 Panel ID: 5495(SK4) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 2 Wheelock AS-24100C Ceiling Horn/Strobe 0.000 0.258 0.000 0.516 5 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 1.180 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsi 0.000 1.696 Ckt. Number: 2 Ckt. Name: 5495(4) Circuit 2 Panel ID: 5495(SK4) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 5 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 1.180 2 Wheelock AS-24100C Ceiling Horn/Strobe 0.000 0.258 0.000 0.516 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsi 0.000 1.696 Ckt. Number: Ckt. Name: 3 5495(4) Circuit 3 Panel ID: 5495(SK4) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 4 Wheelock ASWP-2475W-FR Horn/Strobe 0.000 0.120 0.000 0.480 2 Wheelock RSSWP-2475W-FR Strobe 0.000 0.102 0.000 0.204 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 0.684 Ckt. Number: 4 Panel ID: 5495(SK4) Ckt. Name: 5495(4) Circuit 4 Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm 0 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsi 0.000 T 0.000 Ckt. Number: Aux Panel ID: 5495(SK4) Ckt. Name: 5495(4) Aux Power Out Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 0. 000 Ckt. Number: Ckt. Name: 1 5395(5) Circuit 1 Panel ID: 5495(SK5) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 6 Wheelock AS-24100C Ceiling Horn/Strobe 0.000 0.258 0.000 1.548 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsi 0.000 1.548 Ckt. Number: 2 Panel ID: 5495(SK5) Ckt. Name: 5495(5) Circuit 2 Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm 8 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 1.888 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 1 1.888 Ckt. Number: Ckt. Name: 3 5495(5) Circuit 3 Panel ID: 5495(SK5) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 6 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 1.416 1 Wheelock AS-24100C Ceiling Horn/Strobe 0.000 0.258 0.000 0.258 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsj 0.000 1 1.674 Ckt. Number: 4 Ckt. Name: 5495(5) Circuit 4 Panel ID: 5495(SK5) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 0 Unused 0.000 0.000 0.000 0.000 1 Silent Knight 5495 Power Supply Trip 0.006 0.015 0.006 0.015 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.006 0.015 Ckt. Number: Aux Panel ID: 5495(SK5) Ckt. Name: 5495(5) Aux Power Out Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsi 0.000 0.000 Ckt. Number: Ckt. Name: 1 5495(6) Circuit 1 Panel ID: 5495(SK6) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 0 Unused 0.000 0.000 0.000 0.000 9 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 2.124 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsi 0.000 1 2.124 Ckt. Number: 2 Ckt. Name: 5495(6) Circuit 2 Panel ID: 5495(SK6) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 2 Wheelock AS-2475W Wall Horn/Strobe 0.000 0.165 0.000 0.330 4 Wheelock AS-24100C Ceiling Horn/Strobe 0.000 0.258 0.000 1.032 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 1.362 Ckt. Number: Ckt. Name: 3 5495(6) Circuit 3 Panel ID: 5495(SK6) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 1 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 0.236 2 Wheelock AS-24100C Ceiling Horn/Strobe 0.000 0.258 0.000 0.516 2 Wheelock AS-2475W Wall Horn/Strobe 0.000 0.165 0.000 0.330 Unused 0.000 0.000 0.000 0.000 0.000 0.000 TotalsL 0.000 1.082 Ckt. Number: 4 Panel ID: 5495(SK6) Ckt. Name: 5495(6) Circuit 4 Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm 1 Silent Knight 5495 Power Supply Trip 0.006 0.015 0.006 0.015 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.006 0 015 Ckt. Number: Aux Panel ID: 5495(SK6) Ckt. Name: 5495(6) Aux Power Out Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsil 0.000 0.000 Ckt. Number: Ckt. Name: 1 5495(7) Circuit 1 Panel ID: 5495(SK7) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 2 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 0.472 4 Wheelock AS-24100C Ceiling Horn/Strobe 0.000 0.258 0.000 1.032 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totals 0.000 1.504 Ckt. Number: 2 Panel ID: 5495(SK7) Ckt. Name: 5495(7) Circuit 2 Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm 8 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 1.888 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 1.888 Ckt. Number: Ckt. Name: 3 5495(7) Circuit 3 Panel ID: 5495(SK7) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 8 Wheelock RSS-24100C Ceiling Strobe 0.000 0.236 0.000 1.888 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsi 0.000 1.888 Ckt. Number: 4 Panel ID: 5495(SK7) Ckt. Name: 5495(7) Circuit 4 Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm 1 Silent Knight 5495 Power Supply Trip 0.006 0.015 0.006 0.015 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.006 1 0.015 Ckt. Number: Aux Panel ID: 5495(SK7) Ckt. Name: 5495(7) Aux Power Out Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 0.000 Ckt. Number: Ckt. Name: 1 5495(8) Circuit 1 Panel ID: 5495(SK8) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 4 Wheelock ASWP-2475W-FR Horn/Strobe 0.000 0.120 0 000 0.480 2 Wheelock RSSWP-2475W-FR Strobe 0.000 0.102 0.000 0.204 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 0.684 Ckt. Number: Ckt. Name: 2 5495(8) Circuit 2 Panel ID: 5495(SK8) Max Circuit Current: 3 Amps Qty Device Current Draw Each Standby Alarm Current Draw Total Standby Alarm 4 Wheelock ASWP-2475W-FR Horn/Strobe 0.000 0.120 0.000 0.480 2 Wheelock RSSWP-2475W-FR Strobe 0.000 0.102 0.000 0.204 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 0.684 Ckt. Number: 3 Panel ID: 5495(SK8) Ckt. Name: 5495(8) Circuit 3 Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 0.000 Ckt. Number: 4 Panel ID: 5495(SK8) Ckt. Name: 5495(8) Circuit 4 Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 0.000 Ckt. Number: Aux Panel ID: 5495(SK8) Ckt. Name: 5495(8) Aux Power Out Max Circuit Current: 3 Amps Qty Device Current Draw Each Current Draw Total Standby Alarm Standby Alarm Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 Unused 0.000 0.000 0.000 0.000 0.000 0.000 Totalsl 0.000 0.000 f ZUU1 01j: 22 103-361-0485 VECTOR SECURITY PAGE 03 A I>a C AC Power On AC Power Off In Alarm Normal Current Minimu Current Maximum Current Model Quantity Each Each Each Number Used Unit• Total Unit Total Unit Total D9412ID91121 1 360 x 1 = 350 350 x 1 = 350 500 x 1 = 500 074121D7212 D1255 1 20 x Quant. _ ,20 19 x Quant. = 123 x Quart = _12a D127 13 x Quant = 12 x Quart. = 45 x Quart. = D129 25 x Quant. = 25 x Quart = 25 x Quant = D185 120 x Quattt, = 120 x Quarn = 350 x Quant. = D1920 15 x Quart. = 26 x Quart. = 50 x Quant. D192C 1 _ 15 x Quart = 1 -r, 26 x Uuert = 96 50 x Quart. = Q_ D1255 104 x Quant. = 106 x ownt. = 206 x Quant. _ D1256 2— 104 X Quant. = 2Q$ 100 x Quart. a 2112 206 x Quart = A_12 D1257 104 x Quant. = 106 x Quant. = 206 x Quant. ^- D720 55 x Quant = 20 x Quant. = 75 x Quant. D6125 48 x Quant. = 4$_ 46 x Quant. _ _ 48 x Quant. D8127T/U 3 x Quant. = 3 x Quant. = 4 x Quant. D8128C 50 x Quant. = 50 x Quart. = 50 x Quant. = D8129 20 x Quant. = 20 x Quant. = 20 x Quant. t (25 x 0 of relays) = - 08130 5 x Quant. = 5 5 x Quant. _ 54 x Quani. = 5_ D9127T/U 70 0.5 x Quant. = 35 0.5 x 4uant, _ 0.8 X Quart. _ D9131A 24 x Quant, = 22 x Quant. = 36 x Quant. = 09210B 100 x Quant. = 100 x Quant. = 120 x Quant. x D928 1 14 x Quant - 14 x Quant. =14 45 x Quant. = Ad - Ratings of other devices in the system which are not shown above: 9Fc2112 1` x Quant, _ 1_ 1• x Mani, =1_ 17 x Quant. =17 i X Quant. = X Quant. = x Quant. = x Quant. = x Quant. _ x Quant. oOV x Quant, = x Quant. = x Quant. _ X Quant. = x Quant. = x Quant. = Total A = fcZ Total E = 710 Total C'• a 130 NOTES: Currents shown in milliamperes (1 ampere = 1000 milliamperes) If the column C total exceeds 1400 MA, a D8132 is required to provide an additional 1400 mA. You may also use a UL listed extemal power supply for this purpose. 09000ID7000 Series Operation & Installation Manual Page 61 74•07692-000-D 12l97 l M Current Chart First See the Current Rating Chart !or Standby Saftery CaM.umvonsfor totals B and C used in the formulas Wow. When connecting two batteries, use either Total B the 0122 Dual Battery Wiring Harness or the D8132 Battery Charger Module. Central Station or Local Systems Central Station or Local Systems require 24 hours of standby plus s minutes of alarm operation at the end of the 24 hour period. A single battery is sometimes adequate for Central Station Systems, but you must install two batteries to meet the basic standby requirements for a Local System installation. You must use battery ampere hour (Ah) calculations to verity compliance. The following formula includes the calculation for 5 minutes of alarm operation at the end of the 24 hour period, as well as a 10% contingency factor which allows for depletion of battery capacity with age. Central Stations or Local Systems Ampere- C I I t l F I Remote Station or Auxiliary Systems Ampere - Hour Calculation Formula Hours Total C Hours Contingency Total Ah x60) + ( x .083) + 10% tft Total Ah requirements must not exceed Ah capacity of batteries: Two D126 Batteries =14 Ah Household Fire Warning Equipment The Household Fire Warning Equipment Standard requires 24 hours of standby plus 4 minutes of alarm operation at the and of the 24 hour period. You must use battery ampere hour (Ah) calculations to verify compliance. The following formula includes the Calculation for 4 minutes of alarm operation at the end of the 24 hour period, as well a$ a 10% contingency factor which allows for depletion of battery capacity with age. Household rlre Ampere -Hour Calculation Formula Hour a cu a an orrttu a Total t3 Hours Total C Hours Contingency Total Ah Total B Hours Total C Hours Contingency Total Ah ( x24 ) + ( x .067) + 10% = 710 x24 ) + ( 1 '105 x .003) + 10% =—tL&3 T t 1 Ah re uirements must not exceed Ah Total Ah requirements must not exceed Ah capacity of batteries: Two D128 Batteries = 14 Ah Remote Station or Auxiliary Systems Remote Station or Auxiliary Systems require 60 hours of standby plus 5 minutes of alarm operation at the end of the 60 hour period. A D8132 Battery Charger Module with additional batteries installed in a separate 08109 or 08108A enclosure may be required in the system to meet the basic standby requirements for a Remote Station or Auxiliary System installation. You must use battery ampere hour (Ah) calculations to verify compliance. The following formula includes the calculation for 5 minutes of alarm operation at the and of the 60 hour period, as well as a 101% contingency factor which allows for depletion of battery capacity with age. oa q capacity of batteries: Two D126 Batteries = 14 Ah 09000107000 Series Operation & Installation Manual Page 63 74-07692-000-D 12/97 Underwriters Laboratories Inc. T, Northbrook, IL Santa Clara, CA Melv+tlo. NY Research Tnangle Park, NC Camas. WA A not-tor-orotit orgeniz&non aeai=ea to pu4lic safoly ana committed to quality service Applicant ID No: 544986-001 Service Center No: 1 Expires: 31-MAR-200S a,-, 4 1sue, -9 _ , MM rtM a6s'C. ?> ` •y; 4•h dl il _ W. Rv3, THIS IS TO CERTIFY that the Alarm Service Company Indicated below is included by Underwriters Laboratories Inc. (UL) In Its Product Directories as eligible to use the UL Listing Mark In connection with Certificated Alarm Systems. The only evidence of compliance with UL's requirements is the IsBuance of a UL Certificate for the Alarm System and the Cartifiaatl, is current under UL's Certificate Verifimtion Service. Limed Service From: PITTSBURG ?, PA Alarm Service Cowan y (986-001) SeiWcb Center: (544986.001) VECTOR SECURITY INC' VECTOR SECURITY INC 3400 MCKNIGHT E DR 3400,MCKNIGH7'E DR PITTSBURGH,,PA.1523i PITT$BIJRGH, PA15237 The Alarm Service Company Is Listed In the following Cartlflcate- rtric C3te6oriaP: Fife - Vot No. CCN LfsY22 Category SP4558 -1 vPTC CENTRAL STATION BURGLAR ALARM SYSTEMS BP8466 -1 CVSG MERCANTILE - BURGLAR ALARM SYSTEMS BP4111 -1 CVWY RESIDENTIALALARMi SYSTEMS- BUFIG L.ARALARM EMS 2535- 1 UUFX PROTECTIVE SIGNALING SERVICES - CENTRAL STATION BP5046 - 1. CVSU MONITORING STATION -RESIDENTIAL- BURGLAR ALARM SYSTEM THIS CERTIEICA T F EXPIRES ON 31-MAR-2003 iqN FO LOOK FOR THE UL ALARM SYS 7EM CE— , i neierIng 01999 UL Form CS CC 6M/3/96 ng12 N}AR 2002 Managqr EDIED , d stE96aS2.b8 33I n63S 31d9I S I lZIJ9D -i/n 62 :90 GeZ-6c—JdW t ** Power -Sonic -- An ISO 9002 Certified Corporation *** Page 1 of 2 4 lir l' ry r r. PS 1 2 70 12 Volt 7.1, AMp. Hr. General Specifications Dimensions: Length 5.94 inches 71 151 millimeters Width 2.56 inches IF 65 millimeters Height 3.70 inches 94 millimeters Height over Terminals 3.86 inches 98 millimeters Approximate Weight 5.75 pounds 2.60 kilograms Terminals: Quick disconnect tabs (0.187" x 0.032") Case: High -impact polystyrene Electrical Specifications Nominal Voltage: 12 Volts (6 cell in series) Nominal Capacity: 20 hour rate (350mA to 10.50 7 0 AH volts) 10 hour rate ( 650mA to 10.50 6.5 AH volts) 5 hour rate 1100mA to 10.20 volts) 5.5 AH 1 hour rate 4200mA to 9.00 volts) 4.2 AH http://www.power-sonie.com/1270.litml 4/22/02 Power -Sonic -- An ISO 9002 Certified Corporation *** Page 2 of 2. Energy Density (20 hour rate) 1.49 Watt-hours/cubic 91.0 Watt - inch hours/1 Specific Energy (20 hour rate) 14.6 Watt-hours/pound 32.2 Watt- hours/kg Internal Resistance (Fully Charged 22 milliohms (approx.) Battery) Charging Cycle Applications: Limit initial current to 1400mA. Charge until battery voltage (under charge) 14.40 to 14.70 volts at 68' F (20' Q. Hold at 14.40 to 14.70 volts until current drops to approxima 70mA. Battery is fully charged under these conditions, and charger should either be disconnecte switched to "float" voltage. Float" or "Stand-by Service": Hold battery across constant voltage source of 13.50 to 13.80 volt continuously. When held at this voltage, the battery will seek its own current level and maintain i fully charged condition. http://www,power-sonic.com/1270.html 4/22/02 Wheelock MENE011111111 i INC. FIRE ALARM SYSTEMS FM:'135-U7R5113 SERIES MB MOTOR BELLS Description Wheelock' s Series MB motor bells provide a better engineered motor bell for fire and life safety alarm systems. The Wheelock Series MB bells include higher dBA, low current draw, built-in trimplate for semi -flush mounting, low frequency aluminum shells, and low RFI noise. The motor for Series MB bells is a durable, high torque, permanent magnet motor selected for its high performance and long life. These DC vibrating Series MB motor bells are offered in 6" and 10" shell sizes in both 12 and 24 VDC models. Series RSSP Non-Sync/Sync retrofit plates are used in conjunction with the Series MB Motor Bell when combination appliances are required. These 15, 15/75, 30, 75 and 110 candela strobe plates are designed for Americans with Disabilities Act (ADA) applications while meeting or exceeding the latest requirements of NFPA 72 (National Fire Alarm Code), ANSI 117.1 (American National Standard for Accessible and Usable Buildings and Facilities), and UL Standard 1971 (Signaling Devices for the Hearing Impaired). These strobe products, when properly specified and installed in accordance with NFPA/ANSI Standards, can provide the Equivalent Facilitation allowed under ADA Accessibility Guidelines ( ADAAG General Section 2.2) by meeting or exceeding the illumination which results from ADA's strobe intensity guidelines of 75 candela at 50 feet. This is an illumination of 0.030 lumens per square foot. By specifying and installing Series RSSP Non-Sync/Sync strobe plates, along with the Series SM or DSM Sync Modules, synchronized strobe flash is achieved. Synchronized strobes can eliminate possible restrictions on the number of strobes in the field of view. Wheelock's synchronized strobes offer an easy way to comply with ADA recommendations concerning photosensitive epilepsy. Featttres Approvals include: Underwriters Laboratories UL 464, Factory Mutual ( FM), California State Fire Marshal (CSFM), New York (MEA) and Chicago (BFP) on all models. Meets OSHA 29 Part 1910.165. High sound output with low current draw. Low frequency aluminum shells for better audibility through walls, doors, and other structures. 6" and 10" shell sizes in 12 or 24 VDC models. Integral RFI suppression to minimize induced noise on the NAC circuit. Mounting options for surface, semi -flush, outdoor, and concealed conduit installation. Architects and Engineers Specifications Bell Plate SBL-2 RSSP Remote Plate Built- in trimplate makes semi -flush mounting simpler and less expensive. Screw terminals permit fast in -out field wiring of #12 to 18 AWG wire. Polarized for DC supervision of NAC circuits. Operate on filtered or unfiltered DC. For combined audible (bell) and visual signaling convenient retrofit plate assemblies are available with 15, 15/75, 30, 75 and 110 candela strobes ( Refer to Fire Alarm Products Catalog for Series RSSP Non- Sync/Sync Strobes specifications and technical information). The alarm appliances shall be Wheelock Series MB vibrating Motor Bells or approved equal. They shall be UL 464 Listed for Fire Protective Service. Shells shall be aluminum in 6" or 10" diameter. Sound output at 10 feet shall be 92 dBA. The bells shall incorporate a permanent magnet motor and suppression circuitry to minimize RFI. They shall include a built-in trimplate for semi -flush mounting to a standard 4" square backbox, or surface mounting to Wheelock's indoor BB backbox or outdoor WBB backbox. For bell strobe applications, retrofit plates Series RSSP 15 cd, 15/75 cd, 30 cd, 75 cd or 110 cd intensity strobes shall be used. All bell models shall be polarized for line supervision and shall have screw terminals for in -out field wiring of #12 to 18 AWG wire. Operating voltage shall be nominal 24 VDC or 12 VDC. Finish on all models shall be red enamel. Ordering Information Model Order Shell Input Voltage Input dBA a Mounting- 17NumberCodeSize (VDC) current 10 Ft. Options DC VIBRATING MOTOR BELLS MB- G6-12-R 3942 6" 12 0.060 92 D, E, J, K, R, S, Z MB- G6-24-R 3941 6" 24 0.030 MB- G1O-12-Ft 3944 10" 12 0.060 M8- G10.24-R 3943 10" 24 0.030 Notes: 1. Typical dBA at 10 ft. is measured in an anechoic chamber. 2. For bells all 12 VDC models are UL rated for 9.0 to 15.6 VDC and all 24 VDC models for 18.0 l0 31.0 VDC. Copyright 1998 Wheelock. All rights reserved. STROBE RETROFIT PLATES TO BE USED WITH MOTOR BELLS FOR COMBINATION SIGNALING Model Number' order Code Nominal Voltage C Strobe Candela Average Current" Amps) 0 24 VDC Wall Only Mounting Options— RSSP-2415W-FR 7792 24 15 050 D,E,Z RSSP-241575W-FR 7793 24 15/75 065 D,E,Z RSSP-2430W-FR 7794 24 30 081 D,E,Z RSSP-2475W-FR 7795 24 75 133 D,E,Z RSSP-2411OW-FR 7796 24 110 161 D,E,Z RSSP-1215W-FR 7797 12 15 126 D,E,Z RSSP-121575W-FR 7798 12 15/75 161 D,E.Z SYNC MODULE SM-12124-R 6369 12 014 E,N 24 025 E,N DSM-12/24-R 6374 12 020 W 24 038 W AVERAGE CURRENT SERIES RSSP WALL MOUNT APPLIANCES (24V) Volta RSSP-2415W RSSP-241575W RSSO-243OW RSSP-2415W RSSP-2411OW 20 VDC 0.060 0.076 0.095 0.157 0.199 24 VDC 0.050 0.065 0.081 0.133 0.161 31 VDC 0.043 0.052 0.066 0.108 0.131 AVERAGE CURRENT RSSP WALL MOUNT APPLIANCES (12V) Volta RSSP-1216W RSSP-121575W 10.5 VDC 0.148 0.189 12 VDC 0.126 0.161 15.6 VDC 0.102 0.130 Also available in white as a special order, please call customer service for order code and delivery information. Model code suffix: W = wall, F = fire or call Customer Service if other lettering is required ex. Feugo), R = red, W = white (when Ist suffix). White will be considered a special order on this product. Example: RSSP-2415W-FR -4 Red Wall \Fire Average current per actual Wheelock Product Testing 0 10.5, 12, 15.6, 20, 24, & 31 VDC Nominal Voltage. For rated average across the listed voltage range for both filtered DC and full -wave rectified FWR), see the installation instructions (P83500). Series RSSP 12 or 24 VDC models in all candelas are for wall mount only. Rotor to Data Sheet S7000 for mounting options. SPECIAL NOTES 1. Series RSSP require the use of a SM or DSM Sync Module to attain synchronization of the strobe(s). (For more detail refer to data sheet S3000 or installation instructions IP83123 for SM and P83177 for DSMI). 2. SM Sync Module is rated for 3.0 amperes at 12 or 24 VDC; DSM Sync Module is rated for 3.0 amperes per circuit. The maximum number of interconnected DSM modules is twenty. (Refer to Data sheet S3000 or installation instructions IP83123 for SM and P83177 for DSMI). iWl['ITI Fig. 1 Bell Models 1 F ROM PRECEDING + + TO NEXT BELL BELL OR ORFACP -4P- EDER Fig. 2 Retrofit Strobe Plate Models (RSSP) AUDIBLE VISIBLE r+ -r + - 1 r PRECEDING APPLIANCE - TO NEXT APPLIANCE OR FACP OR EDER RED BLX PRECEDING APPLIANCE TO NEXT APPLIANCE OR FACP OR EDER O WARNING: PLEASE READ THESE SPECIFICATIONS AND INSTALLATION INSTRUCTIONS CAREFULLY BEFORE USING, SPECIFYING OR APPLYING THIS PRODUCT. FAILURE 10 COMPLY Wlln ANY ur THESE INSTRUCTIONS, CAUTIONS AND WARNINGS COULD RESULT IN IMPROPER APPLICATION, INTALLATION AND/OR OPERATION OF THESE PRODUCTS IN AN EMERGENCY SITUATION, WHICH COULD RESULT IN PROPERTY DAMAGE, AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. Wheelock products must be used within their published specifications and must be PROPERLY specified, applied, Installed, operated, maintained and operationally tested in accordance with their installation instructions at the time of installation and at least twice a year or more often and in accordance with local, state and federal codes, regulations and laws. Specification, application, installation, operation, maintenance and testing must be performed by qualified personnel for proper operation in accordance with all of the latest National Fire Protection Association (NFPA), Underwriters' Laboratories (LIL), National Electrical Code (NEC), Occupational Safety and Health Administration (OSHA), local, state, county, province, district, federal and other applicable building and fire standards, guidelines, regulations, laws and codes including, but not limited to, all appendices and amendments and the requirements of the local authority having jurisdiction (AHJ). Due to continuous development of our products, specifications and offerings are subject to change without notice in accordance with Wheelock, Inc. standard terms and conditions NATIONAL SALES OFFICE 800.631-21I48 Canada 800-397-5777 E-mail: Info0wheelockine.com http://www.wheelockinc.com 3 YEAR WARRANTY r0 W w Distributed By: WHEELOCK, INC. 273 BRANCHPORT AVENUE LONG BRANCH, N.J. 07740 in 732-222-6880 FAX: 732-222-8707 S1500 Rev. 10/98 C-leman Cable - Security, Fire Alarm & Sound Wire & Cable - Type FPLR, Multi-Condu.. Page 1 of 2 COIEMAN 7ABL"t SIGNAL Fire Alarm Multi - Conductor Cable - Unshielded Type FPLR Conductors: Bare Copper Insulation: Foam Polypropylene Jacket: PVC with Sun Resistance, Ripcord and . Sequential Footage Marking Construction: Cabled Temperature Rating: 600C C& Operating Voltage: 300V Color Code: 16 Applications: Power limited fire alarm and communications cable for riser or non -riser applications. Fire Alarm, Smoke Detectors, Signaling, Fire Protective Circuits Approvals: UL Type FPLR NEC Article 760 ' 44f CUL Type CMP/ FT4 ?O California State FireMarshalToviewan Adobe Acrobat PDF specification, click on the PDF symbol (Gn)beside the part number. Click here to download a copy of Adobe Acrobat. Nom Max Nom Part Number of Copper Insulation Jacket Nom Cap. Wt. per Number AWG Conductors Stranding Thickness Thickness O.D. fPlft. 1000' 22 AWG Solid 98204" 22 4 Solid 006 014 117 20 12 98206 22 6 Solid 006 019 148 20 20 98208 22 8 Solid 006 019 164 20 27 98210 22 10 Solid 006 019 185 20 31 18 AWG Solid 98820 18 2 Solid .006 014 132 26 16 98803 18 3 Solid .006 014 140 25 21 98804 18 4 Solid .006 014 154 25 27 98844" 18 4 Solid .006 014 154 25 27 98805 18 5 Solid .006 019 180 25 33 98806 18 6 Solid .006 019 194 25 40 98808 18 8 Solid .006 019 210 25 52 98810 18 10 Solid .006 019 246 25 67 16 AWG Solid 98620 16 2 Solid .007 014 158 27 22 98604 16 4 Solid .007 014 185 26 40 14 AWG Solid http://www.colemancable. com/catalog/Security 110.htm 4/22/02 Coleman Cable - Security, Fire Alarm & Sound Wire & Cable - Type FPLR, Multi-Condu.. Page 2 of 2 98420 2 14 50110 u IV 6 98404 4 14 Solid .010 .017 .237 25 6 12 AWG Solid 98200 2 12 Solid .010 .017 .236 29 53 Not cabled Start Page] [Corporate] [Catalog] [New Products] [Technical] [News] [Employment] [Contact Us] 1586 South Lakesade Drive Waukegan, IL80085 Tat: 80G-323-0355 Fax 847-MB-1192 http://www.colemancable.com/catalog/Seculityl 10.htm 4/22/02 Y whmprck f I M 19A FIRE ALARM SYSTEMS Description Wheelock's Series SM and DSM Sync Modules are utilized with the Series AS/AH, Series NS/NS4/NH, Series RSS, Series RSSP, Series SL/SLM and selected strobe applications with other Wheelock combination appliances. When used with Series AS Audible Strobes and/or Series NS Horn Strobes, the SM and DSM Sync Modules provide independent operation of synchronized temporal pattern (code 3) horn and synchronized strobe flash, as well as the ability to silence the horn while maintaining the strobe flash. while using only a single pair of wires. The sync modules are available in two versions; the SM 12124 for control of a Class B NAC circuit; and a dual output version, the DSM 12/24 for control of either a Class A or two (2) Class B NAC circuits. Features Approvals include: Underwriters Laboratories (UL 1971) Listing, New York City (MEA), California State Fire Marshal CSFM) and Chicago (BFP) on all models. Uniquely designed to accept an independent strobe and audible input from the FACP and convert to a single output that connects to Wheelock's Series AS or Series NS family of audible strobes. Series SM and DSM Sync Modules can also be used to synchronize Wheelock's Series RSS, RSSP, SL and SLM Sync Strobes. 3 ampere per circuit current handling at 12 or 24 VDC. Low operating current draw. Compatible with all standard fire alarm control panels. Meets the NFPA-72 (1999) requirement for Temporal Pattern when used with the Series AS/AH and/or Series NS/NS4/NH. 3 year warranty. Copyright 2000 Wheelock, Inc. All rights reserved. SERIES SM AND DSM SYNC MODULES Series SM or DSM RECF JgNI D j ?© 03 NOTE: Al CAUTIONS and WARNINGS are identified by the symbol,& . All warnings are printed in bold capital letters. WARNING: PLEASE READ THESE SPECIFICATIONS AND INSTALLATION INSTRUCTIONS CAREFULLY BEFORE USING, SPECIFYING OR APPLYING THIS PRODUCT. FAILURE TO COMPLY WITH ANY OF THESE INSTRUCTIONS, CAUTIONSAND WARNINGS COULD RESULT IN IMPROPER APPLICATION, INSTALLATION AND/OR OPERATION OF THESE PRODUCTS IN AN EMERGENCY SITUATION, WHICH COULD RESULT IN PROPERTY DAMAGE, AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. Table 1: Sync Module (SM) Current Requirement (AMPS) Table 2: Dual Sync Module (DSM) Current Requirement (AMPS) Voltage Rated Average Current Rated Peak Current Rated Inrush Current Voltage Rated Average Current Rated Peak Current Rated Inrush Current Strobe Audible Strobe Audible Strobe Audible Strobe Audible Strobe I Audible Strobe Audible 10.5 VDC 0.008 0.004 0.032 0.004 0.032 0.004 10.5 VDC 0.015 0.003 0.112 0.003 0.299 0.053 12.0 VDC 0.009 0.005 0.036 0.005 0.034 0.005 1 12.0 VDC 0.016 0.004 0.117 0.004 0.352 0.065 24.0 VDC 0.015 0.010 0.074 0.010 0.062 0.010 124.0 VDC 0.030 0.008 0.130 0.008 0.662 0.118 31.0 VDC 0.018 0.012 0.090 0.012 0.078 0.012 31.0 VDC 0.040 0.010 0.138 0.010 0.831 0.152 10.5VRMS 0.014 0.006 0.066 0.006 0.058 0.006 10.5 VRMS 0.025 0.010 0.158 0.010 0.416 0.068 12.0 VRMS 0.015 0.007 0.072 0.007 0.066 0.007 12.0 VRMS 0.027 0.011 0.158 0.011 0.479 0.083 24.0 VRMS 0.030 0.013 0.108 0.013 0.078 0.013 24.0 VRMS 0.044 0.022 0.1941 0.022 0.838 0.138 31.0 VRMS 0.040 0.017 0.122 0.017 0.086 0.017 31.0 VRMS 0.054 0.028 0.218 0.028 1.111 0.213 A WARNING: MAKE SURE THAT THE TOTAL CURRENT REQUIRED BYALLAPPLIANCES THAT ARE CONNECTEDTOASM OR DSM DOES NOT EXCEED 3.OAOR EXCEED THE RATING OF THE FIREALARM CONTROL PANEL'S PRIMARYAND SECONDARY POWER SOURCES AND NAC CIRCUITS. OVERLOADING THESE SOURCES COULD RESULT IN LOSS OF POWERAND FAILURE TO ALERT OCCUPANTS DURINGAN EMERGENCY, WHICH COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. When calculating the total current, use Tables 1 & 2 to determine the highest value of "Rated Average Current" for the SM or DSM across the listed voltage range), then add this value to the total current for any other appliances powered by the same source and include any required safety factors. Refer to Instruction Sheet for addtional information. Q WARNING: MAKE SURE THATALL FUSES USED ON NAC CIRCUITSARE RATED TO HANDLE THE MAXIMUM INRUSH OR PEAK CURRENT FROM ALLAPPLIANCES ON THOSE CIRCUITS. FAILURE TO DO THIS MAY RESULT IN LOSS OF POWERTO THE NAC CIRCUIT AND THE FAILURE OF ALL APPLIANCES ON THAT CIRCUIT TO OPERATE, WHICH COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. Table 3: Current Consumption of the SM and DSM Modules Output Circuit Description of SM/DSM Module SM Module DSM Module Current Required from FACP Audible NAC Circuit Current Required from FACP Strobe NAC Circuit Ref. Fig. Class "B' with Audible Silence (single circuit) Y 0.010 0.015 1 Class "B' with No Audible Silence (single circuit) Y 0.025 2 Class "B' with Audible Silence (single circuit) Y 0.008 0.030 3 Class "B' with No Audible Silence (single circuit) Y 0.038 4 Class "B' with Audible Silence (dual circuit) Y 0.008 0.030 3 Class "B' with No Audible Silence (dual circuit) Y 0.038 4 Class "A' with Audible Silence (single circuit) Y 0.008 0.030 5 Class "A' with No Audible Silence (single circuit) Y 0.038 6 Note: SM Sync Modules are rated for 3.0 amperes at 12/24 VDC; DSM Dual Sync Modules are rated for 3.0 amperes per circuit. The maximum number of interconnected DSM modules is twenty (20). b CAUTION: Use SM or DSM Sync Modules only on NAC circuits with continuously applied voltage. Do not use SM or DSM Sync Modules on coded or interrupted NAC circuits in which the applied voltage is cycled on and off. ACAUTION: Power Boosters may be used in conjunction with the SM or DSM Sync Modules only in the order shown below. Only one SM or DSM Sync Module shall be allowed on a NAC circuit. Do not connect Power Booster to the NAC circuit after the one SM or DSM Sync Module. Refer to Power Booster instruction manual for proper application and installation. ACAUTION: SM and DSM Sync Modules may be used in conjunction with a POWERPATH only in the order shown below. Each output can use Sync Module (SM or DSM) to drive audible or visual synchronized appliances. Do not connect POWERPATH to the NAC after a Sync Module. FIRE POWERPATH ASJAH, ALARM OR NS/NS4/NH, CONTROL OTHER SM OR DSM RSS, RSSP, PANEL POWER SL, SLM FACP) BOOSTERS APPLIANCES SM or DSM Connection Diagram with Power Booster SPA 9d? Cr- La E tEIStSIM (ECLI40 SWC,,, Sa3,, + CL A% N% AIA W OL + caqzLrr al + + - rn F - AANSI A p 9QPYl — + / R EAR I- /Y t Ni ALll3LE lmportur AS, NS, NH and AH appNaaces drag power from strobe appRamc circuit only. FIG. 1 SINGLE CLASS "B" CIRCUIT WITH AUDIBLE SILENCE FEATURE SM SIROHE STROBE F arr C AS AS NS Q MI EOLR OUI P SEE SEE ALIUIBLE NOTE 1 NOTES I & 2 NciRCUculr AUDIBLE FIG. 2 SINGLE CLASS "B" CIRCUIT WITH NO AUDIBLE SILENCE FEATURE DSM SYNCsn+c STROBE "Ac i OUT I CIRCUIT An IN I AB Q AH Q NS Q YI EOLR rLR6 1 F AlpBLE SEENOTE , SEENOTESI E 2 A OLR C CIRCLVE 2cncur'I p AMBLE NOTE S OU,' I N 2 AS All NS YI EOIR 411YWUS 2 STROBE MAC CIRCUIT 82 SEE SEE SEE NOTE 3 NOTE , NOTES I a 2 FIG. 3 DUAL CLASS "B" CIRCUIT WITH AUDIBLE SILENCE FEATURE DSM SrNC . SYNC OUT i N 1 AS Q AN Q NS Q YT EOLR rNus , SEE SEE F AMBLE NOTE 1 NOTES I a 2 A C MAc aRcur p10 AUDIBLE Our 2 N 2 AS AH NS UT EOLR YM13 2 MAC CIRCUIT Q SEE SEE SEE NOTE 3 NOTE I NOTES I a 2 FIG. 4 DUAL CLASS "B" CIRCUIT WITH NO AUDIBLE SILENCE FEATURE DSM SYNC STROBE NAC CRCUFT OUT SYNC IN 1 AS AS NS YT rNus 1 AuoeLE ruc SEE SEECIRCUTour F AUIBOE NOTE 1 NOTES 1 A 2 A C AMBLE AMBLE MACP CRCU T RETwN NOTE 5 OUT 2 Nit UFFC RFSTROBENAC CRCLKT RETURN MMUS 2 SEE SEE SEE NOTE ] NOTE 1 NOTES 1 S.2 FIG. 5 SINGLE CLASS "A" CIRCUIT WITH AUDIBLE SILENCE FEATURE SYNC OUT1 1041 AS AS NS YT rNus 1 SEE SEE F AMBLE NOTE 1 NOTES 1 3 2 A AuoeLE NAc C cRcurour P AuoIaLE NOTE S ourz2 AS AS NS NT AUDIBLE MAC rNUS 2 CRCUR RETURN SEE SEE NOTE 1 NOTES 1 a 2 FIG. 6 SINGLE CLASS "A" CIRCUIT WITHOUTAUDIBLE SILENCE FEATURE DSM N = MAXIMUM OF DSM DSM 2 20 DSM S W m 2 + 2 0 0 0 coo ZU U W Y m J m m p i + W 0 = 7 + + SEE 000 00 NOTE FROM FACP NAC ORCUT FOR NOW/ SILENCE FIG. 7 DSM'S WIRED FOR MULTIPLE SIGNAL CIRCUITS ALL IN SYNCHRONIZATION, 20 CLASS "A" CIRCUITS OR 40 CLASS "B" CIRCUITS MAX DSM POWER BOOSTER SEE CRCUIT 92 NOTE 5 0 m $ G + m 0 0 0 0 0 0 0 SEENOIE 1 SEENOTES1 A 2 FIG. 8 DUAL CLASS "B" CIRCUIT WITH AUDIBLE SILENCE FEATURE CONNECTED WITH POWER BOOSTER Notes 1. Non -Sync Appliances can be installed before or after a SM or DSM. If the Non -Sync appliance requires audible silence, four wire connection is necessary with the strobe circuit connected before the SM or DSM NAC circuit, and the audible leads connected to a silenceable NAC circuit from the FACR 2. The audible appliance produces a momentary interruption (approximately 25ms) each time the strobes flash. 3. Circuit #2 may be omitted if only 1 circuit is required when using the DSM. 4. Power Boosters may be used in conjunction with the SM or DSM Sync Modules ONLY in the order shown in Figure 8. Only one SM or DSM Sync Module Output shall be allowed on a NAC circuit. Do not connect Power Booster to the NAC cirWit after the one SM or DSM Sync Module. Refer to Power Booster instruction manuals for proper application and installation (Installation Instruction P83123 or SM 8 P83177 DSM). 5. Non -Sync Audible Appliances can be installed on the audible NAC. Be aware of the current requirement for the SM or DSM module. See table 3. A WARNING: ALTHOUGH UL TESTING HAS VERIFIED THAT SYNC MODULES FUNCTION EVENAT 80% OF THEIR MINIMUM RATING AND 110% OF THEIR MAXIMUM RATING, WHEELOCK STRONGLY RECOMMENDS THAT THE VOLTAGE APPLIED TO THESE PRODUCTS BE WITHIN THEIR RATED INPUT VOLTAGE RANGE. THE APPLICATION OF IMPROPER VOLTAGE MAY RESULT IN DEGRADED OPERATION OR DAMAGE TO THESE PRODUCTS, WHICH COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/ OR OTHERS. Wheelock products must be used within their published specifications and must be PROPERLY specified, applied, installed, operated, maintained and operationally tested in accordancewith their installation instructions at the time of installation and at least twice a year or more often and in accordance with local, state and federal codes, regulations and laws. Specification, application, installation, operation, maintenance and testing must be performed by qualified personnel for proper operation in accordance with all of the latest National Fire Protection Association (NFPA), Underwriters' Laboratories (UL), National Electrical Code (NEC), Occupational Safety and Health Administration (OSHA), local, state, county, province, district, federal and other applicable building and fire standards, guidelines, regulations, laws and codes including, but not limited to, all appendices and amend- ments and the requirements of the local authority having jurisdiction (AHJ). A WARNING: CONTACT WHEELOCK FOR "INSTALLATION INSTRUCTIONS" P83123-SM & P83177-DSM) AND "GENERAL INFORMATION' SHEET ON THESE PRODUCTS. These documents do undergo periodic changes. It is important that you have current information on these products. These materials contain important information that should be read prior to specifying or installing these products including: TOTAL CURRENT REQUIRED BY ALL APPLIANCES CONNECTED TO SYSTEM SECONDARY POWER SOURCES. FUSE RATINGS ON NAC CIRCUITS TO HANDLE MAXIMUM INRUSH OR PEAK CURRENTS FROM ALL APPLIANCES ON THOSE NAC CIRCUITS. COMPOSITE FLASH RATE FROM MULTIPLE STROBES WITHIN APERSON'S FIELD OF VIEW. THE VOLTAGE APPLIED TO THESE PRODUCTS MUST BE WITHIN THEIR RATED IN PUT VOLTAGE RANGE. INSTALLATION IN OFFICEAREASAND OTHER SPECIFICATION AND INSTALLATION ISSUES. USE STROBES ONLY ON NAC CIRCUITS WITH CONTINUOUSLY APPLIED OPERATING VOLTAGE. DO NOT USE STROBE ON CODED OR INTERRUPTED NAC CIRCUITS IN WHICH THE APPLIED VOLTAGE IS CYCLED ON AND OFFAS THE STROBE MAY NOT FLASH. Ordering Information Model Order Coda tout Roe VDT Avwape Current @ 12 or 24VDC Moun*V Options" SM-24-R 6369 12 014 W 24 025 W DSM- 63741 12 1 .020 W 24 1 AM W R = Red Average current per actual Wheelock Production Listing @ 12 & 24 VDC Nominal Voltage. Refer to Data sheet # S-7000 for Mounting Options. The maximum number of interconnected DSM modules is twenty (20). The total distance from the first to the last DSM shall not exceed 1,000 feet of #18 AWG wire. Use only #18 AWG wire. Architects and Engineers Specfcations The sync modules shall be Wheelock Series SM or DSM Sync Modules. Series SM or DSM Sync Modules shall be the master controllers for Wheelock Series AS/AH, NS/NS4/NH, RSS, RSSP, SL, SLM appliances where a synchronized audible/visual audible or visual only appliance is specified. All modules shall be UL listed under Standard 464. Series SM and DSM modules shall be designed to interface with Series AS Audible Strobe Appliances and NS Horn Strobe Appliances to produce a synchronized temporal (Code 3) horn as well as synchronized strobe flash on a two -wire alarm circuit. Other synchronized products are the Wheelock Series RSS, RSSP, SL, SLM visual only appliances and Series AH and NH Horn Appliances. SM Sync Module shall incorporate two input NAC circuits for power connection from the Fire Alarm Control Panel; one for the strobe NAC circuit and one for the audible NAC circuit. DSM modules shall provide an additional strobe circuit input/output for control of either two Class "B" NAC circuits or a single Class "A" NAC circuit. Upon activation of the audible silence function at the Fire Alarm Control Panel, the audible signal component of Series AS Audible Strobe and/ or the Series NS Horn Stobe may be silenced while maintaining strobe activation. Series SM or DSM module shall be designed and available in two versions; the SM 12/24 for control of a single Class B NAC circuit and a dual output version, the DSM-12/24 for control of either ClassAtwo (2) Class B NAC circuits. The DSM dual circuit version shall provide the additional capability of "daisy -chaining", that is, the ability to interconnect multiple DSM's for synchronous horn and strobe operation on multiple NAC circuits. Interconnection capability shall be for a maximum of 40 NAC circuits. All modules shall operate on either 12 or 24 VDC. Rated average current requirement for the SM 12124 shall be .014 amperes @ 12 VDC and .025 amperes @ 24 VDC. The DSM 12/24 shall be .020 amperes @ 12 VDC and .038 amperes @ 24 VDC. A single circuit SM Sync Module shall be capable of handing a 3 ampere load at 12 or 24 VDC and the dual circuit DSM Sync Module shall be capable of handling a load of 3 amperes per NAC circuit at 12 or 24 VDC. All versions shall be polarized for DC supervision and shall incorporate screw terminals for in/out field wiring of #18 to 12 AWG wire size. The SM and DSM Sync modules shall mount to a 4-11/16" x 2-1/8" deep backbox. MADE IN THE USA NOTE: Due to continuous development of our products, specifications and offerings are subject to change without notice in accordance with Wheelock Inc. standard terms and conditionsf— NATIONAL SALES OFFICE 800-631-2148 3 YEAR WARRANTY Canada @800-3 ckinc. 7 E-Mail: lnfo@wheelockinc.com MENU http://www.wheelockinc.com 273 BRANCHPORTAVENUE • LONG BRANCH, NJ 07740 • TEL Distributed By: 732-222-6880 • FAX: 732-222-2588 S3000 08100 whedock INC. 273 Branchport Avenue Long Branch, NJ 07740 800) 631-2148 (USA) 800) 397-5777 (CANADA) www.wheelockinc.com Thank you for using our products. INSTALLATION INSTRUCTIONS SERIES ASWP AUDIBLE STROBE WEATHERPROOF APPLIANCE 2-WIRE WALL MOUNT VERSION) Use this product according to this instruction manual. Please keep this instruction manual for future reference. GENERAL: Wheelock's Series ASWP appliance is the industry's first 2-wire horn strobe alarm appliance that provides a selectable continuous or Code 3 horn tone and continuous strobe when connected directly to the Fire Alarm Control Panel (FACP), or provides a synchronized Code 3 horn tone and synchronized strobe when used in conjunction with a Sync Module (SM), Dual Sync Module (DSM) or Wheelock's Power Supply (PS-12/24-8 UL Only). The ASWP appliance is UL Listed under Standard 1638 for Emergency Devices for the hearing impaired (Visual Signal appliances), indoor/outdoor use, and UL Standard 464 for Audible Signal appliances. The ASWP is also ULC Listed under Standard CAN/ULC-S525-M87 for Visual Signaling Appliances and Standard CAN/ULC-S525-99 for Audible Signaling Appliances. The strobe has a 75 candela intensity on axis at -350C and a low current draw. For outdoor application the ASWP must be wall mounted to the Weatherproof Backbox (WPBB) . The ASWP uses a Xenon flashtube with solid state circuitry enclosed in a rugged Lexan® lens to provide maximum visibility and reliability for effective visible signaling. The ASWP appliance can be field set to provide either High (HI) dBA, Medium (MED) dBA or Low (LO) dBA sound output. The strobe is designed for use with either filtered DC (VDC) or unfiltered Full -Wave -Rectified (FWR) input voltage. All inputs are polarized for compatibility with standard reverse polarity supervision of circuit wiring by a FACP. NOTE: The Code 3 horn incorporates the temporal pattern (1/2 second on, 1/2 second off, 1/2 second on, 1/2 second off, 1/2 second on, 1-1/2 off and repeat) specified by ANSI/NFPA for standard emergency evacuation signaling. The Code 3 horn should be used only for fire evacuation signaling and not for any other purpose. NOTE: All CAUTIONS and WARNINGS are identified by the symbol 0 All warnings are printed in bold capital letters. 0 WARNING: THE ASWP STROBE APPLIANCE IS A "FIRE ALARM DEVICE - DO NOT PAINT." NOTE: All Canadian Installations should be in accordance with the Canadian Standard for the Installation of Fire Alarm Systems - CANIULC-S524-01 and Canadian Electrical Code, Part 1. Final acceptance is subject to Authorities Having Jurisdiction. 0 WARNING: PLEASE READ THESE INSTRUCTIONS CAREFULLY BEFORE USING THIS PRODUCT. FAILURE TO COMPLY WITH ANY OF THE FOLLOWING INSTRUCTIONS, CAUTIONS AND WARNINGS COULD RESULT IN IMPROPER APPLICATION, INSTALLATION AND/OR OPERATION OF THESE PRODUCTS IN AN EMERGENCY SITUATION, WHICH COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. SPECIFICATIONS: Table 1: UL/ULCRatin Models Regulated Voltage Range Limit Voltage Range Per Strobe Strobe Voltage Per UL 1638/464 CAN/ULC-S526-87/S525-99 Candela at 25°C Candela -35°C DC/VRMS C/FWR CIVRMS cd) ed) ASWP-2475W 24 16.0-33.0 20.0-31.0 180 75 NOTE: THE MAXIMUM WIRE IMPEDANCE BETWEEN STROBES SHALL NOT EXCEED 35 OHMS. THE MAXIMUM NUMBER OR STROBES ON A SINGLE NOTIFICATION APPLIANCE CIRCUIT SHALL NOT EXCEED 47. Copyright 2000 Wheelock, Inc. All rights reserved. RE%! CDI — BAN 13 2003 P83957 F Sheet 1 of 7 WARNING: FOR UL APPLIACATIONS THESE APPLIANCES WERE TESTED TO THE OPERATING VOLTAGE LIMITS OF 16-33 VOLTS USING FILTERED (DC) OR UNFILTERED FULL -WAVE RECTIFIED (FWR). DO NOT APPLY 80% AND 110% OF THESE VOLTAGE VALUES FOR SYSTEM OPERATION. WARNING: FOR ULC APPLIACATIONS THESE APPLIANCES WERE TESTED TO THE OPERATING VOLTAGE LIMITS OF 20-31 VOLTS USING FILTERED (DC) OR UNFILTERED FULL -WAVE RECTIFIED (FWR). APPLY 80% AND 110% OF THESE VOLTAGE VALUES FOR SYSTEM OPERATION. Table 2: UL/ULC dBA Sound Out, ut Description Volume Reverberant Per UL 464 Anechoic dBA Per CAN/ULC-S525-99 16.OVD C 24.OVD C 33.OVD C 20.OVDC 24.OVD C 31.0VDC Continuous Hom Low 79 82 82 88 90 92 Medium 85 88 88 93 95 97 High 88 91 91 97 99 101 Code 3 Horn Low 75 75 75 88 90 92 Medium 79 82 82 93 95 97 Hi h 82 85 85 97 99 101 WARNING: CHECK THE MINIMUM AND MAXIMUM OUTPUT OF THE POWER SUPPLY AND STANDBY BATTERY AND SUBTRACT THE VOLTAGE DROP FROM THE CIRCUIT WIRING RESISTANCE TO DETERMINE. THE APPPLIED VOLTAGE TO THE STROBES. NOTES: 1) Strobe will produce 1 flash per second over the "Regulated Voltage" range. 2) Anechoic dBA is measured on -axis in a non -reflective (free field) test room using fast meter response. For peak dBA (measured with peak meter response), add 5dBA to anechoic values shown in Table 2. Reverberant dBA is a minimum UL rating based on sound pressure measurements in a reverberant test room. 3) All models are UL Listed for indoor and outdoor use with a temperature range of -31 °F to 150°F (-35°C to +66*C) and maximum humidity of 93% RH, ± 2%. 4) Ratings - tested range -20% below and 10% above rated voltage range. Table 3: UL/ULC Current Ratings (AMPS) with Hi dBA Setting Rated Average Current UL Voltage ULC Voltage RMS MEAN 16.0VDC 20.0VDC 0.195 0.199 24.0VDC 24.0VDC 0.176 0.153 33.0VDC 31.0VDC 0.173 0.145 16.0VRMS 20.0VRMS 0.167 24.0VRMS 24.OVRMS 0.184 33.OVRMS 31.OVRMS 0.190 Rated Peak Current ** UL Voltage ULC Voltage ASWP-2475W 16.0 VDC 20.OVDC 0.260 24.0VDC 24.OVDC 0.340 33.OVDC 3 LOVDC 0.345 16.OVRMS 20.0VRMS 0.340 24.0VRMS 24.OVRMS 0.345 33.OVRMS 3 LOVRMS 0.560 Rated Inrush Current *** UL Voltage ULC Voltage ASWP-2475W 16.0VDC 20.OVDC 0.108 24.0VDC 24.OVDC 0.165 33.0VDC 3 LOVDC 0.210 16.0VRMS 20.0VRMS 0.145 24.OVRMS 24.OVRMS 0.210 33.OVRMS 3 LOVRMS 0.275 Rated average current is measured using mean value. * * The time duration for the peak current is 100 microseconds. The time duration for the inrush current is 4 milliseconds. P83957 F Sheet 2 of 7 Table .3A: Rated Average Current (AMPS) with Medium and Low dBA Setting Rated Average Current Medium * UL Voltage ULC Voltage RMS MEAN 16.OVDC 20.OVDC 0.175 0.169 24.0VDC 24.OVDC 0.155 0.126 33.OVDC 3 LOVDC 0.145 0.104 16.OVRMS 20.OVRMS 0.148 24.OVRMS 24.OVRMS 0.163 33.OVRMS 31.0VRMS 0.158 Rated Average Current Low * UL Voltage ULC Voltage RMS MEAN 16.OVDC 20.OVDC 0.173 0.163 _ 24.OVDC 24.OVDC 0.147 0.119 33.OVDC 31.0VDC 0.132 0.098 16.OVRMS 20.OVRMS 0.141 24.OVRMS 24.OVRMS 0.159 33.OVRMS 3 LOVRMS 0.149 Rated average current is measured using mean value. 0 WARNING: MAIM SURE THAT THE TOTAL AVERAGE CURRENT, TOTAL PEAK CURRENT AND TOTAL INRUSH CURRENT REQUIRED BY ALL APPLIANCES THAT ARE CONNECTED TO THE SYSTEM'S PRIMARY AND SECONDARY POWER SOURCES, SIGNALING CIRCUITS, SM, DSM SYNC MODULES AND PS-12/24-8 POWER SUPPLY DO NOT EXCEED THE POWER SOURCES' RATED CAPACITY OR THE CURRENT RATINGS OF ANY FUSES ON THE CIRCUITS TO WHICH THESE APPLIANCES ARE WIRED. OVERLOADING POWER SOURCES OR EXCEEDING FUSE RATINGS COULD RESULT IN LOSS OF POWER AND FAILURE TO ALERT OCCUPANTS DURING AN EMERGENCY, WHICH COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. When calculating the total average, peak or inrush currents: Use Table 3 and 3A to determine the highest value of "Rated Average Current" for an individual strobe (across the expected operating voltage range of the strobe) or use Table 3 and 3A to determine the highest value of "Rated Inrush Current" or "Rated Peak Current" (whichever is higher) of an individual strobe (across the expected voltage range of the strobe) then multiply the value by the total number of strobes; be sure to add the currents for any other appliances, including audible signaling appliances, powered by the same source and include any required safety factors. If the inrush current or peak current exceeds the power supplies' inrush capacity, the output voltage provided by the power supplies may drop below the listed voltage range of the appliances connected to the supply and the voltage may not recover in some types of power supplies. For example, an auxiliary power supply that lacks filtering at its output stage (either via lack of capacitance and/or lack of battery backup across the output) may exhibit this characteristic. ACAUTION: The ASWP appliances are not designed to be used on coded systems in which the applied voltage is cycled on and off. LIGHT DISTRIBUTION: A4 AS Table 4: Candela at Various Angles Per UL 1638 Model Rated Candela A 1 A2 A3 A4 A5 A6/A7 ASWP-2475W 75.Ocd 180 16 16 15 15 8 P83957 F Sheet 3 of 7 SOUND OUTPUT (SPL) SETTINGS: WARNING: THE AUDIBLE STROBE APPLIANCES MUST BE FIELD SET TO THE DESIRED TONE AND dBA SOUND OUTPUT LEVEL BEFORE THEY ARE INSTALLED. THIS IS DONE BY PROPERLY INSERTING JUMPER PLUGS IN ACCORDANCE WITH THESE INSTRUCTIONS. INCORRECT SETTINGS WILL RESULT IN IMPROPER PERFORMANCE, WHICH COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. Figure 1: Showing Location of Jumper Plug CODES O HI MED LO Factory setting is on medium dB and Code 3. Figure 2: Jumper plug settings for High, Medium, Low and Code 3 SHOWN SET ON HIGH dB H I -- ( MED r-t SHOWN SET ON MED dB LCDW :::: SHOWN SET ON LOW dB Use needle nose pliers to pull and properly set the jumper plugs) Figure 3: Juniper plug setting fir Continuous Horn TURN PLUG 90- CODE 3 No jumper plug is needed for continuous horn setting. However, it is recommended that the jumper plug be retained in the unit for future use (if needed) as shown in Figure 4. NOTE: The ASWP must be set for Code 3 when used with the sync module. WIRING INFORMATION: Figure 4. Figure 5. 1) AS-24MCW Appliance has in -out wiring PROM PRECEDING - TO NEXT APPLLANCE OR terminals that accepts two -#12 to 18 American PPUANCE OR SYNC ' - END OF LINE MODULE RESISTOR (EOLR) Wire Gauge (AWG) wires at each screw terminal. Strip leads 3/8" inches for connection to screw terminals. 2) Break all in -out wire runs on supervised circuit When the sync module is used, the audible tone will be the supervision as shown in Figure 5. The polarity Code 3 sound only. Refer to Sync Module installation shown in the wiring diagrams is for the instruction sheets SM (P83123), DSM (P83177) or PS-12/24-8 operation of the appliances. The polarity is P83862) for additional information. reversed by the FACP during supervision. P83957 F Sheet 4 of 7 MOUNTING: WARNING: REMOVAL OF THE PRINTED CURCUIT BOARD COVER AT THE BACK OF THE MOUNTING PLATE COULD RESULT IN SEVERE ELECTRIC SHOCK. CAUTION: The following figures show the maximum number of field wires (conductors) that can enter the backbox used with each mounting option. If these limits are exceeded, there may be insufficient space in the backbox to accommodate the field wires and stresses from the wires could damage the product. Although the limits shown for each mounting option comply with the National Electrical Code (NEC), Wheelock recommends use of the largest backbox option shown and the use of approved stranded field wires, whenever possible, to provide additional wiring room for easy installation and minimum stress on the product from wiring. SURFACE (INDOOR/OUTDOOR) WPBB 6-20 X 1-3/4- BACKBOX SCREW SUPPLIED) 4 0 WOOD SCREWS SUPPUED) MAXIMUM NUMBER OF CONDUCTORS AWG #18 AWG #16 AWG #14 AWG #12 4 4 4 4 MOUNTING PROCEDURES: Use this mounting procedure to position the field wires in the backbox so that they use minimum space and produce minimum stress on the product. This is especially important for stiff, heavy gauge wires and wires with thick insulation or sheathing. 1. Connect 4 field wires to the ASWP terminal block (polarity must be observed). 2. Bend the 4 field wires up 90° at the connection to the terminal block. 3. Carefully push the 4 field wires into the backbox by hand. 4. Carefully press the ASWP to the backbox, verifying that the ASWP is in contact with the gasket all the way around. It should not be resting on the lip of the backbox. 5. Screw the ASWP to the WPBB using the #6-20 X 1-3/4" screw supplied. MOUNTING NOTES: OWARNING: THIS UNIT MUST BE WALL MOUNTED ON A FLAT SURFACE, SO THAT THE WALL COVERS THE ENTIRE BACK SURFACE, AND WITH THE DRAIN HOLES POINTED DOWN TOWARD THE GROUND AND TOP" FACING UP. WHEN USED IN AN OUTDOOR APPLICATION OR A NEMA 3R APPLICATION KNOCKOUTS IN THE REAR OF THE BACKBOX MUST REMAIN INTACT. CAUTION: Check that the installed product will have sufficient clearance and wiring room prior to installing backboxes and conduit, especially if sheathed multiconductor cable or 3/4" conduit fittings are used. 1. Conduit entrances to the backbox should be selected to provide sufficient wiring clearance for the installed product. 2. When terminating field wires, do not use more lead length than required. Excess lead length could result in insufficient wiring space for the signaling appliance. 3. Do not pass additional wires (used for other than the signaling appliance) through the backbox. Such additional wires could result in insufficient wiring space for the signaling appliance. 4. The effect of shipping and storage temperatures do not adversely affect the performance of the appliances when stored in the original cartons and are not subjected to misuse. P83957 F Sheet 5 of 7 WARNING: IF AUDIBLE STROBE APPLIANCES ARE OPERATED WITHIN 15 INCHES OF A PERSON'S EAR, THEY CAN PRODUCE A SOUND PRESSURE LEVEL THAT EXCEEDS THE MAXIMUM 120dBA PERMITTED BY ADA AND OSHA RULES. EXPOSURE TO SUCH SOUND LEVELS CAN RESULT IN DAMAGE TO A PERSON'S HEARING. WARNING: WHEN INSTALLING STROBES IN AN OPEN OFFICE OR OTHER AREAS CONTAINING PARTITIONS OR OTHER VIEWING OBSTRUCTIONS, SPECIAL ATTENTION SHOULD BE GIVEN TO THE LOCATION OF THE STROBES SO THAT THEIR OPERATING EFFECT CAN BE SEEN BY ALL INTENDED VIEWERS, WITH THE INTENSITY, NUMBER, AND TYPE OF STROBES BEING SUFFICIENT TO MAKE SURE THAT THE INTENDED VIEWER IS ALERTED BY PROPER ILLUMINATION, REGARDLESS OF THE VIEWER'S ORIENTATION. FAILURE TO DO SO COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. WARNING: A SMALL POSSIBILITY EXISTS THAT THE USE OF MULTIPLE STROBES WITHIN A PERSON'S FIELD OF VIEW, UNDER CERTAIN CIRCUMSTANCES, MIGHT INDUCE A PHOTO -SENSITIVE RESPONSE IN PERSONS WITH EPILEPSY. STROBE REFLECTIONS IN A GLASS OR MIRRORED SURFACE MIGHT ALSO INDUCE SUCH A RESPONSE. TO MINIMIZE THIS POSSIBLE HAZARD, WHEELOCK STRONGLY RECOMMENDS THAT THE STROBES INSTALLED SHOULD NOT PRESENT A COMPOSITE FLASH RATE IN THE FIELD OF VIEW WHICH EXCEEDS FIVE (5) Hz AT THE OPERATING VOLTAGE OF THE STROBES. WHEELOCK ALSO STRONGLY RECOMMENDS THAT THE INTENSITY AND COMPOSITE FLASH RATE OF INSTALLED STROBES COMPLY WITH LEVELS ESTABLISHED BY APPLICABLE LAWS, STANDARDS, REGULATIONS, CODES AND GUIDELINES. NOTE: NFPA 72/ANSI 117.1 conform to ADAAG Equivalent Facilitation Guidelines in using fewer, higher intensity strobes within the same protected area. These appliances can produce a distinctive three pulse Temporal Pattern Fire Alarm Evacuation Signal (for total evacuation) in accordance with NFPA 72, 1999 Edition. CAUTION: Check the installation instructions of the manufacturers of other equipment used in the system for any guidelines or restrictions on wiring and/or locating Notification Appliance Circuits (NAC) and notification appliances. Some system communication circuits and/or audio circuits, for example, may require special precautions to assure electrical noise immunity (e.g. audio crosstalk). NOTE: This equipment has been tested and found to comply with the limits for a Class B digital appliance, pursuant to Part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: 1) Reorient or relocate the receiving antenna, 2) Increase the separation between the equipment and receiver, 3) Connect the equipment into an outlet on a circuit different from that to which the receiver is connected, and 4) Consult the dealer or an experienced radio/TV technician for help. The Audible Strobe products and these instructions are copyrighted by Wheelock and the Audible Strobe products contain proprietary, confidential and trade secrets of Wheelock. No part of the Audible Strobe products and these instructions may be photocopied, printed or reproduced in any form or modified, adapted, changed or enhanced, or converted to another programming language, or used to create updated, related or derivative works, without the prior written consent of Wheelock. No part of the Audible Strobe products shall be decomposed, disassembled or reverse engineered. ANY MATERIAL EXTRAPOLATED FROM THIS DOCUMENT OR FROM WHEELOCK MANUALS OR OTHER DOCUMENTS DESCRIBING THE PRODUCT FOR USE IN PROMOTIONAL OR ADVERTISING CLAIMS, OR FOR ANY OTHER USE, INCLUDING DESCRIPTION OF THE PRODUCT'S APPLICATION, OPERATION, INSTALLATION AND TESTING IS USED AT THE SOLE RISK OF THE USER AND WHEELOCK WILL NOT HAVE ANY LIABILITY FOR SUCH USE. P83957 F Sheet 6 of 7 IMPORTANT: READ SEPARATE "GENERAL INFORMATION• SHEET FOR INFORMATION ON THE PLACEMENT, LIMITATIONS, INSTALLATION, FINAL CHECKOUT, AND PERIODIC TESTING OF NOTIFICATION APPLIANCES. Limited Warranty Wheelock products must be used within their published specifications and must be PROPERLY specified, applied, installed, operated, maintained and operationally tested in accordance with these instructions at the time of installation and at least twice a year or more often and in accordance with local, state and federal codes, regulations and laws. Specification, application, installation, operation, maintenance and testing must be performed by qualified personnel for proper operation in accordance with all of the latest National Fire Protection Association (NFPA), Underwriters' Laboratories (UL), Underwriters' Laboratories of Canada (ULC), National Electrical Code (NEC), Occupational Safety and Health Administration (OSHA), local, state, county, province, district, federal and other applicable building and fire standards, guidelines, regulations, laws and codes including, but not limited to, all appendices and amendments and the requirements of the local authority having jurisdiction (AH.n. Wheelock products when properly specified, applied, installed, operated, maintained and operationally tested as provided above are warranted against mechanical and electrical defects for a period of three years from date of manufacture (as determined by date code). Correction of defects by repair or replacement shall be at Wheelock's sole discretion and shall constitute fulfillment of all obligations under this warranty. THE FOREGOING LIMITED WARRANTY SHALL IMMEDIATELY TERMINATE IN THE EVENT ANY PART NOT FURNISHED BY WHEELOCK IS INSTALLED IN THE PRODUCT. THE FOREGOING LIMITED WARRANTY SPECIFICALLY EXCLUDES ANY SOFTWARE REQUIRED FOR THE OPERATION OF OR INCLUDED IN A PRODUCT. WHEELOCK MAKES NO REPRESENTATION OR WARRANTY OF ANY OTHER KIND, EXPRESS, IMPLIED OR STATUTORY WHETHER AS TO MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE OR ANY OTHER MATTER. USERS ARE SOLELY RESPONSIBLE FOR DETERMINING WHETHER A PRODUCT IS SUITABLE FOR THE USER'S PURPOSES, OR WHETHER IT WILL ACHIEVE THE USER'S INTENDED RESULTS. THERE IS NO WARRANTY AGAINST DAMAGE RESULTING FROM MISAPPLICATION, IMPROPER SPECIFICATION, ABUSE, ACCIDENT OR OTHER OPERATING CONDITIONS BEYOND WHEELOCK'S CONTROL. SOME WHEELOCK PRODUCTS CONTAIN SOFTWARE. WITH RESPECT TO THOSE PRODUCTS, WHEELOCK DOES NOT WARRANTY THAT THE OPERATION OF THE SOFTWARE WILL BE UNINTERRUPTED OR ERROR -FREE OR THAT THE SOFTWARE WILL MEET ANY OTHER STANDARD OF PERFORMANCE, OR THAT THE FUNCTIONS OR PERFORMANCE OF THE SOFTWARE WILL MEET THE USER'S REQUIREMENTS. WHEELOCK SHALL NOT BE LIABLE FOR ANY DELAYS, BREAKDOWNS, INTERRUPTIONS, LOSS, DESTRUCTION, ALTERATION, OR OTHER PROBLEMS IN THE USE OF A PRODUCT ARISING OUT OF OR CAUSED BY THE SOFTWARE. THE LIABILITY OF WHEELOCK ARISING OUT OF THE SUPPLYING OF A PRODUCT, OR ITS USE, WHETHER ON WARRANTIES, NEGLIGENCE, OR OTHERWISE, SHALL NOT IN ANY CASE EXCEED THE COST OF CORRECTING DEFECTS AS STATED IN THE LIMITED WARRANTY AND UPON EXPIRATION OF THE WARRANTY PERIOD ALL SUCH LIABILITY SHALL TERMINATE. WHEELOCK IS NOT LIABLE FOR LABOR COSTS INCURRED IN REMOVAL, REINSTALLATION OR REPAIR OF THE PRODUCT BY ANYONE OTHER THAN WHEELOCK OR FOR DAMAGE OF ANY TYPE WHATSOEVER, INCLUDING BUT NOT LIMITED TO, LOSS OF PROFIT OR INCIDENTAL OR CONSEQUENTIAL DAMAGES. THE FOREGOING SHALL CONSTITUTE THE SOLE REMEDY OF THE PURCHASER AND THE EXCLUSIVE LIABILITY OF WHEELOCK. IN NO CASE WILL WHEELOCK'S LIABILITY EXCEED THE PURCHASE PRICE PAID FOR A PRODUCT. Limitation of Liability WHEELOCK'S LIABILITY ON ANY CLAIM OF ANY KIND, INCLUDING NEGLIGENCE AND BREACH OF WARRANTY, FOR ANY LOSS OR DAMAGE RESULTING FROM, ARISING OUT OF, OR CONNECTED WITH THIS CONTRACT, OR FROM THE MANUFACTURE, SALE, DELIVERY, RESALE, REPAIR OR USE OF ANY PRODUCT COVERED BY THIS ORDER SHALL BE LIMITED TO THE PRICE APPLICABLE TO THE PRODUCT OR PART THEREOF WHICH GIVES RISE TO THE CLAIM. WHEELOCK'S LIABILITY ON ANY CLAIM OF ANY KIND SHALL CEASE IMMEDIATELY UPON THE INSTALLATION IN THE PRODUCT OF ANY PART NOT FURNISHED BY WHEELOCK. IN NO EVENT SHALL WHEELOCK BE LIABLE FOR ANY CLAIM OF ANY KIND UNLESS IT IS PROVEN THAT OUR PRODUCT WAS A DIRECT CAUSE OF SUCH CLAIM. FURTHER, IN NO EVENT, INCLUDING IN THE CASE OF A CLAIM OF NEGLIGENCE, SHALL WHEELOCK BE LIABLE FOR INCIDENTAL OR CONSEQUENTIAL DAMAGES. SOME STATES DO NOT ALLOW THE EXCLUSION OR LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES, SO THE PRECEDING LIMITATION MAY NOT APPLY TO ALL PURCHASERS. 11/01 P83957 F Sheet 7 of 7 alhceiocJc _._ tow M EA .. . Fire Alarm Systems Helping P euple Take Action DESCRIPTION: Wheelock's Weatherproof Strobe, Audible Strobe, Audible Horn and Multitone Strobe appliances have an extended temperature range of -31'F to 150'F (-35'C to 66'C) that will satisfy virtually all outdoor and severe environment applications. All strobes are Indoor/Outdoor UL 1638 Listed and rated for 75 candela @ -31'F 35-C). The Wheelock Weatherproof Appliances are designed for maximum performance, reliability, and cost effectiveness while meeting or exceeding the latest requirements of NFPA 72 (National Fire Alarm Code), UL Standard 1638 (Standard for Visual Signaling Appliances), and UL 464 (Standard for Audible Signaling Appliances). Series RSSWP Strobes, Series ASWP Audible Strobes and Series AHWP Audibles may be synchronized when used in conjunction with the Wheelock SM and DSM Sync Modules or the PS-12/24-8 Power Supply with Wheelock's Patented Sync Protocol. The Series MTWP is a true 4-wire appliance. The strobe portion can be synchronized as stated above. The multitone portion cannot, but it can be connected to a coded fire alarm system. Weatherproof Strobe Series RSSWP Is UL 1638 approved for Indoor/Outdoor use. The appliances use a Xenon flashtube with solid state circuitry enclosed in a rugged Lexan® lens to provide maximum visibility and reliability for effective visual signaling. The Series RSSWP mounts to a Series WPSBB Weatherproof Backbox. Weatherproof Audible Strobe and Audible Series ASWP and AHWP Is UL 1638 and UL 464 approved for Indoor/Outdoor use and offer a field selectable choice of continuous horn or temporal pattern (Code 3) when constant voltage from the Fire Alarm Control Panel (FACP) is applied. Additionally, the audible has three (3) selectable dBA settings of 99, 95, and 90 dBA in both tones and, when synchronized, may be silenced while maintaining strobe activation. The Series ASWP mounts to a WPBB Weatherproof Backbox while the Series AH mounts to a WBB Weahterproof Backbox. SERIES RSSWP, ASWP, AHWP, MTWP and MT-12/24 WEATHERPROOF STROBE WEATHERPROOF AUDIBLE STROBE AND WEATHERPROOF AUDIBLES SERIES MTWP Mounted to IOB-R SERIES RSSWP Mounted to WPSBB-R SERIES AHWP Mounted to WBB-R SERIES ASWP Mounted to WPBB-R FEATURES Approvals include: UL 1638, UL 464, California State Fire Marshall (CSFM) and New York City (MEA). Pending: MEA on MTWP, Factory Mutual (FM) on MTWP and RSSWP and Chicago (BFP). Designed to meet or exceed NFPA, UFC, ANSI 117.1, OSHA Part 29, 1910.165, and ADA requirements. UL 1638 and UL 464 listed with extended temperature range of -31' to 150°F (-35°C to 66*C) 24 VDC with new UL "Regulated" Voltage Range: of 16-33 VDC using filtered DC or unfiltered FWR voltage. Note: The Series MT-12/24 voltage range is 10.5 - 15.6 f 0 3 VDC f ')A Weatherproof Multitone Strobe and Multitone Horn V). VDC (or 12V) and 2 - 1 (or Series MTWP and MT-12/24 Sync/Non-Sync in each product. Note: The audible Is UL 1638 and UL 464 approved for Indoor/Outdoor portion of the Series MTWP and MT-12/24 is non sync use and offers a field selectable choice of 8 nationally only. and internationally recognized alerting signals. Synchronize with Series SM, DSM Sync Modules or Additionally, the audible has 2 installer selectable sound PS-12/24-8 Power Supply with built-in patented sync output levels: Standard and high covering a range protocol. depending on selected signal) of 76-94 dBA Selectable dBA settings. reverberant. The Series MTWP is a true 4 wire appliance. The Strobe portion can be synchronized or Selectable alert signals. non -synchronized. The multitone (audible) portion - EC Ecannotbesynchronized, but it can be connected to VE j nd OUT wiring termination that accepts two #12-18 G wires at each terminal. coded fire alarm system. The Series MTWP and the MT-1 2/24 mount to a series IOB Backbox. puts are polarized for compatibility with JANqm001dustrystandardCoovpn2002Wx.elod , Inc A nahm tivea reverse olarit su ervison. polarity P NOTE: All CAUTIONS and WARNINGS are identified by the symbol $AR WARNINGS are printed in bold capital letters. AWARNING: PLEASE READ THESE SPECIFICATIONS AND ASSOCIATED INSTALLATION INSTRUCTIONS CAREFULLY BEFORE US.NG, SPECIFYING OR APPLYING THIS PRODUCT. FAILURE TO COMPLY WITH ANY OF THESE INSTUCTIONS, CAUTIONS, OR WARNINGS COULD RESULT IN IMPROPER APPLICATION, INSTALLATION, AND/OR OPERATION OF THESE PRODUCTS IN AN EMERGENCY SITUATION, WHICH COULD RESULT IN PROPERTY DAMAGE, AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. General Notes: Wheelock UL 1638 Strobes are designed to produce 30-62flashes per minute over the Regulated Voltage Range. If used in an indoor application, UL 1638 strobes must be operated at a minimum of 20 VDC to meet the NFPA-72 (1999) flash rate of 1 to 2 flashes pers second and ADA Guideline flash rate of 1 to 3 flashes per second. Wheelock Weatherproof Appliances are designed to operate over an extended temperature range of -31'F to 150'F (-35'C to 66'C) and all candela ratings represent minimum effective strobe intensity based on UL 1638. Maximum humidity of 93% RH t 2%. Regulated Voltage Range" is the newest terminology used by UL to identify the voltage range. Prior to this change, UL used the terminology "Listed Voltage Range". Table 1: Average Current* for Series RSSWP and Strobe in MTWP Avg. Current * Strobe 75 cd @ Regulated 31*F (-35'C) Voltage Range 16.0 24.0 33.0 VDC I VDC I VDC RSSWP-2475W-FR 1 16.0 - 33.0 VDC 1 .150 1 .102 1 .086 Table 3: Average Current* (AMPS) for Series AHWP Voltage AH-24WP Voltage AH-12WP AH-24WP Hi / Med / Low AH-12WP Hi / Med / Low 16.0 VDC 035 / .020 1.014 8.0 VDC 093 / .037 / .030 24.0 VDC 041 / .024 / .017 12.0 VDC 100 / .043 / .035 33.0 VDC 1 .053 / .030 / .021 17.5 VDC 1 128 / .056 / .040 Average aurent per adual Wheelock production IesUrg. For rated average, peak and in Hush current across Ure UL listed voltage range for both filtered DC and urfipered VRMS, see InStallabw Instnrdions. Table 2: Average Current* (AMPS) For Series ASWP° Voltage High dBA Setting 99) dBA Medium dBA Setting 95) dBA Low dBA Setting 90) dBA 16.0 VDC 190 161 155 24.0 VDC 145 120 113 33.0 VDC .138 .099 Audible and Visual combined. 093 Table 4: dBA Ratings for Series ASWP & AHWP Description Volume Reverberant dBA Per UL 464@10R Anechoic dBA @10 tL 24 VDC 24 V DC Continuous Horn High 91 99 Med 88 95 Low 82 90 Code 3 Hofn High 85 99 Med 82 95 Low 75 90 Table 5: Average Current* (AMPS) for 24 V Series MTWP (Audible and Visual combined) Tone 16.0 VDC 24.0 VDC 33.0 VDC Standard High Standard High Standard High Hom 0.167 0.179 0.125 0.140 0.117 0.135 Bell 0.160 0.165 0.114 0.121 0.102 0.110 March Time 0.167 0.178 0.126 0.149 0.117 0.135 Code 3 Horn 0.167 0.178 0.126 0.149 0.117 0.135 Code 3 Tone 0.162 0.178 0.118 0.128 0.107 0.121 Slow Whoop 0.167 0.199 0.126 0.148 0.119 0.145 Siren 0.167 0.187 0.124 0.136 0.114 0.130 Hi/Lo 0.163 0.177 0.115 0.122 0.104 0.112 Table 6: Average Current* (AMPS) for Series MT-12/24 and audible of MTWP Tone 12.0 VDC 24.0 VDC Standard High Standard High Horn 0.020 0.100 0.023 0.040 Bell 0.010 0.031 0.012 0.014 March Time 0.020 0.100 0.023 0.040 Code 3 Horn 0.020 0.100 0.023 0.040 Code 3 Tone 0.015 0.060 0M17 0.028 Slow Whoop 0.025 0.100 0.026 0.048 Siren 0.020 0.082 0.023 0.036 H Lo 0.012 0.044 0.014 0.020 Table 7: dBA Ratings for Series MTWP and MT-12124 Tone Standard MTWP MT-12/24 Higgh Sailing 16.0 VDC 24.0 V DC 33.0 VDC 20.0 VDC 24.0 VDC 10.5 VDC 12.0 VDC Horn Standard 84 87 90 82 85 82 85 High Setting 89 92 94 88 91 88 91 Bell Standard 76 80 83 75 79 75 1 79 High Setting 83 86 88 82 85 82 85 March Time Standard 80 84 87 79 82 79 82 High Setting 86 89 91 85 88 85 88 Code 3 Horn Standard 79 83 86 75 79 75 79 High Setting 85 88 90 85 85 85 85 Code 3 Tone Standard 76 80 82 75 75 75 75 High Setting 81 85 86 79 82 79 82 Slow Whoop Standard 81 85 87 82 82 82 82 High Setting 87 90 92 88 88 88 88 Siren Standard 81 84 87 82 82 82 82 High Setting 86 89 92 85 88 85 88 Hi/Lo Standard 77 81 84 79 79 79 79 High Setting 83 86 89 82 85 82 85 Table 8: UL Ratings Model Nominal Voltage VDC/VRMS) Regulated Input VDC) Strobe Candela Per UL 1638 ASWP-2475W 24 16.0-33.0 75 AH-12WP-R 12 8.0-17.5 AH-24WP-R 24 16.0-33.0 RSSWP-2475W 24 16.0-33.0 75 MTWP-2475W 24 16.0-33.0 75 MT-12124 24 20.0-31.0 Table 9: SYNC MODULES I POWER SUPPLY Average Input Current" Model Number Voltage AMPS) @ VDC) 24 VDC SM-12/24-R # 12/24 028 DSM-12/24-R ## 12/24 038 PS-1 2/24-8 #A# 1 120 VAC SM Sync Module is rated for 3.0 amperes @ 24 VDC. DSM Sync Module is rated for 3.0 amperes per circuit. The maximum number of interconnected DSM Modules is twenty (20). Refer to Data Sheet S3000 or Installation Instructions P83123 for SM and P83177 for DSM). Refer to Data Sheet S9001 or Installation Instructions P83862 for PS-1 2/24-8 Power Supply. Wiring Diagrams SERIES MTWP AUDIBLE APPLIANCE AND STROBE OPERATE INDEPENDENTLY FROM TO NEXT PRECEDING + AUDIBLE OR AUDIBLE OR _ EOLR FACP FROM + PRECEDING TO NEXT STROBE OR STROBE OR EOLR FACP o I."- STROBE AUDIBLE SERIES MTWP AUDIBLE APPLIANCE AND STROBE OPERATE IN UNISON. RED AND BLACK SHUNT -WIRES ARE SUPPLIED. FROM TO NEXT PRECEDING + + APPLIANCE APPLIANCE _ RED_ OR EOLR OR FACP BLACK STROBE AUDIBLE SERIES RSSWP, ASWP, AHWP, MTWP AND MT-12/24 APPLIANCES FROM TO NEXT PRECEDING + + APPLIANCE APPLIANCE OR OR EOLR FACP 2V APPLIANCE Wiring Diagrams SERIES MTWP APPLIANCES SYNCHRONIZED STROBE OPERATION WITH CODED FACP TWP SYNC 0 0 Strobe Mu- Sync TO THE NEXTModule NAC NAc#1 or APPLIANCE PS-1M,I.8 Audible 0 OR EOLRPowerCroyt FACP Supply NAC #2 SERIES RSSWPIASWP APPLIANCES SYNCHRONIZED W/ DSM MODULE SINGLE CLASS "A" NAC CIRCUIT DSM STROBE NAC SYNC CIRCUIT OUT our1 RSS tY11NUS 1 FACP AUDIBLE 0 MINUS 2 IN 2 RSS RSS STROBE NAC UT 2 CIRCUIT RETURN SERIES RSSWP/ASWP APPLIANCES SYNCHRONIZED W/MULTIPLE DSM MODULES CLASS "B" NAC CIRCUITS DSM #1 Sync Strobe NAC Cir. 0 + RSS" RSS F 0- DSM #2 Sy+c SwP RSSWPStrobeNACCir. C J DSM #3 P Sync Strobe NAC Cir. RSSwP RSSwP DSM Interconnecting wiring shown. Maximum of twenty (20) JkWARNING: CONTACT WHEELOCK FOR THE CURRENT "INSTALLATION INSTRUCTIONS" AND GENERAL INFORMATION" SHEET (P82380) ON THESE PRODUCTS. THE INSTALLATION INSTRUCTIONS ARE AS FOLLOWS: P84135 FOR SERIES RSSWP, P83957 FOR SERIES ASWP, P83641 FOR SERIES AH-WP, P84150 FOR SEREIS MTWP AND P824671 FOR SERIES MT-12/24-R. THESE DOCUMENTS UNDERGO PERIODIC CHANGES. IT IS IMPORTANT THAT YOU HAVE CURRENT INFORMATION ON THESE PRODUCTS. THESE MATERIALS CONTAIN IMPORTANT INFORMATION THAT SHOULD BE READ PRIOR TO SPECIFYING OR INSTALLING THESE PRODUCTS, INCLUDING: TOTAL CURRENT REQUIRED BY ALL APPLIANCES CONNECTED TO SYSTEM SECONDARY POWER SOURCES. FUSE RATINGS ON NOTIFICATION APPLIANCE CIRCUITS TO HANDLE PEAK CURRENTS FROM ALL APPLIANCES ON THOSE CIRCUITS. ADDING, REPLACING OR CHANGING APPLIANCES WILL EFFECT CURRENT DRAW. RECALCULATE CURRENT DRAW TO INSURE THAT THE TOTAL AVERAGE CURRENT AND TOTAL PEAK REQUIRED BY ALL APPLIANCES DO NOT EXCEED THE RATED CAPACITY OF THE POWER SOURCE OR FUSES. COMPOSITE FLASH RATE FROM MULTIPLE STROBES WITHIN A PERSON'S FIELD OF VIEW. THE VOLTAGE APPLIED TO THESE PRODUCTS MUST BE WITHIN THEIR "REGULATED VOLTAGE RANGE". USE STROBES ONLY ON CIRCUITS WITH CONTINUOUSLY APPLIED OPERATING VOLTAGE. DO NOT USE STROBES ON CODED OR INTERRUPTED CIRCUITS IN WHICH THE APPLIED VOLTAGE IS CYCLED ON AND OFF AS THE STROBE MAY NOT FLASH. FAILURE TO COMPLY WITH THE INSTALLATION INSTRUCTIONS OR GENERAL INFORMATION SHEETS COULD RESULT IN IMPROPER INSTALLATION, APPLICATION, AND/OR OPERATION OF THESE PRODUCTS IN AN EMERGENCY SITUATION, WHICH COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. CONDUCTOR SIZE (AWG), LENGTH AND AMPACITY SHOULD BE TAKEN INTO CONSIDERATION PRIOR TO DESIGN AND INSTALLATION OF THESE PRODUCTS, PARTICULARLY IN RETROFIT INSTALLATIONS. SPECIFICATIONS AND ORDERING INFORMATION Model Order Code Non- Sync Sync w/ SM, DSM or PS-12/24-8 Strobe cd @ -31-F 35°C) dBA Input Voltage Outdoor Mounting ems. Strobe RSSWP-2475W-FR 9013 Yes I Yes I 75cd I - 124VDC I T Audible Strobe ASWP-2475W-FR 9012 Yes Yes 75cd 90/95/99 24 VDC I Multitone Strobe MTWP-2475W- R B420 Yes Yes, Strobe ONy 75cd 75-94 24 VDC M Homs/Audibles At-R 7892 Yes Yes N/A 90/95/99 24 VDC K 12WP-R 7891 Yes Yes WA 90/95/99 12 VDC K MT-1224-R 5023 Yes WA M Back Boxes USE WIM WPSBB-R 9751 RSSWP WPBB-R 9014 ASWP IOB-R 5046 MTWP & MT-12/24R WBB-R 2959 A -NW Sync Modules and Power Supply SM-1224-R 6369 No Yes WA NIA 12or 4 W DSM-12r24R 6374 No Yes WA N/A 12or 4 W PS-1224-8 8114 Yes Yes WA N/A 120 VAC WA Refer to data sheet S7000 for mounting options ARCHITECTS AND ENGINEERS SPECIFICATIONS The Weatherproof Strobe appliances shall be Wheelock Series RSSWP-2475W strobes or approved equals. The Series RSSWP shall meet and be listed for UL Standard 1638 (Standard for Visual Signaling Appliances) for Indoor/ Outdoor use. The strobe appliances shall produce a flash rate of 30-62 flashes per minute over the Regulated Voltage Range of 16 to 33 VDC and shall incorporate a Xenon flashtube enclosed in a rugged Lexan® lens. The strobe shall be rated at 75cd and shall operate over an extended temperature range of -31 °F to 150'F (-35°C to 66°C). All inputs shall be polarized for compatibility with standard reverse polarity supervision of circuit wiring by a Fire Alarm Control Panel. When synchronization is required, the appliances shall be compatible with the Wheelock Series SM and DSM Sync Modules or the Wheelock PS-12/24-8 Power Supply with built-in, patented sync protocol. The strobes shall not drift out of synchronization at any time during operation. If the sync module fails to operate, (i.e., contacts remain closed), the strobe shall revert to a non -synchronized flash rate. The Series RSSWP shall be mounted only to the WPSBB-R Backbox. The Weatherproof Audible Strobe and Audible appliances shall be Wheelock Series ASWP-2475W Audible Strobes and Wheelock Series AHWP Audible Horns or approved equals. The Series ASWP and Series AHWP shall meet and be listed for UL Standard 1638 (Standard for Visual Signaling Appliances) for Indoor/Outdoor use. The strobe appliances shall produce a flash rate of 30-62 flashes per minute over the Regulated Voltage Range of 16 to 33 VDC and shall incorporate a Xenon flashtube enclosed in a rugged Lexan® lens. The strobe shall be rated at 75cd and shall operate over an extended temperature range of -31 °F to 150°F (-35°C to 66°C). All inputs shall be polarized for compatibility with standard reverse polarity supervision of circuit wiring by a Fire Alarm Control Panel (FACP). The Series ASWP shall be mounted only to the WPBB-R Backbox while the Series AHWP shall only be mounted to the WBB-R Backbox. The weatherproof audible strobe appliances shall be designed for two -wire operation and shall provide either a continuous or temporal (Code 3) tone when constant voltage from a Notification Appliance Circuit (NAC) of the Fire Alarm Control Panel (FACP) is applied. They shall be designed so that the audible signal may be silenced while maintaining strobe activation. When synchronization is required, the appliances shall be compatible with the Wheelock Series SM and DSM Sync Modules or the Wheelock PS-12/24-8 Power Supply with built-in, patented sync protocol. The strobes shall not drift out of synchronization at any time during operation. If the sync fails to operate, (i.e., contacts remain closed), the strobe shall revert to a non -synchronized flash rate. The Weatherproof Multitone Strobe and Multitone Audible appliances shall be a Wheelock Series MTWP and MT-12124 or equivalent. The Series MTWP shall meet and be listed for UL Standard 1638 (Standard for Visual Signaling Appliances) for indoor/outdoor use_ The strobe portion of the appliance shall produce a flash rate of 30-62 flashes per minute over the listed voltage range of 20-31 VDC and shall incorporate a Xenon flash tube enclosed in a rugged Lexan® lens. The strobe shall be rated at 75cd. The series MTWP shall operate over an extended temperature range of -31 °F to 150°F (-35°C to 66°C). All inputs shall be polarized for compatibility with industry standard reverse polarity of circuit wiring by a Fire Alarm Control Panel. The audible portion of the Series MTWP as well as the Series MT-12/24 shall provide eight field selectable alarm signals. The signals shall consists of: Horn, Bell, March Time, Code 3 Horn, Code 3 Tone, Slow Whoop, Siren and HULo. Tone selection shall be by a durable dip switch assembly. Clips or Jumpers are not acceptable. The appliance shall provide two output sound levels: Standard and High dBA. The range of dBA shall be 75 to 94 dBA. The Series MTWP shall have an operating voltage of 24 VDC nominal) while the Series MT-12/24 shall operate at either 12 or 24 VDC (nominal) using filtered power or unfiltered power (full wave rectified). Both models shall have provisions for In/Out field wiring using terminals that accept #12 to 18 AWG wiring. When synchronization is required, the Series MTWP shall be compatible with the Series SM and DSM Sync Modules or with the Series PS-12/24-8 Power Supply with built-in, patented sync protocol. Note: The Strobe portion of the Series MTWP may be synchronized. The audible portion of the appliance cannot. The audible portion of the appliance can be connected to a coded fire alarm system. The Series MTWP and the Series MT-12/24 shall be mounted only to the IOB-R Backbox. Due to continuous development of our products, specifications and offerings are subject to change without notice in accordance with Wheelock Inc. standard terms and conditions. WE ENCOURAGE AND SUPPORT NICET CERTIFICATION MADE IN THE USA 3 YEAR WARRANTY NATIONAL SALES OFFICE 800-631-2148 X& g Canada 800-397-5777 E-Mail: Info@wheelockinc.com hV://www.wheelockinc.com Distributed By: 273 BRANCHPORT AVENUE • LONG BRANCH, NJ 07740 • TEL: 732-222-6880 • FAX: 732-222-2588 S9004 Rev 02/02 awAlock u uir a h ADti r r c rrarr__nia / i1FJafS M EA _ ... ... "-' FIRE ALARM SYSTEMS Helping People Tale Action" 100N0 SPEC 1 FIRE A&-4.dfr.f Ne1d-Candela A1-gW1 ccs-k Description Wheelock's patented 2-wire Series AS Audible Strobe Appliances and Series AH Audibles offer more features with less current draw and Zero Inrush. Strobe options for wall mount models include 15/75cd or Wheelock's patented Multi -Candela strobe with field selectable candela settings of: 15, 30, 75 or 110cd. Ceiling mount models are available in 15, 30, 75 or 100cd intensities. The audible provides a selectable choice of either a continuous horn or temporal pattern (Code 3) when constant voltage from a Fire Alarm Panel (FACP) is applied. Each tone has 3 dBA settings to choose from. Additionally, the audible may be silenced while maintaining strobe activation. SERIES AS SINGLE & MULTI -CANDELA AUDIBLE STROBE APPLIANCES SERIES AH AUDIBLES SERIES AS SERIES AH fNltlN re y.. xiy C- y ? .!' [ a'!.FJ' 1h L+p 1,tu• iNY: Multi -Candela Indicator bottom of lens) All models may be synchronized when used in Features conjunction with the Wheelock SM, DSM Sync Modules or the PS-12124-8 Power Supply with Wheelock's Approvals include: UL 1971, California Patented Sync Protocol. State Fire Marshall (CSFM), New York CityNeYork MEA), Factory Mutual (FM), Chicago (BFP). ADA/NFPA/UFC/ANSI Compliant. Synchronization of the continuous horn tone provides the Wall mount models are available with Field temporal (Code 3) tone as mandated by NFPA-72 (1999) Selectable Candela Settings of 15, 30, 75 or 110cd for all audible appliances. This ensures a distinct Multi -Candela models) or 15/75cd. temporal (Code 3) pattern when 2 or more audibles are Ceiling mount models are available in 15, 30, 75 within hearing distance. If not synchronized, or 100cd. the temporal sound may overlap and not be distinctive. Selectable Continuous Horn or Temporal (Code 3). At the same tirne, the strobes will also be synchronized. 3 Selectable dBA settings (99, 95 and 90 dBA) in both This provides the ability to comply with ADA tones. Patented 2-Wire Audible Strobe Appliance. recommendations concerning photosensitive epilepsy and Patented Universal Mounting Plate. NFPA and UFC standards when installing two or more Strobes produce 1 flash per second over the regulated visual appliances within the field of view. voltage range. 12 and 24 VDC models with wide New UL "Regulated All of this, plus the ability to silence the audible is Voltage" using filtered DC or unfiltered VRMS achieved by using only 2 WIRES. input voltage. Wall Mount or Ceiling Mount models. Synchronize with Wheelock SM, DSM or PS-12/24-8 Power Supply with Wheelock's built-in sync protocol. ZERO Inrush above Peak. For Weatherproof Series AS, See Datasheet S9004 jQ %ible with all Wheelock 2-Wire products. 1 tion with IN / OUT screw terminals using 12 to #AWG wires. d ~ N 3 Copyright 2002 Wheelock Inc. All rights reserved. 2003 NOTE: All CAUTIONS and WARNINGS are identified by the symbol. All warnings are printed In bold capital letters. A,WARNING: PLEASE READ THESE SPECIFICATIONS AND ASSOCIATED INSTALLATION INSTRUCTIONS CAREFULLY BEFORE USING, SPECIFYING OR APPLYING THIS PRODUCT. FAILURE TO COMPLY WITH ANY OF THESE INSTRUCTIONS, CAUTIONS OR WARNINGS COULD RESULT IN IMPROPER APPLICATION, INSTALLATION AND/OR OPERATION OF THESE PRODUCTS IN AN EMERGENCY SITUATION, WHICH COULD RESULT IN PROPERTY DAMAGE, AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. General Notes Strobes are designed to flash at 1 flash per second minimum over the Regulated Voltage Range. Note that NFPA-72 (1999) specifies a flash rate of 1 to 2 flashes per second and ADA Guidelines specify a flash rate of 1 to 3 flashes per second. All candela ratings represent minimum effective Strobe intensity based on UL 1971. Series AS Strobe products are listed under UL 1971 for indoor use with a temperature range of 32e F to 120' F (0e C to 49e C) and maximum humidity of 93% (t 2%). Series AH-24 horns are listed under UL 464 for audible signal appliances (Indoor use only). Series AH-24WP audible appliances are listed under UL 464 for indoor/outdoor use with a temperature range of 31'F to 150eF (35eC to 66•C) and maximum humidity of 95%. Regulated Voltage Range" is the newest terminology used by UL to identify the voltage range. Prior to this change, UL used the terminology "Listed Voltage Range". Table 1: Ratings Per UL 1971 Model Input Voltage VDC Regulated Voltage Range VDC/FWR Strobe Candela led) AS-24MCW-FR 24 16.0 - 33.0 15d30l75/110 AS-241575W-FR 24 16.0 - 33.0 15 (75 on Axis) AS-121575W-FR 12 8.0 - 17.5 15 (75 on Axis) AS-2415C-FW 24 16.0 - 33.0 15 AS-2430C-FW 24 16.0 - 33.0 30 AS-2475C-FW 24 16.0 - 33.0 75 AS-2410OC-FW 24 16.0 -33.0 100 ASWP-2475W-FR 24 16.0 - 33.0 751d -31-F Table 2 Average current - (AMPS) for AS24 MC Wall Models @ Each Candala Selling Average Cuna x omilll High MA Setting 09 d864 VO&W 15cd 30rd 75ud 110cd 1&0 VDC 495 142 242 308 241)VDC DL8 120 174 224 33,0 VDC OIB 120 152 190 Average Cum*wM Madan dBA Sd*V 05 dBA) 16D VDC L81 128 225 296 24DVDC Lm 105 157 207 330 VDC L88 L90 119 157 Average Q+raltiNh Law dBA Setng (90 CIBA) 16D VOC D77 119 222 294 24D VDC LW LBO 142 200 33.0 VDC 055 Doi 109 147 Table 3: Average Current' (AMPS) Series A l-24-R/W a WP (Hom only) VOLTAGE High Medium Low 16.0 VDC 033 019 013 24.0 VDC 039 023 016 33.0 VDC 050 028 0m SM Sync Module is rated for 3.0 amperes @ 24 VDC. DSM Sync Module is rated for 3.0 amperes per circuit. The maximum number of interconnected DSM modules is twenty (20). Refer to Data Sheet S3000 or Installation Instructions (P83123 for SM and P83177 for DSM). Refer to Data Sheet S9001 or Installation Instructions P83862 for PS-12124-8 Power Supply. Table 4: Average Current' (AMPS) Series AS-241575 VOLTAGE High Medium Low 16.0 VDC 124 108 103 24.0 VDC 102 083 077 33.0 VDC 100 077 067 SYNC MOOUIES I POWER SUPPLY Omar Input A-ge current Mountini; Modal MarE.r Cod. V(wge) AMPS) @ Options" 24 VDC M-12r24-ft 8969 24 025 W OSM-12a4-R' 6374 24 038 F-a114 VAC H Table 5: dBA Ratings for 12 VDC and 24 VDC Series ASIAH 12 and 24 VDC Audible Description Volume Reverberant dBA Per UL 464 @ 10 ft. Anechoic d8A Q 10 ft. Continuous Horn High 91 99 Medium 88 95 Low 83 90 Code 3 Hom High 87 99 Medium 84 95 Low 79 90 Table 6: Average Current' (AMPS) for Calling Mount 24 V Audible Strobe At the 3 Audible Settings @ 16. 24, and 33 VDC dBA Levels Models Voltage 16.0 VDC 24.0 VDC 33.OVDC Average Current with High dBA Setting (99 dBA) AS-2415C 130 106 102 AS-2430C 178 135 131 AS-2475C 357 248 200 AS-24100C A04 277 245 Average Current with Medium d8A Setting (95 d8A) AS-2415C 116 091 079 AS-2430C 164 120 103 AS-2475C 339 226 179 AS-241001- r 389 258 217 Average Current with Low dBA Setting (90 dBA) AS-2415C 112 082 069 AS-2430C 160 113 095 AS-2475C 332 219 164 AS-24100C 382 252 207 Table 7: Avenge Cunent -(AMPS) for Wall IWS cd 12 V Audible Strobe At th. 3 Audlbl. S.tsnga ® a, 12, a 17.5 V.hag. dBA Level Modal a.e VDC 12.0 VDC 17.5 voc Avwge Cunent with High d8A AS-121576W 408 258 251 99 dBA) Avenge Cumnt with Medium AS-121516W 364 211 182 dBA (95 dBA) Avenge Cunene with Low dBA AS-121675W 348 1- 162 90 dBA) Average Current per actual Wheelock Production Testing at listed VDC. For Rated Average and Peak current across UL Regulated Voltage Range for both Filtered DC and Unfiltered VRMS, see Installation Instructions- Refer to Data Sheet S7000 for Mounting Options. A WARNING: CONTACT WHEELOCK FOR THE CURRENT "INSTALLATION INSTRUCTIONS" (P83947) SERIES AS-24MCW, (P84023 AND P84024) SERIES AS SINGLE CANDELA, (P83519) Seies AH, (P83641) Series AH-WP AND "GENERAL INFORMATION" SHEET (P82380) ON THESE PRODUCTS. THESE DOCUMENTS UNDERGO PERIODIC CHANGES. IT IS IMPORTANT THAT YOU HAVE CURRENT INFORMATION ON THESE PRODUCTS. THESE MATERIALS CONTAIN IMPORTANT INFORMATION THAT SHOULD BE READ PRIOR TO SPECIFYING OR INSTALLING THESE PRODUCTS, INCLUDING: TOTra.L CURRENT REQUIRED BY ALL APPLIANCES CONNECTED TO SYSTEM SECONDARY POWER SOURCES. FUSE RATINGS ON NOTIFICATION APPLIANCE CIRCUITS TO HANDLE PEAK CURRENTS FROM ALL APPLIANCES ON THOSE CIRCUITS. ADDING, REPLACING OR CHANGING APPLIANCES OR CHANGING CANDELA SETTINGS WILL EFFECT CURRENT DRAW. RECALCULATE CURRENT DRAW TO INSURE THAT THE TOTAL AVERAGE CURRENT AND TOTAL PEAK REQUIRED BY ALL APPLIANCES DO NOT EXCEED THE RATED CAPACITY OF THE POWER SOURCE OR FUSES. COMPOSITE FLASH RATE FROM MULTIPLE STROBES WITHIN A PERSON'S FIELD OF VIEW. THE VOLTAGE APPLIED TO THESE PRODUCTS MUST BE WITHIN THEIR "REGULATED VOLTAGE RANGE". INSTALLATION OF 110 CANDELA STROBE PRODUCTS IN SLEEPING AREAS. INSTALLATION IN OFFICE AREAS AND OTHER SPECIFICATION AND INSTALLATION ISSUES. THESE APPLIANCES ARE NOT DESIGNED TO BE USED ON CODED SYSTEMS IN WHICH THE APPLIED VOLTAGE IS CYCLED ON AND OFF. FAILURE TO COMPLY WITH THE INSTALLATION INSTRUCTIONS OR GENERAL INFORMATION SHEETS COULD RESULT IN IMPROPER INSTALLATION, APPLICATION, AND/OR OPERATION OF THESE PRODUCTS IN AN EMERGENCY SITUATION, WHICH COULD RESULT IN PROPERTY DAMAGE AND SERIOUS INJURY OR DEATH TO YOU AND/OR OTHERS. CONDUCTOR SIZE (AWG), LENGTH AND AMPACITY SHOULD BE TAKEN INTO CONSIDERATION PRIOR TO DESIGN AND INSTALLATION OF THESE PRODUCTS, PARTICULARLY IN RETROFIT INSTALLATIONS. Wiring Diagrams' _ SERIES AS APPLIANCES NON -SYNCHRONIZED FROM TO NEXT PRECEDING + ±APPLIANCE APPLIANCE OR EOLR OR FACP SERIES AS APPLIANCES SYNCHRONIZED W/ DSM MODULE CLASS -A" NAC CIRCUIT W/ NO AUDIBLE SIENCE FEATURE DSM STROBE + NAC SYNC 00CIRCUIT OUT OUt1 a. , " - I "EM: IN 2 ST AI . OUf2 NAC CIRCUIT RETURN SERIES AS APPLIANCES SYNCHRONIZED WI SM MODULE CLASS "B" NAC CIRCUIT WI AUDIBLESILENCE FEATURE SM F A C•A mnlx PI STROBE Strobx NAC Circuit STROBE EOLR AuJiblx AS AS rAl-blx NAC C—ii SERIES AS APPLIANCES SYNCHRONIZED W/ MULTIPLE DSM MODULES DSM #1 DSM Interconnecting wiring shown. Maximum of twenty (20) SERIES AS & RSS APPLIANCES SYNCHRONIZED W/ PS-12-24-8 AS GUrPUrS f fYH F A.A35 A sOR AS C 2-awsSA' P AS For detail using SM or DSM Sync Module refer to Data Sheet S3000 Or Installation Instructions (P83123 for SM and P83177 for DSM). For wiring information on the PS-12/24-8 Power Supply refer to Installation Instructions P83862. Wheelock products must be used within their published specifications and must be PROPERLY specified, applied, installed, operated, maintained and operationally tested in accordance with their installation instructions at the time of installation and at least twice a year or more often and in accordance with local, state and federal codes, regulations and laws. Specification, application, installation, operation, maintenance and testing must be performed by qualified personnel for proper operation in accordance with all of the latest National Fire Protection Association (NFPA), Underwriters' Laboratories (UL), National Electrical Code (NEC), Occupational Safety and Health Administration (OSHA), local, state, county, province, district, federal and other applicable building and fire standards, guidelines, regulations, laws and codes including, but not limited to, all appendices and amendments and the requirements of the local authority having jurisdiction (AHJ). Architects and Engineers Specifications The notification appliances shall be Wheelock Series AS Audible Strobe appliances and Series AH Audible appliances or approved equals_ The Series AS Audible Strobe shall meet and be listed for UL Standard 1971 (Emergency Devices for the Hearing -Impaired) for Indoor Fire Protection Service. The Series AH Audible shall be UL Listed under Standard 464 (Fire Protective Signaling). The audible/strobe shall be listed for indoor use and both shall meet the requirements of FCC Part 15 Class B. All inputs shall be compatible with standard reverse polarity supervision of circuit wiring by a Fire Alarm Control Panel FACP). The audible portion of the appliance shall have a minimum of three (3) field selectable settings for dBA levels and shall have a choice of continuous or temporal (Code 3) audible outputs. The strobe portion of the appliance shall produce a flash rate of one (1) flash per second over the Regulated Voltage Range and shall incorporate a Xenon flashtube enclosed in a rugged Lexan® lens. The Series AS shall be of low current design and shall have Zero Inrush. Where wall mount, Multi -Candela appliances are specified, the strobe intensity shall have a minimum of four (4) field selectable settings and shall be rated per UL 1971 for: 15, 30, 75 or 110 candela. The selectorswitch for selecting the candela shall be tamper resistant and not accessible from the front of the appliance. The 15/75 candela strobe shall be specified when 15 candela UL 1971 listing with 75 candela on -axis is required (e.g. ADA compliance). For ceiling mount applications, the strobe intensity shall be 15, 30, 75 or 100 candela. When synchronization is required, the appliance shall be compatible with Wheelock's SM, DSM Sync Modules or Wheelock's PS-12/24-8 Power Supply with built-in Patented Sync Protocol. The strobes shall not drift out of synchronization at any time during operation. If the sync module or Power Supply fails to operate, (i.e., contacts remain closed), the strobe shall revert to a non -synchronized flash -rate. The appliance shall also be designed so that the audible signal may be silenced while maintaining strobe activation. The Series AS Audible Strobe and Series AH Audible shall incorporate a Patented Universal Mounting Plate that shall allow mounting to a single -gang, double -gang, 4-inch square, 100mm European type backboxes, or the SHBB Surface Backbox. If required, an NATP (Notification Appliance Trimplate) shall be provided. All notification appliances shall be backward compatible. Specifications and Ordering Information Model Order Code Strobe Candela Non -Sync Sync DSM or PS-12/S-12124-8 24 VDC 12 VDC Wall Mount Ceiling Mount Mounting Options AS-24MCW-FR 9024 15130f75/110 X X X X A B,D,E,F,G,HAO,R,S,X AS-24MCW-FW 9025 15r.WU5/110 X X x X A, B,D,E,F,G,H J,O,RAX AS-241575W-FR 7405 15 (75 on Axis) X X X x A, B,D,E,F,G,H J,O,R S X AS721575W-FR 7410 15 (75 on Axis) X X X X A B,D,E,F,G,H J,O,R,S X AS-2415C-Fw 7411 15 X X X X A,B,D,E,F,G,H J,O,RAX AS-243OC-FW 7412 30 X X X X A,B,D,E,F,G,H,J,O,R.S,X AS-2475C-FW 7413 75 X X X X A B,D,E,F,G,H J,O,R,S,X AS-24100GFW 7414 100 X X X X A,B,D,E,F,G,H,J,O,R,S,X ASWP-2475W-FR" 9012 75 @ -31-F X X X X 1 (see Data Sheet S9004) AM-24-R 7892 X X X X X A,B,D,E,F,G,H,J,O,R,S,X AM-12-R 7691 X X X X X A,B,D,E,F,G,H J,O,R S,X AM-24WP-R^ 7416 X X X X X K AH-12WP-R" 7415 X X X X X K Refer to Data Sheet S7000 for Mounting Options. For Weatherproof Series AS/AH specifications see data sheet S9004. Note: Models are available in either Red or White. Contact Customer Service for Order Code and Delivery. NOTE: Due to continuous development of our products, specifications and offerings are subject to change without notice in accordance with Wheelock Inc. standard terms and conditions. WE SUPPORT AND ENCOURAGE NICET CERTIFICATION 3 YEAR WARRANTY NATIONAL SALES OFFICE 1-800-631-2148 Canada 800 397-5777 E-mail: Info@wheelockinc.com http:]/www.wheelockinc.com Made in USA D' 'b t d B WHEELOCK, INC. • 273 BRANCHPORT AVE • LONG BRANCH, N.J. 07740 • 732-222-6880 Istrl u e y. FAX: 732-222-2588 S8100 01/02 I D192C Notification Appliance Circuit Supervision Module Features Supervises 12 or 24 V DC Notification Appliance Circuits Supervised signal silencing switch Notification appliance circuit rated at 1.8 Amps Multiple module configurations Mounts in panel enclosure Description The D192C Circuit Supervision Module is an accessory module for use with Radionics Fire Alarm Control Panels (FACPs) and Control/ Communicators. The D192C supervises the wiring to remote Notification Appliances in compliance with UL 864 and NFPA 72. The D192C powers Notification Appliances either from an FACP or from an auxiliary power supply, which allows the use of 12 or 24 V DC Notification Appliances with the appropriate power supply. The D192C supervises the wiring to Notification Appliances for open circuit, short circuit, or grounded circuit faults. It responds to these conditions by causing a shorted trouble condition on the FACP supervisory zone or point. The panel then provides audible and visual warning at the command center(s). Panel programming may provide Notification Appliance supervision reports to a remote receiver. In an alarm condition the panel output voltage triggers the D192C to supply power to the Notification Appliances. The D192C module also filters and stabilizes the output voltage to the Notification Appliances in the event the battery power is interrupted. Several D192C modules can be connected to the same supervisory zone or point of the FACP or control/communicator. The D192C module has a silence switch to disconnect power to the Notification Appliances during system testing. When this toggle switch is in the Silence (OFF) position, the D192C shorts the supervisory zone or point of the panel, causing a trouble condition. Notification Appliances used with the D192C module must comply with the following: Must be polarized (DC) equipment Must match the voltage rating of the alarm power supply Must not exceed the current rating of the alarm power supply Combined device current must not exceed 1.8 Amps per D192C module Application The D192C Module provides a supervised connection point between a Notification Appliance circuit and the FACP. It supervises the Notification Appliance circuit for open, short, and ground condition, any of which the FACP will report as a trouble condition. In an alarm situation, the FACP signals the D192C to power the Notification Appliance circuit, either from the FACP battery or from an auxiliary power supply. 1997 Radionics All rights reserved 75-07081-000-C 09/97 Radionics- "'The Radionics logo is a registered trademark of Radionics, D192C Specifications 1800 Abbott Street, Salinas, CA 93901, USA L522A Page 1 of 2 Installation The D192C mounts inside the FACP enclosure. Depending on the configuration of the panel, it may attach using existing mounting holes or with a D137 or D138 mounting bracket. Using a Class B, Style W, 2-wire circuit, wire the D192C to the FACP according to the Installation Instructions supplied with the module. The D192C requires the following: 12 V DC auxiliary power Supervisory zone or point input Alarm power input of 12 or 24 V DC Panel common For UL applications, a listed (UTRZ) regulated power supply may be used to power Notification Appliances through the D192C To comply with NFPA standards: The FACP and the power supply must be supervised or installed in the same room not more than 20 feet from the D192C as specified by NFPA Wiring between the FACP and the power supply must be in conduit Power supply fault conditions must be supervised by a UL-listed relay. Install according to the Radionics Installation Instructions. Test and maintain equipment according to the Instruction manual, NFPA 72, Local Codes, and the Authority Having Jurisdiction. Failure to follow these instructions may result in a failure to initiate an alarm condition. Radionics is not responsible for improperly installed, tested, or maintained products. Listings and Approvals Underwriters Laboratories CSFM FM NYC-MEA Specifications D192C Operating Voltage 12 V DC supplied by FACP Auxiliary Power and/or external power supplv Alarm Output Voltage 12 V DC supplied by FACP alarm power supply, 12 or 24 V DC supplied by external power supply Module is rated at 1.8 A @ 12 or 24 V DC Idle Current 20 mA Alarm Current 10 mA Maximum Rating 1.8 A Dimensions Width 3" Height 5" Depth 1 -1 /2" Ordering Information Model Description D192C Notification Appliance Circuit Supervision Module D9142F 24 V DC Auxiliary Power Supply D137 Mounting Bracket D138 Mounting Bracket (for D9124) ISO 9002 uN Certification No. 3946 01997 Radionics All rights reserved 75-0708 1 -000-C 08/97RadionicsTA°The Radionics logo is a registered trademark of Radionics, D192C Specifications 1800 Abbott Street, Salinas, CA 93901, USA L522A Paget oft D8130 Release Module Specifications Features Two Form C, 5 Amp rated contacts Supervised disable switch for system testing Easy to install Remote control of fire system devices Instant or delayed relay activation and restoral Compatible with D8112, D8112E & G Series, D9112, D911261, D7212, D7212131, D7412, and D9412 control/ communicators Relay closure follows indicating circuit duration Description The D8130 Release Module is an accessory for Radionics Fire Alarm Control/Communicators. The D8130 is suitable for release applications commonly found in NFPA 72 Local Fire Alarm Installations. Two independent Form C dry contacts, each rated at 5 Amps, connect low voltage circuits to magnetic door holders, pilot relays, orcontractor units, for release function control. Contact activation on alarm is jumper selectable to be either instant or delayed by ten seconds. If the delay option is selected, a ten second delay also occurs upon restoral. The control/communicator indicating output activates the contacts of the D8130. A red "ALARM INPUT' LED is provided on the D8130 module to indicate contact activation. The duration of the contact activation follows the programmed indicating circuit time. If the user silences the alarm output, the D8130 contacts are deactivated. Latching features must be provided for pilot relays or contractor units requiring release control beyond the programmed indicating device time or after manual silencing of the indicating circuits. Disable Switch To facilitate fire alarm installation testing, the D8130 Module contains a supervised disable switch that prevents release operation. An amber "DISABLE" LED is provided on the D8130 to indicate when the switch is in the DISABLE position. The D8130 is connected to any unused protective zone or point of the control/communicator to supervise module disabling. A trouble is indicated on the control/communicator when the D8130 switch is in the DISABLE position, and a restoral is sent when the switch is returned to the NORMAL position. When the contacts are activated with the switch in the NORMAL position, no trouble indications are sent to the control/communicator. RECEIVE) JAN 13 03 N Radionics-' D8130 Release Module Release Contact Outputs A normally open (NO) terminal, a normally closed (NC) terminal, and a common (COM) terminal are provided for each D8130 release contact. Silk screened markings on the edge of the circuit board clearly identify each terminal. In the inactive state of the contact, the NC terminal has continuity with the COM terminal. In the active state of the contact, the NO terminal has continuity with the COM terminal. Application The D8130 Release Module is used as a control/ communicator accessory to provide system control functions commonly required in NFPA 72 fire alarm installations. Typical applications are releasing fire doors, emergency exit doors, stairwell doors, elevator recall, smoke exhaust functions, and HVAC control. Installation The D8130 Release Module mounts in the control/ communicator enclosure or in a separate approved enclosure. Up to four modules can be installed using the mounting locations provided. A D138 Mounting Bracket is required to mount the D8130 in the D9124. Install, test and maintain this device according to the Installation Guide, NFPA 72, Local Codes and the Authority Having Jurisdiction. Failure to follow these procedures may result in failure of the device to operate properly. Radionics is not responsible for devices that are improperly installed, tested and maintained. Wiring to Control/Communicator Four wires from the D8130 module common (1 COM), alternate alarm output (2 ALT ALRM), +12 VDC (3 AUX PWR), and protective point (4 SWITCH SUPERVISION POINT) terminals connect to the control/communicator. These wires connect to the terminal block on the D8130. Specifications D8130'Specifications Operating Nominal 12 VDC supplied by the control/communicator Voltage 16 to 22 AVVG between D8130 and control/communicator Operating Idle: 7 mA Current Contacts disabled: 17 mA Alarm: 60 mA Wring Use standard voltage drop calculations to determine correct contact wire size Relay Dry form C contacts: Rating 5.0 Amp rating at 30 VDC 5.0 Amp rating at 40 VAC Dimensions 5 In. x 3 in. x .75 in. (12.7 cm x 7.6 cm x1.9 cm) HxVVx0) Listings and Approvals UL listed NYC-MEA approved CSFM listing: approved Ordering Information Model Description D8130 Release Module D137 Accessory Mounting Bracket D138 Accessory Mounting Bracket D8130 Te Mn Is 1® NO 0 COM Release ® NC Control Connections 7 NO COM Control/Communicator QS NCInputs 11,13,14,16,17,19,20, or22 li Switch O(connect to positive side ® Supervision of supervision loop) Zone 0 O3 AUX PWR O7 O ALT ALRM 12,15,18, or21 connect to panel common) o O1 COM Radionics model D105F end -of -line resistorT-1equired if no D192C module attached Additional D8130 Modules D192C Module 0 Zonervision11O - - - 1D ® O3 COM Control/ Communicator Earth Ground D8130 Wiring Connections ISO 9r702 0 CERTIFICATE NO. A6137 2001 Radionics, a division of Detection Systems, Inc. P/N: 75-06348-000-C 03/01 The Radionics logo is a registered trademark of Radionics, Specification Sheet D8130 PO Box 80012, Salinas, CA 93912-0012 USA Page 2 of 2 Customer Service: (800) 538-5807 Radionics"' Features D8125 and D9127 Addressable Expansion Modules Specification Sheet Provides point identification of initiating devices Supervises wiring to devices for circuit integrity Compatible with D7212, D7412, D8112, D9112, D9412,and D9124 Control/Communicators Expands the number of points of protection in the system Compact size Terminal connections for reliabiRbiili-t c Multiplex technology EVG Low installation costs JAN t ff3 Description The D8125 and D9127U/T expansion modules are a proven multiplex technology combining zone/point supervision with individual device addressing on one pair of wires. The control/communicators use the D8125 to provide for expansion beyond the standard number of zones up to a total of 240 points of protection. Each D8125 module can fully supervise 120 D9127U/T Untampered andTampered) POPITs(Pointof Protection Input Transponders). The D9127 is a compact, addressable device. Future system expansion is very economical as they can be spliced in anywhere along the two wire data expansion loop from the D8125 module. Four screw terminals provide reliable connections for the data expansion loop and supervised sensor loop wiring. Application The D8125 and D9127U/T Modules are used when there is a need to expand the appropriate control/communicators beyond their standard number of on -board initiating zones or points. Listings and Approvals UL listed NYC- MEA approved CSFM listing no. for D8125 and D9127: 7167- 801:104 (household) 7165- 801:102 (non-highrise) Installation The D7212 and D7412 control/communicator uses one D8125 expansion module to provide a maximum of 40 additional points of protection. Up to two model D8125 expansion modules can be used with the D8112, D8124, D9112, D9412, and D9124 control/ communicators. The D9124 Control/ Communicator basic system comes with an integral D8125 module and can accept one additional module. Each D8125 installs in the control panel enclosure or in an adjacent approved enclosure. You can supervise up to 120 D9127 PORTS with each D8125 module. The D9127U/T POPIT modules are suitable for applications where specifications call for point identification from each initiating device or series of devices. The units are small, and easily installed in standard outlet boxes, above false ceilings, closets, or other accessible locations. CONTROL COMMUNICATOR ZONE EXPANSION LOOP D9127U/ T PORT MODULE TO ZONEX MODULE MODULE33 k END - OF -LINE I COP RESISTOR POPIT SENSOR MONITORS NORMALLY OPEN AND/ OR NORMALLY CLOSED DETECTION DEVICES) T 75- 07506-000-B 3/96 1995-1996 Radionics Ordering Information Model I Description D8125 D7212, D8112, D9112, D9412, D9124 Expansion Module D9127U/T Point of Protection Transponder Electrical Specifications Operating Nominal12 VDC supplied by Voltage control/communicator Operating 50 mA per D8125 module plus Current 0.5 mA per D9127U/T module Operational Data Each D8125 expansion module monitors the D9127 POPITs over a two -conductor supervised data expansion loop. Off - normal sensor loops (open orshorted), missing, and extra POPITs are quickly identified by device address and the information relayed to the control/communicator. Each D9127 provides one supervised point of protection. Normally open and/or normally closed contacts may be connected on the same sensor loop. A 33kQ EOL resistor is provided to be installed at the furthest point on the loop for proper supervision. wiring intormation D . D$127 SEWOR LOOP 22K O ENO-OFLNE RESISTOR Q . D9127 SWITCH BLOCK POPEXMODULESI 1 NIP Off HISHI TERMINAL 1• 08127URCONNECTORS 1.) Vt.,.- Diu ZONE EXPANSION LOOP AUK POWER POPEI( CND MODULEP2 HFI DS127U 2.= qq IIII .. die eildldldldldldldl ldll ZONE UPANWON LOOP MASTERZONES ZONES SION Specifications The contractor shall furnish and install the D9127 PORT expansion modules as indicated on the plans. Each POPIT shall provide a supervised sensor loop for initiating devices and identify the device status in off -normal conditions. Each POPIT shall be assigned a device address as indicated on the plans and annunciate at the specified locations. The POPITs shall connect to a 2-wire data expansion loop from a D8125 installed in the control/ communicator enclosure. The D8125 module shall be used for D9124, D9112, D9412 or D8112 control/communicators and provide supervision for up to 63 or 120 D9127 POPITs on each of up to two modules. The D8125 module shall be used for D7212 control/ communicators and provide supervision for up to 40 D9127 POPITs, Specified Radionics control/communicators shall be capable of providing device point identification to a remote Radionics D6500 receiver using the Modem II reporting format. All wiring shall be in accordance with the manufacturer' s instructions and follow all applicable codes. Dimensions D8125/ D8125X: 5" L x 3" W x 3/4" D D91271J/ T: 3 3/16" L x 1 112" W x 7/8" D FaM1191 iW 09127U? DOW= O D9127U DD127U D9127U 1111WI " 111 2M T" 1 The Radionics logo is a registered trademark of Radionics, Salinas, CA, U.S.A. 1995- 1996 Radionics, Salinas, CA, U.S.A. All rights reserved. Radionics" Radionics, 1800 Abbott Street, Salinas, CA, 93901 U.S.A. D1256/D1257 Fire Command Center/Fire Annunciator Specifications Features Compatible with the D9124, D9112, D9412, D7212 and D7412 Attractive low profile fire annunciators D1256 provides system control with easy to use function keys D1257 can be remotely installed in public access areas Built-in multi -tone sounder Easy to read vacuum fluorescent display Displays complete system status in English format Programmable custom text for each point Local system test display Molded red ABS plastic construction Description Radionics' D1256 Fire Command Center and D1257 Fire Alarm Annunciator are four -wire serial devices used with the Radionics' D9124 Addressable 24 VDC Fire Alarm Control/ Communicator and the D9112, D9412, D7212 and D7412 ControVCommunicators. One D1256 is included with the D9124 panel, which can be accessed through the slide door on the front of the enclosure. Both annunciators provide English text displays of system events with highly visible blue vacuum fluorescent displays. A built-in sounder alerts building personnel to system alarms and troubles and guides responding agencies to the annunciator location. Both units are molded in durable red plastic and have low profile enclosures. The wording "Fire Alarm Annunciator" is clearly printed on the faceplate of the D1257. This allows inspectors, service technicians and responding fire agencies to identify the annunciator. The D1256 Fire Command Center is a full -function system controller and annunciator. Four special one -touch function keys provide user-friendly control over the system. The function keys allow the user to silence the audible alarm output, silence the trouble sounder, reset the annunciator display and reset system detectors. Four additional navigational keys allow access to other programmed system functions. The D1257 Fire Alarm Annunciator provides remote annunciation capabilities without system control. Similar in appearance to a D1256 Fire Command Center, yet the D1257 Fire Alarm Annunciator lacks function keys. This makes system control functions inaccessible to unauthorized persons. Thus, the D1257 can be placed in locations where the public may have access to it. Two navigational keys allow the user to step forward or backward through a list of system events. Radianicso Fire Command Center and Fire Annunciator Application The D1256 can be mounted in secure areas for use as both a system controller and annunciator. The D1257 Remote Fire Annunciator is typically installed in building entrances and areas with unrestricted access. Near exterior doors in hotel or business lobbies are ideal locations. This allows a responding agency, or persons evacuating the building to quickly identify the type and location of the emergency from outside the building without being in danger. Both devices have a built-in sounder that allows them to be installed in locations not in general view. Audible tones alert personnel to fire system events and assist fire fighters in locating the annunciator. Installation The D1256 and D1257 system annunciators connect to the fire control/communicator through standard four -wire cable. Shielded cable may sometimes be required where excessive EMI is a problem. The field wiring connects to a four -wire harness supplied with the unit. This harness plugs into a four -pin connector on the circuit board through the back of the D1256 or D1257. Each unit has three mounting holes in the base that allow secure, correct positioning during installation. Do not install the D1256 or D1257 in direct sunlight. This damages the module components and makes the display less visible. Install, test and maintain these devices according to their Installation Guides, NFPA 72, Local Codes and the Authority Having Jurisdiction. Failure to follow these procedures may result in failure of the devices to operate properly. Radionics is not responsible for devices that are improperly installed, tested and maintained. JAN t Operational Data The D1256 and D1257 operate through the Serial Device Interface buss of the control/communicators. The D1256 and D1257 receive serial data and power through a four -wire cable. Both devices continually show the status of the fire alarm system. Changes in the normal panel condition such as alarm or trouble events are displayed in alphanumeric English text and the appropriate sounder response tone emitted. Resetting the display and sounder can only be accomplished at the D1256 Fire Command Center by authorized persons. Specifications D1256ID1257 Specifications Operating voltage Nominal 12 VDC supplied by control/communicator) Operating Current 104 mA min.; 206 mA max. Wiring Four conductors supply: Serial data, 12 VDC and panel common Display 16-character vacuum fluorescent Operating Temperature 32°F to 122°F (0°C to +50°C) Non -condensing Relative Humidity 5 % to 85°/ at 86°F (30°C) Base Dimensions (L x W x D) 8.3 in. x 4.5 in. 0.8 in. 21 cm x 11.4 cm x 2 cm) Wire Information Four -Conductor from Panel D1256 or D1257 Wiring Harness 12 VDC 12 VDC (Red) Data -Out Data -In (Yellow) Data -In Data -put (Green) Common Common (Black) 2001 Radionics, a division of Detection Systems, Inc. O The Radionics logo is a registered trademark of Radionics, PO Box 80012, Salinas, CA 93912-0012 USA Customer Service: (800) 538-5807 Listings and Approvals UL Listed CSFM Listed FM Approved Ordering Information Model Number Description D1256 Fire Command Center D1257 Remote Fire Alarm Annunciator D546 Brass Faceplate D54C Stainless Steel Faceplate D55 Desk Stand D56 Conduit Backbox Specifications The contractor shall furnish and install, where indicated on the plans, Radionics D1256 Fire Command Center and D1257 Remote Fire Alarm Annunciator. Each device shall have a 16 character vacuum fluorescent display and show all fire system events. Alarms shall be prioritized ahead of other system events and displayed in sequence. The D1257 shall have no on board system control function keys. A built-in sounder shall indicate events with distinct tones for fire alarm and system trouble. The D1256 and D1257 shall connect to the fire control/communicator through a four -wire cable. The D1256 and 1257 shall be constructed of high impact red plastic. The D1257 shall have the text "Fire Alarm Annunciator" clearly printed in bold letters to the right of the event display. The D9124, with the D9112LTB, D9112131 and D7212B1, have a 500 event non-volatile event memory log. The D9124 with the D9112LTB-EX or D9412GLTB, 9000/7000 Series panels have a 1000 event non-volatile memory log. All system events are displayed on system annunciators, printed locally or retrieved from off premises via the Remote Account Manager RAM) software package. IS0 9002 0 CERTIFICATE NQ A5117 75-06926-000-B 01/01 Specifications D1256/D 1257 L643 Page 2 of 2 D8132 Battery Charger Module Specifications Features Provides additional standby Amp hours for control/communicators 1200mA battery recharging circuit Suitable for 12 VDC, 7 and 18 Amp -hour batteries Suitable as a stand alone 12 VDC, 1 Amp power supply Description The D8132 Battery Charger Module is an accessory device for Radionics D6112, D7112, D8112, D8124, and 9000 Series control/communicator panels. The D8132 uses a 16.5 VAC, 40 VA plug-in transformer to supply 1200mA of battery charging current. An on- board, green LED remains lit to indicate the presence of AC voltage. The D8132 can be used to increase the standby battery time of a panel when installed with external batteries in an adjacent approved enclosure. The D8132 is not to be used as the sole means of standby power for a panel. One or two 12 VDC, 7 Amp -hour batteries must still be provided for the panel. The D8132 can also be used as a stand-alone power supply in non-UL applications. You can connect one or two 12 VDC, 7 Amp -hour batteries or one or two 12 VDC, 18 Amp -hour batteries to the D8132 in either application. In addition to providing increased standby time and auxiliary power, batteries connected to the D8132 also filter the AC power supply. The amount of ripple that appears on the panel outputs is dependent on the charge state of the batteries. Radionics does not recommend using the D8132 to power devices that are sensitive to excessive ripple. Application The D8132 Battery Charger Module is suitable for systems requiring extended battery standby time. The D8132 is UL listed for use in Central Station. Household and Local Fire and Burglary Alarm applications, Police Connected, Remote Station, and Electrically Actuated Transmitter applications. The D8132 is not UL listed for use with the D6112. Provided with the D8132 are two cables, and two sets of lockwashers, nuts, screws, and terminal lugs. The cables connect the D8132 to the D1640 transformer, one or two batteries, and the control/communicator. Additional hardware is provided for connecting the battery cable to 12 VDC 18 Amp -hour batteries. This Radionics° hardware is not required when connecting 12 VDC, 7 Amp -hour batteries. Installation The D8132 Battery Charger Module and additional batteries are typically mounted inside a separate approved enclosure such as the Radionics D8103, D8108A, or D8109. The enclosure is installed adjacent to the control/communicator enclosure. The plug-in AC transformer is installed on the same AC branch circuit as the control/communicator transformer. No other devices may be connected to the transformer. A 4-wire harness is used to connect one or two batteries to the D8132. An additional 4-wire harness connects to the AC transformer (2 wires) and the battery terminals of the control/communicator. The D8132 installs in the enclosure using three plated screws supplied with the unit. Radionics enclosures provide module mounting locations with knockouts. Use a Radionics D137 Mounting Bracket when installing the D8132 in a non-Radionics enclosure. The D8132 should be mounted towards the top of the enclosure away from the batteries to avoid overheating. The Radionics D8103, D8108A, and D8109 enclosures provide a rectangular knockout on the door that allows the green AC power LED on the D8132 to be easily viewed. A ED Operational Data When using the D8132 to increase your control/communicator panel standby battery Amp hours, refer to the appropriate calculation chart contained in the D8132 Operation and Installation Manual 74-04777-000). These charts detail the Amp -hour requirements, control/communicator Auxiliary current load, and the D8132 battery recharge time. The D8132 can also be used as a stand-alone, 12 VDC 1 Amp power supply. For stand-alone applications the D8132 does not provide battery supervision or load shed capability and is not recommended for critical loads. The D8132 is not UL listed for stand-alone applications. A form of battery supervision can be provided to a D8132 in stand-alone configurations when connected to the same AC branch circuit as the panel. AC power failures and restorals, which would also affect the D8132 module, can be reported by the panel to a remote receiver. This supervision relies on the assumption that AC power to both devices has been affected. The Amp -hour rating of batteries on the D8132 should be greater than batteries connected to the panel. This ensures that devices connected to the D8132 are powered at least as long as those on the control/communicator. The stand-alone D8132 and the panel must share a common ground. Specifications Operating Voltage 16-18 VAC supplied by plug-in transformer Operating Current 1200mA of rectified AC Float Voltage 13.9 VDC maximum current Length 5.0" Width 3.0" Depth 75" The contractor shall furnish and install Radionics model D8132 Battery Charger Module where indicated on the plans. The D8132 shall provide increased standby Amp -hours for the specified Radionics control/communicator panel. The module shall be equipped with a 16.5 VAC, 40 VA plug-in transformer, two sets of connecting cables and all hardware required for proper installation. The D8132 shall have an on- board, green LED for indicating the presence of AC power. The D8132 shall be capable of supplying recharging current for one or two 12 VDC, 7 Amp -hour or 18 Amp - hour batteries. The module shall be mounted in the recommended Radionics enclosure or other approved enclosure. Installation shall be subject to the requirements of the authority having jurisdiction. Listings and Approvals UL Listed CSFM and NYC -BSA approved Ordering information Model Description D126 12 VDC 7.0 Amp -hour Battery D137 Mounting Bracket D1218 12 VDC 18 Amp -hour Battery D8132 Battery Charger Module ISO 9002 UL CERTIFICATE NO. A5137 2000 Radionics, a division of Detection Systems, Inc. 75-06430-000-B 02/00 The Radionics logo is a registered trademark of Radionics, Specifications D8132 PO Box 80012, Salinas, CA 93912-0012, USA L515 Page 2 of 2 D9412G/D7412G Specifications Control Features Eight programmable areas, each with perimeter/interior partitioning. Regular, master, associate, or shared option by area Real-time clock and test timer Up to 1000-event log, including time, date and event with area, point and user number Battery charging circuit; AC power, voltage and ground fault supervision Automatic reset circuit protectors On -board CPU watchdog warning buzzer and diagnostic LEDs Lightning and EMI protection Power limited external circuits Communicator Built-in digital communicator with phone line monitor (loop or ground start) Multiple telephone numbers, primary and duplicate paths with main and alternate destinations All reports within each 4 route groups are programmable Optional dual phone line switcher monitors 2 phone lines Automatic test and status reports Time windows for arming and open/close report suppression Programmable answering machine work -around for remote programming on shared phone line Programmable Outputs 2-amp alarm power @ 12 VDC 1.4-amp aux power @ 12 VDC 4 alarm output patterns Automatic bell test Programmable bell shut-off timer D7412G: 67 programmable outputs D9412G: 131 programmable outputs System Response D7412G: 75 points, 8 on -board, up to 67 off -board D9412G: 246 points, 8 on -board, up to 238 off - board 31 custom point indexes, including fire supervisory Selectable point response time Fire alarm verification Fire inspector's local test Watch mode Scheduled events (Skeds) arm, disarm, bypass and unbypass points, control relays, control authority levels, control door access and more tiradionics Control/Commu n icators User Interface Supervises up to 8 command centers (up to 32 non -supervised command centers can be used) Custom command center text D7412G: 4 custom functions D9412G: 16 custom functions Full function command menu including custom functions D7412G: 99 Users D9412G: 249 Users Each user has authority by area and 16-character name 14 custom authority levels control user's authority to change, add, delete passcodes or access control tokens/cards, disarm, bypass points, initiate system tests, and more Adjustable brightness/loudness for command center display/ sounder D7412G: 1 parallel printer D9412G: 3 parallel printers Access Control D7412G: 2 access control doors and 396 tokens/cards D9412G: 8 access control doors and 996 tokens/cards Custom door strike, point shunt and auto disarming response by area Logging options for: Access Granted, No Entry, Request to Exit and Request to Enter 14-panel wide access levels with both manual and scheduled control A member of the J 1 Zn03 Bosch Group D9412G/D7412G System Description D9412G/D7412G Control/Communicators provide an integrated solution to Access Control, Security, and Fire Alarm System applications. Control/Communicators are capable of monitoring alarm points for intruder or fire alarms while operating user command centers, (access readers, door locks - D7412G/ D9412G), and other outputs. Includes a built- in digital communicator, which reports events to selected destinations via 4 programmable route groups. Programming and accessory modules offer flexibility and beneficial features rarely found in other security control systems. Area Configurations D9412G/D7412G area programming offers you a wide selection of different system configurations. Each area is assigned an account number to define annunciation, control, and reporting functions. Multiple areas can be linked to a shared area which is automatically controlled hallway or lobby). Area arming can be conditional on other areas (master/associate). User Interface D9412G/D7412G command centers provide on - premises point and system status annunciation. A fully selectable user interface can customize command center displays and simplify operation by creating menu items and functions, appropriate only to that command center. Function Lists can help a user become familiar with the operation of the control panel. Custom functions allow users to perform complex functions with a few keystrokes. Each may be programmed and identified by 16 characters of custom text and contain up to 32 keystrokes. D1255 Command Center, D1256 Fire Alarm Command Center and D1257 Fire Alarm Annunciator use a 16- character English language display to show system status, area status (custom text), and point status custom text). D720 8-point LED area command center provides command functions and annunciation for up to 8 points in a single area. Any combination of these command centers may be used within the same area. Easy to remember commands like Command 1, Command 2, and Command 8 make an easy transition for seasoned Radionics users. User Passcodes D9412GID7412G can accommodate: Each user may have a 16-character customized name that may be viewed, printed, reported to a central station in Radionics' Modem Illa2 Communications format or retrieved with Remote Account Manager (RAM). Security and Fire Detection D9412G/D7412G provide eight "on -board" detection points, and up to 238 additional off -board points depending on Model. and expansion interfaces). Points may be individually programmed and used to monitor all types of burglar alarm, fire alarm, and supervision devices. Communications D9412G/D7412G have four route groups, sort reports by priority and are capable of transmitting reports to up to four locations. Each group has a programmable primary and backup destination. Compatible with D6600 NetCom Communications System using a D9133TTL-E Ethernet Interface Module. Radionics' Modem Illa2 Communications Format, available with Radionics' receiver, adds these reporting capabilities. To name just a few: Individual point numbers and text Opening/Closing reports by area number Remote programming attempts Diagnostic reports Access control events with user name Event Log Storage, Viewing and Printing D9412G/D7412G event log automatically stores up to 1000 events. All local and transmitted events are stored some access events are selectable). Event log includes time, date and event, with area, point and user number. Users may view event log from Alpha Command Centers. Events may be retrieved remotely using RAM. Events are printed as they are stored in event log. D9131A Parallel Printer Interfaces can be installed to record events locally on one, two, or three printers depending on model). Each can print opening and closing, access, alarm, Skeds, or any combination of events. Each can print information from any combination of areas. Each can supervise various printer status conditions. Event log and local printer are ideally suited for customers who like to have a record of openings and closings without having extra communications costs. Logger and RAM, can suppress reports and then retrieve events periodically using one phone call, rather than receiving several calls each day. D7412G: 99 user passcodes When the panel's event log reaches its programmed D9412G: 249 user passcodes. threshold of stored events, it can send a report to a Each passcode individually programs with 3 to 6 receiver to remind central station to retrieve events from digits in length and no fixed digits). the panel's event log with RAM. Each user is assigned one of 14 customized authority levels in each area. You may restrict passcodes to operate only during certain times. D9412GID7412G Specifications -- --- - 02001 Radionics Page 2 47487B Scheduled Events (Skeds) D9412G/D7412G internal clock and calendar help the panel operate individual scheduled events (Skeds). Skeds perform a specific function (such as arm/disarm, relay control, point bypassing, etc.). Each Sked is programmed for a time and day -of -week schedule or a date -of -year schedule. Users may change Sked Time if programmed for local time editing. Holiday schedules can enable or disable individual Skeds during holiday periods. 64 scheduled events with up to 26 different functions Day -of -week or date -of -year schedules Four holiday schedules of 366 days each (leap year) Fire Test D9412G/D7412G Fire Test Mode suppresses reports to the central station receiver so you can test initiating and indicating devices without transmitting alarms. Initiating Fire Test Mode, sends "Fire Walk Start" to central station indicating start of test. Test events become "local only." Command center shows how many points are to be tested. Each time a device initiates an alarm, programmed point text displays at command center and the fire bell rings for 2 seconds. Automatic sensor reset feature allows continued testing of devices without time consuming trips to manually reset sensors. At the end of test, command center displays the number of untested points. You can also view point text for each untested point. Ending Fire Test Mode, sends "Fire Walk End" to the central station receiver indicating end of test. Combining Access Control with Security and Fire Detection (D7412G/D9412G) D9412G/D7412G combined systems can help prevent false alarms making it easy to use one system that controls access, security, and fire functions. Access control features of D7412G/D9412G can deny access during armed periods, grant access only to certain authorized users depending whether an area is master armed, perimeter armed or disarmed. Alarm system can automatically disarm when designated authorized users are granted access. D7412G: Two (2) access doors; 75 detection points; 396 Token/Users D9412G: Eight (8) access doors; 246 detection points; 996 Token/Users D9412G/D7412G D9210B Access Control Interface Module Access is granted from Wiegand format readers or Request to Enter/Exit devices when connected to the D9210B. Also provided are connections for door point, strike, buzzer and enclosure tamper. (One D9210B required per door). Each access door can be configured independently Door point controls access door and is part of alarm system (door does not need double contacts) Door contact can reset strike time when opened Door contact can terminate entry buzzer (if used) Door contact is shunted when valid access is granted Optional buzzer can trigger prior to end of door shunt period, warning user a "door left open" condition is about to occur Door point can be configured to generate alarm or trouble (or have no response) when door is left open beyond shunt period In addition to granting access, cards control whether system will disarm along with granting access Door strike can release automatically during disarmed periods, then automatically re -lock when area is armed Door can generate an alarm, trouble, (or have no response) depending on area's armed condition when door is opened outside authorized access period REQUEST TO ENTER and REQUEST TO EXIT can be programmed to shunt door without activating strike An option determines whether access granted, no entry, request to enter, or request to exit messages are sent to event log RAM IV and RAM IV Lite These account management and panel -programmingutilitiesallowcomputersequippedwiththeMicrosoft Windows® operating system and a modem to act as a remote programming, record storage, remote control and troubleshooting tool for the D9412G/D7412G Control/Communicators. To enhance the down/upload capabilities RAM can be used in a TCP/IP and Dynamic Host Communication Protocol (DHCP) configuration. D9412GID7412G Specifications — — — 47487B Page 3 0 2001 Radionics D9412G/D7412G Specifications General Contractor shall furnish and install, where indicated on plans, a Radionics D9412GID7412G Control/Communicator. Panel shall be listed by Underwriters Laboratories for NFPA 72 Applications. D9412G/D7412G shall support initiating and indicating modules and Radionics Command Centers. Power supply shall provide 1.4-amp @12 VDC for all processing functions and auxiliary requirements. Software D9412G/D7412G programming of all system functions shall be accomplished on site using Radionics' Hand- held D5200 Programmer or remotely using a RAM software package. A programmable system passcode shall be used to prevent unauthorized remote programming. Panel shall accommodate up to four separate telephone numbers for primary, alternate and backup receivers, automatic test reports, selective relay activation, and custom text on associated command centers and annunciators. When resetting alarms, arming or disarming a combination fire/burglary and/or access control system, the user shall be identified by name and number. D72121D7412G: Up to 99 users D91121D9412G: Up to 249 users Panel's internal clock shall support Skeds (scheduled events) feature. User shall have option to alter Sked activation times using a programmable passcode. Up to 64 programmable, scheduled event functions shall be available for controlling relays, enabling passcodes, windows, and supporting service alert feature. Other programmable functions shall include fire alarm reset commands, and day/date/time adjustments. Event Logger/Clock D9412G/D7412G event log shall store up to 1000 events. All system events shall include time, date and event with area, point and user number. Access events (optional) stored shall include: Access granted, No Entry, Request To Enter, and Request To Exit. Logger records certain functions entered at command centers. Stored events in Logger shall be retrievable with a RAM software package. Remote Diagnostics and Controls D9412G/D7412G shall be able to be remote controlled through use of RAM software. Features shall include: reset of audible signals, activation/deactivation of D8129 relays, interrogation of battery, point and armed status, enabling or disabling reporting functions, and shunting of reporting points during servicing. Command Centers be equipped with a 16-character alphanumeric display, distinct fire and burglary tones, and backlighted multi - key touchpad. D1255, D1256, and D1257 shall have the ability to display for each detection point: alarm, trouble, supervisory, or faulted, and custom text. In addition, expanded, addressable point displays shall include missing and extra point information. System -wide displays shall include: local system test, sensor reset, fire test mode, and user programming prompts. Fire Test D9412GID7412G Fire Test Mode shall support single - person operation. All reports to central station shall be suppressed while fire test is being conducted. Fire Test Mode shall be activated by entering a user passcode at a command center. All testing data shall be visible on command center and annunciator displays during testing. Hardware D9412G/D7412G shall provide up to 246 individually identified addresses, (75 with D7412G). Each shall accommodate normally open and/or normally closed devices with end -of -line resistor supervision. Each point shall be programmable for fire, fire supervisory or burglary applications. Point output shall be silent or audible. Audible output shall be steady, pulsed, CA standard, or temporal code 3. External Hardware D9412GID7412G shall allow use of up to three on -site parallel printers (one with D7412G), using Radionics D9131A Printer Interface Modules. Events shall print time, date, and event description with area, account, point, and user number, including text for points and users. Installation, Warranty, and Training D9412G/D7412G System Installation, wiring of initiating devices and signaling circuits, shall be the responsibility of installing company. Warranty on all components shall be two years, subject to manufacturer's limitations. Training on complete system operation shall be furnished by installing company upon completion of installation. D9412G/D7412G command centers shall be Radionics D1255 Command Center, D1256 Fire Alarm Command Center and D1257 Fire Alarm Annunciator. Each shall D9412GID7412G Specifications -- 2001 Radionics Page 4 47487B Accessories/Ordering Information Model 'Description' Command Centers, Keypads and,Accessories: D1255 Command Center D1256 I Fire Alarm Command Center D1257 Fire Alarm Annunciator D720 t 8 Point LED Area Command Center D268 Independent Point Control Module D269 Independent Point Control Keypad i 0279 Independent Point Control i D54B i Command Center Flush Mount Kit, Brass IFD54C Command Center Flush Mount Kit, Stainless D55 I Command Center Desk Stand I D56 Command Center Surface Mnt. Conduit Box Zone Expansion and Interface'.Modules: _ D8125 i POPEX Module D9127U/T POPIT Module, U=No Tamper/ T= Tamper D8128C OctoPOPIT Module D940 Super Loop Module D8129 OctoRelay Module D127 Reversing Relay D136 Plug-in Relay D8121A Derived Channel S.T.U. Non UL I D8122 Derived Channel S.T.U. UL Listed D9131A i Parallel Printer Interface Module 1 D9210B Access Control Interface Module Detection -Devices with.Built-In:POPI_T: ZX835 PIR/Microwave Detector, 35 x 35 ft. 10.7 x 10.7 m) PIR/Microwave Detector, 60 x 60 ft. X970F 18.3 x 18.3 m) ZX935Z-- PIR Detector, 35 35 10xft. (10.7-x 7 m) - ZX776Z T PIR Detector, 50 x 50 ft. (15 x 15 m) ZX794 PIR Detector, 90 x 90 ft. (27 x 27 m) I PIR Detector, Ceiling Mount, 360' x 60 ft. ZX938Z 18 m) r6278S I Smoke Detector Base 12 VDC Smoke Detector Base, Master, 24 VDCD298M D298S Smoke Detector Base, 24 VDC D9412G/D7412G r- Model ' Description Fire Alarm Modules and Accessories: _ T 0125B Dual Class B Powered Loop Interface Module D129 Dual Class A Initiation Circuit Module D130 Auxiliary Relay Module, 12/24 VDC — D184 Auxiliary Local Energy Interface Kit D185 Reverse Polarity Interface Module D192C D192D N.A.C. Module, Class B, 12124 VDC, 1.8-amp N.A.C. Module, Class A/B, 12/24 VDC, 3-amp Dual Phone Line SwitcherD928 D8130 Release Module Rower. Supplies, Transformers,. Batteries & Accessories: D9142F Auxiliary Power Supply, 24 VDC, 4-amp D8132 Battery Charger Module, 12 VDC — D1640 16.5 VAC 40 VA Transformer D113 Battery Lead Supervision Module D122/L Dual Battery Harness/Long Leads D126 Battery, 12 V. 7.5 Ah D1218 IBattery, 12 V, 17.2 Ah Enclosures,:'Brackets,.artda.Phone Cords: D8103 Universal Enclosure Fire Enclosure— D8109 D8108A Attack Resistant Enclosure D8004 Transformer Enclosure —_ D137 Module Mounting Bracket — D101 Lock and Key for D8103 D161/162 Dual Mod. Telephone Phone Cord, 7 ft. 2.1 m) / 2 ft. (61 cm) Programmin.g Products: — D5200 D5500- Hand-held Programmer — — Remote Account Manager, RAM IV 65500- LTE RAM IV Lite represents the version number of the software. Order Processing has the latest revision information. 47487 B D9412GID7412G Specifications Page 5 2001 Radionics D9412G/D7412G Listings and Approvals Fire UL: Central Station, Local, Auxiliary, Remote Station, and Household Fire Warning. CSFM: Approved for highrise and non-highrise. Burglary UL: Central Station, Local, Police Connect, Bank Safe and Vault, Mercantile Safe and Vault, and Grade A Household DOD: Approved for installations in Sensitive Compartmented Information Facilities (SCIF). Access UL: Access Control Systems. D9412GID7412G Specifications -- 02001 Radionics Page 6 47487B Innovc,". r a Flaw Dud Smd e Ddedon Tedndogy 4-Wire Low -Flow Duct Smoke Detector Model DH100ACDCLP 4-Wire Photoelectric Duct Smoke Detector with Low -Flow Technology Product Overview The System Sensor Innovair" DH100ACDCLP is a 4-wire photoelectric air duct smoke detector capable of sensing smoke in air velocities from 100 to 4,000 feet per minute (0.5 to 20.32 m/sec). This Innovair features Low -Flow technology that enables duct smoke detection throughout a broad range of air- flow environments. Many difficult to solve HVAC applications occur in low air- flow duct applications where reliable smoke detection is critical. Innovair with Low -Flow technology can detect smoke at air speed velocities of 100 feet per minute or greater, while'continuing the same reliable performance to 4,000 feet per minute. The two available form C relay contacts provide reliable performance for the management of fans, blowers and air conditioning systems. These HVAC w devices can be configured to prevent the spread of toxic smoke and fire gasses C through a protected area J,Q ;9VoJ The Innovair family is designed for simplified installation and easy mainte- natice. The modular construction allows for easy cleaning and uncomplicated I?©i,7 field replacement of the UL recognized power and sensor boards. The patented cover missing feature insures the cover is securely tightened following routine cleaning and maintenance. The patented interconnectability feature allows mul- tiple Innovairs to communicate with each other. In the event smoke is detected, the Innovair will signal the remaining interconnected detectors to initiate their relays for smoke control. Duct smoke detectors have specific limitations. NOT a substitute for an open area smoke detector, NOT a substitute for early warning detection, and NOT a replacement for a building's regular fire detection system. UL Refer to NFPA 72 and 90A for additional information about the proper LISTED application of duct smoke detectors. Architectural/Engineering Specifications The air duct smoke detector shall be a System Sensor Model DH100ACDCLP Series Duct Smoke Detector. The detector housing shall be UL listed per UL 268A specifically for use in air handling systems. The detector shall operate at air veloci- ties of 100 feet per minute to 4000 feet per minute (0.5 to 20.32 m/sec.). The unit shall be capable of controlling up to ten (10) air handling systems when interconnected with other detectors. The detector shall be capable of providing a trou- ble signal in the event that the front cover is removed. It shall be capable of local testing via magnetic switch or remote testing using the SSK451 Multi -Signaling Accessory or the RTS451KEY Remote Test Station. The unit shall be reset by local reset button or remote test station. The duct smoke detector housing shall incorporate an airtight smoke chamber in compliance with UL 268A, Standard for Smoke Detectors for Duct Applications. The housing shall be capable of mounting to either rectangular or round ducts without adapter brackets. An integral filter system shall be included to reduce dust and residue effects on detector and housing, thereby reducing maintenance and servicing. Sampling tubes shall either be telescoping or be easily installed by passing through the duct housing after the housing•is mounted to the duct. The unit shall provide a spacial separation of no less than 1/4" (6,4 mm) and/or a physical barrier between the high and low voltage terminals. The enclosure shall meet all applicable NEC and NFPA standards regarding electrical junction boxes. Terminal connections shall be of the strip and clamp method suitable for 12-18 AWG wiring. Wiring Guide POWER INPUTS ACCEPT 24 VDC, 24 VAC 50-60 HZ, 120 VAC 50.60 HZ, OR 220240 VAC 50.60 HZ. CONNECT POWER SOURCE TO APPROPRIATE TERMINALS OF EACH DETECTOR. VCONTACLR T9 INGSO90VDCRESISTIVE IOA ® 250 VAC I OO.A MINIMUM • 5 VDC NOT INTENDED FOR CONNECTION TO CONTROL PANELS. TROURIF— NTACT RATING 2.0 A 6 30 VDC mcichve ALARMINITIATION LOOP UL LISTED 4-WIRE CONTROL PANEL Specifications 143/8" (37 cm.) Length 51,t2" (14 cm.) Width 23/4" (7 cm.) Depth 3Y4 lbs. (1.7 kg.) AVAILABLE POWER INPUTS I e 10 A B C120 I 1 I I 24V t02C 20240 1 1 VAC ALARM AUXILIARY CONTACTS FOR FAN SHUTDOWN, ETC. 16 6 17 7 18 B N.C. C. N.O. N.O. .C. ALARM AUXILIARY CONTACTS SHOWN IN STANDBY. CONTACTS TRANSFER DURING ALARM AS INDICATED BY THE ARROWS. SUPERVISORY TROUBLE CONTACTS ALARM CONTACTS SHOWN INITIATION OPEN IN STANDBY. CONTACTS CONTACTS CLOSE IN ALARM. 4 L_ _ _ _ _ _ _ _ _ _ _ _ _ _ FIRST DETECTOR IN THE LOOP DH100ACDC AVAILABLE POWER INPUTS CONNECT POWER SOURCE B 10 A B C I TO APPROPRIATE TERMINALSOFEACHDETECTOR. SEE I SPECIFICATIONS FOR ONAL W SUPPLYADDITII{ L/ 24V t'AAG INFORMATION. 2.240i VAC ALARM AUXILIARY CONTACTS FOR FAN SHUTDOWN, ETC. 16 8 17 7 1B 8 FOR WIRING OF AUXILIARY I N.".2. t"-. DEVICES, REFER TO MANUFACTURERSINSTRUCTIONS I I OR CONTACTNMANUFACT I ALARM AUXILIARY CONTACTS SHOWN IN I NOTE: THE SUPERVISORY RELAY NOW STANDBY. CONTACTS TRANSFER DURING PROVIDES A'FORM C' CONTACT FOR ALARM AS INDICATED BY THE ARROWS. CUSTOMIZED APPLICATIONS. ONLY SUPERVISORY TROUBLE CONTACTS THE NO' CON ACT IS USEIDONS, I I143 I I TROUBLE CONTACTS CLOSED IN AURM AND STANDBY CONTACTS OPEN WHILE DETECTOR PCB DA POWER IS REMOVED OR WHEN TAMPER FEATURE TIMES OUT OPEN CONTACTS SIGNAL TROUBLE OONDITION TO PANEL I I I 5 I ALARM CONTACTS SHOWN I INITIATION OPEN IN STANDBY. CONTACTS CONTACTS CLOSE IN ALARM. 4 I I I EOL I RESISTOR LAST DETECTOR IN THE LOOP SPECIFIEDSPE DH100ACDC PANEL MANUFACTURER 32' to 131e F (00 to 55e C) 10% to 93% relative humidity non -condensing 100 to 4000 ft./min. (0.5 to 20.32 m/sec.) Electrical Ratings — DH100ACDCLP (Includes Detector) Power supply voltage: 20-29 VDC 24 VAC 50-60-Hz 120 VAC 50-60 Hz 220/240 VAC 50-60 Hz Input capacitance: 270 pF max. 270 NF max. N/A N/A Reset voltage: 3.0 VDC min. 2.0 VAC min. 10 VAC min. 20 VAC min. Reset time (with RTS451): 03 to 0.3 sec. 03 to 0.3 sec. 03 to 0.3 sec. 03 to 0.3 sec. Reset time (by power down): 0.6 sec. max. 0.6 sec. max. 0.6 sec. max. 0.6 sec. max. Power up time: 34 sec. max. 34 sec. max. 34 sec. max. 34 sec. max. Alarm response time: 2 to 17 sec. 2 to 17 sec. 2 to 17 sec. 2 to 17 sec. Sensitivity Test: See detector label See detector label See detector label See detector label Power Supply Voltage 1 20 - 29 VDC 24 VAC 50.60 Hz 120 VAC 50.60 Hz 22=40 VAC 50 - 60 Hz CURRENT REQUIREMENTS (USING NO ACCESSORIES) Max. standby current 15 mA 35 mA RMS 25 mA RMS' 15 mA RMS' Max. alarm current 70 mA 125 mA RMS 35 mA RMS' 25 mA RMS' CONTACT RATINGS Alarm initiation contacts (SPST) 2,OA 0 30 VAC/DC (0.6 power factor) Alarm auxiliary contacts (OPDT) t0A @ 30 VDC 1OA 0 250 VAC Note: Alarm auxiliary contacts must switch 100mA minimum at 5VDC. Alarm auxiliary contacts shall not be connected to irtitdaing circuits of control panels. Use the alarm initiation contact for this purpose. Trouble contacts (SPDT) 2.OA 0 30 VDC (resistive) ACCESSORY CURRENT LOADS AT 24 VDC DEVICE STANDBY TROUBLE ALARM APA451 12.5mA Max. n/a 30mA Max PA400 OmA n/a 15mA Max RA40OZ OmA Na 10mA Max RTS451IRTS451KEY 12mA' n/a 7.5mA Max. SSK451 5mA Max. gmA Max. 30mA Max NOTE: When a unit is powered at the 120VAC or 220/240VAC input, any combination of accessories may be used such that the given aceassory loads are: 60 mA orlessin the standby slate; 110 mA orless o the alarm stele. Important Interconnect Notes a When using the interconnect feature, all interconnectedDH100ACDCLPAPA451 Alarm Signal 15 2 Alarm units must be powered with the same, independent supply. Aux. Power 19 a Polarity must be maintained throughout the interconnect wiring. Connect terminal 12 on unit 1 to terminal 12 on Sup. N. o. 14 3 Power unit 2 and so on. Similarly, connect terminal 1 on unit 1 to terminal 1 on unit 2 and so on. Sup. COM 3 Aux. Power- 20 1 Common NOTE: Wiring diagram shown is for DH1 OOACDCLP 4-wire duct smoke detector system equipped without a control panel. NOTE: A trouble condition is indicated when the green LED is not illuminated. FIELD INSTALLED JUMPER FOR TEMPORAL PATTERN COMMON. G TEMPORAL SELECT V 5 ALARM SIGNAL ALARM SIGNAL 1 3 SUPERVISORY SUPERVISORY SIGNAL 4 q NO CONTACT RESET 7 2 RESET TEST 8 11 TEST POWER (•) 6 41 0 AUX. POWER (-) POWER (+) 5 8 AUX. POWER (+) 2 INTERCONNECT + 1 INTERCONNECT- SSK451 DH100ACDCLP UNIT 1 FIELD INSTALLED 12 INTERCONNECT+ JUMPER1 INTERCONNECT- OH100ACDCLP UNIT 2 Alarm Signal `! I Aux. Power + L I I Sup. N. O. 4 1 I Sup. COM Aux. Power- 12 Reset Test Interconnect - RTS451/ RTS451KEY O1 ( Red LED) Alarm 6 ( Green LED) I Power I I I Interconnect + Unit 1 12 NOTE: For RTS451KEY only without a Control Panel. DH100ACDCLP UNIT 2 Interconnect - Interconnect + Ordering Information DH100ACDCLP 4-wire photoelectric duct detector with low -flow technology A5069 Replacement photoelectric detector board A5064 Replacement 4-wire power board ST-1.5 Metal sampling tube duct widths 1'-2' (0.3-0.6 m) ST-3 Metal sampling tube duct widths 2'-4' (0.6-1.2 m) ST-5 Metal sampling tube duct widths 4'-8' (1.2-2.4 m) ST-10 Metal sampling tube duct widths 8'-12' (2.4-3.7 m) TSO-71-00 Replacement telescoping sampling tube P48-55-00 Replacement and cap for T80-71-00 SSK451 RTS451KEY Multi -Signaling accessory Remote test station with key lock (see below) RTS451 Remote test station____ APA451 Remote annunciator with plezo alarm Accessories MOD40OR Sensitivity test module RA40OZ Remote annunciator alarm LED (see below) F36-09-11 Replacement air filters (two per package) M02.04-00 Test magnet P48-21-00 End cap for metal sampling tubes S08-39-01 Photo replacement screen PA40OW Mini -Alert sounder PS24LOW Minl-Alert add -on strobe PS12/24SLENSW Wall -mount 'SMOKE' lens System Sensor provides system flexibility with a variety of accessories, including two remote test stations, and several different means of visible and audible system annunciation. As with our duct detectors, all duct smoke detector accessories are UL listed. Piezo Annunciator Remote Test Station Mini -Alert Sounder Remote Test Station UL S4011) with Key (UL S2522) (UL S3593) (UL S2522) shown with PS24LOW add - on strobe (PS12/24SLENSW smoke lens option available) Ooo00 OO 00000000pp o . 00000000 o ooe0000000000000000 0000000 1000000000W0000000000000000008OOOOOO000Multi - Signaling Oo Oo Accessory A ( UL 268A) System Sensor Sales and Service 00 0o00 000 O YAY OO O S 0 K o0 O0UO00000000oo0oSystem Sensor Headquarters System Sensor Canada System Sensor In China 3825 Ohio Avenue Ph: 905.812.0767 Ph: 86.29.524.6253 St. Charles, IL 60174 Fx: 905.812.0771 Fx: 86.29.524.6259 Ph: 800/SENSOR2 System Sensor Europe System Sensor In Singapore Fx: 630/377.6495 Ph:44.1403.276500 Ph:65.273.2230 Documents - on -Demand Fx:44.1403.276501 Fx:65.273.2610 800/ 736-7672 x3 www. systemsensor.com Remote Annunciator UL S2522) Multi - Signaling Accessory UL 268A) shown with PS24LOW add -on strobe ( PS12/24SLENSW smoke lens option available) System Sensor - Far East Ph: 85.22.191.9003 Fx: 85.22.736.6580 System Sensor - Australia Ph: 613.54.281.142 Fx: 613.54.281.172 System Sensor - India Ph: 91.11.558,2119 Fx: 91.11.567.6815 0 2000 System Sensor. The company reserves the right to change product specifications without notice. A05-1044000. 12/00•#685 Models Available Standard Application Models 2100S 2100TS 2112/24S 2112/24TS Auxiliary Form C Relay Models 2100TR 2112/24R 2112/24TR Temporal Pattern Sounder Models 2100AT 2112/24AT 2112/24ATR 2112/24AITR Product Overview Full product line of photoelectric, low -profile smoke detectors SmartCheck'"^ diagnostics let you visually check sensitivity range Isolated thermal models Extensive two -wire compatibility listings Twist -off" cleaning on standard models only Sounder units feature built-in temporal tone Auxiliary Form C Relay units control elevator recall, door closure System Sensor's 100 Series smoke detectors may come in a small package but they pack some big benefits. A large, supervised terminal block patent pending) featuring captured SEMS screws simplifies installation. SmartCheckT' self -diagnostics allow you to check the detector's sensitivity range by simply looking at the unit, Every ten seconds diagnostic circuitry monitors chamber sensitivity, checking to see if the detector is within its UL specification range. If it is, the LED flashes every ten seconds. If not, the LED stops flashing - a clear sign the detector needs cleaning or servicing. So, to see if a 100 series is within specification range, just look at it. This meets NFPA 72 requirements for sensitivity testing. For sensitivity readout, use MOD 400 accessory and voltmeter. Heat Detection. Integrated thermal models provide restorable, 135-degree fixed -temperature heat detection. Isolated thermal models feature a fixed -tem- perature heat sensor that is isolated from the smoke sensor, providing a self -resetting, local audible smoke alarm. In these models only the isolated heat sensor will signal an alarm to the panel. The isolated thermal products are designed for applications where local annunciation, not total facility evacuation is desired. Sounder Models. A built-in piezoelectric horn (patent pending) in the 100 series sounder models produces the NFPA 72-required, 85dBA temporal U tone pattern when the individual detector alarms or when the supply voltage polarity is reversed. LISTED continued Standard Application Specifications Operating Voltage 12/24 VDC (nominal), 8.5 min. to 35 max. Standby Current - -- ------ 50 pA maximum average humidity Range 10% to 93% RH, noncondensing Fixed lempuraturu Heat Sensor 1 35°F electronic thermistor Uiameter 5.5 in. (140mm) Model I Thermal I Wiring lenlperatuie Range 2100S i No 2-wire 32' to 120-F (0° to 50°C) 2100TS Yes I 2-wire 32° to 100-F (0' to 38°C) 2112/24S No 4-wire 32° to 120°F (0° to 50°C) 2112/24TS Yes I 4-wire 32° to 100°F (0' to 38°C) Auxiliary Form C Relay Specifications Alarm Current Height 1.9 in. (48mm) with bracket WFaglu 5.3 oz. (150 grams) 100mA max. limited by panel 100mA max. limited by panel r 17mA typical, 23mA max. at 12V; 19mA typical, 25mA max. at 24V _ - 17n1A typical, 23mA max. at 12V; 19mA typical, 25mA max. at 24V Auxiliary Contact Hunudity Ramie Form C 10% to 93% RH, noncondensing Auxiliary Relay C.untaCt Raunys Diameter 1AC30 VDC 5.5 inches (140mm) Height 1.7 inches (43mm) with bracket Slipping Weight 6.8 ounces (192 grams) Fixed lemperature Model I Itw..Ii11al Wlrniq lelllpeiature liiinge Operating VoltHge Fleat S011501' — _ Alarm Current Standby Current — 2100TR• I Yes 2-wire 32' to 100°F 12/24 VDC (nominal) 135°F 100mA max. 50 pA average 0' to 38°C) 8.5 min. to 35 max. electronic thermistor limited by panel 100 pA maximum 2112/24R° No i 4-wire 12/24 VDC (nominal) 32° to 120`F 28mAtypical 50 pA average 0' to 50°C) 10 min. to 35 max. 35mA max. at 12V 36mA typical 32' to 100°F 135°F 45mA max. at 24V 2112/24TR° Yes 4-wire I 12/24 VDC (nominal) 28mAtypical 50 pA average 0° to 38°C) I 10 min. to 35 max. electronic thermistor 35mA max. at 12V 36mA typical 45mA max. at 24V Temporal Pattern Sounder Specifications Standby Cunene fix«sl Icnlperauue Ileat Sensnl 50 pA avg., 100 pA max. 135'F electronic thermistor englerallire Range Dialnetel 32°-100°F (0 -38°C) 5.5 in. (140mm) Humidity Range 10%-93% RH, noncondensing height 2.05 in. (52mm) with bracket Shipping Weight -- — 7.4 oz. (210 grams) Auxiliary F3uiltIn Temp 3 Auxiliary Model Thermal Wiring Operating Vohege Alain Current Consumption Contact 1481.111gs SUtlnder Contact 2100AT' Yes 2-wire 12/24 VDC 13mA min., 1 OOmA max. 85dBA No 8.5 min. to 35 max. 2112/24AT Yes 4-wire 12/24 VDC 49mA typical, 60mA max. at 12V 85dBA No 10 min, to 35 max. 57mA typical, 65mA max. at 24V 2112/24ATRI Yes 4-wire 12/24 VDC 49mA typical, 60mA max. at 12V lA030 VDC 85dBA Form C 10 min. to 35 max. 57mA typical, 65mA max. at 24V 2112/24AITR° Isolated 4-wire 12/24 VDC 49mA typical, 6OmA max. at 12V TiA 30 VDC 85dBA Form C 10 min. to 35 max. 57mA typical, 65mA max. at 24V CSFM. MSFM listed System Sensor Sales and Service System Sensor Headquarters System Sensor Canada System Sensor in China 3825 Ohio Avenue Ph: 905.812.0767 Ph: 011.86.29.524.6253 St. Charles, IL 60174 Fx: 905.812.0771 Fx: 011.86.29.524.6259 Ph: BOO -SE NSOR2 System Sensor in Europe System Sensor in Singapore Fx: 630/377 6495 Ph: 011.44.1403.276500 Ph: 011.65.273,2230 Fx:011.44.1403.276501 Fx:011.65.273.2610 0 1999 System Sensor The company reserves the right to change product specifications without notice. System Sensor- For East Ph: 011.852.21919003 Fx: 011,852.27366580 System Sensor- Australia Ph: 011,613.54-281.142 Fx: 011. 613.54.281.17 2 AOS-227,09.1/99(25K) °i400 D461 Manual Fire Alarm Box Specifications 1 Features Rugged die cast housing 14 gauge Plated steel back plate Single gang mounting Corrosion resistant construction 10 Amp 120 VAC contacts Key locked reset Screw terminal connections Optional break glass rod Latching pull down lever Description The Radionics' D461 Manual Fire Alarm Box is a single action, UL listed fire alarm initiating device. It has one set of normally open contacts rated for 10 Amps at 120 VAC. The D461 has an easily identifiable pull down lever and contains an integral break glass rod carrier. The D461 is compatible with the following accessory devices: D463 D465 D466 The unit is a high quality manual fire alarm box constructed entirely of non -toxic materials with a low profile and rounded edges to fit most design applications. All components are prepainted or have plated surfaces to inhibit corrosion. Non - corroding screw terminals are provided for wire connections to the D461. The D461 is manufactured in conformance with the standards set forth in the Americans with Disabilities Act. The D461 has a white pull down lever in its center. Pulling down the lever latches it into place. The D461's normally open contact switch is shorted causing an alarm on the fire initiating loop. The pull down lever can not be reset unless the correct key is inserted into the manual fire alarm box lock and the unit is opened. The latching lever can then be restored to its normal position. When the D461 is being reset and has a glass break rod installed, all debris must be removed priorto installing another rod to ensure the unit will close and lock securely. Radionics D461 Manual Fire Alarm Box Application The D461 Manual Fire Alarm Box is an accessory device for Radionics control/communicators and is typically used in fire alarm applications. Manual fire alarm boxes are generally installed near building fire exits such as lobbies or stairways. Persons evacuating the building during an emergency are able to initiate an alarm by pulling down a lever. This alerts others who may still be inside. Schools, factories, offices, and health care facilities are typical applications. The snap lock feature of the D461 prevents the unit from being reset without a key so the origin of the alarm can be more easily determined. The 10 Amp, 120 VAC contact rating allows the D461 to handle larger current loads. This makes the unit an ideal choice for both new installations and retrofits. Installation The Radionics' D461 Manual Fire Alarm Box is a UL listed fire alarm initiating device. The D461 is installed alone or with other approved mechanical devices on Radionics control/communicators. Manual fire alarm boxes must be installed according to codes set by the authority having jurisdiction. The D461 mounts to a standard flush or surface mounted single gang switch box or plaster ring. Slotted screw holes allow for correct positioning during installation. Two corrosion resistant screw terminals are provided for wire connections. All wiring and installation is subject to the authority having jurisdiction. Install, test and maintain this device according to the Installation Guide, NFPA 72, Local Codes and the Authority Having Jurisdiction. Failure to follow these procedures may result in failure of the device to operate properly. Radionics is not responsible for devices that are improperly installed, tested and maintained. Specifications D461 Specifications Contact current rating 10 Amps at 120 VAC Dimensions HXWXD) 4.75 in. x 3.1875 in. x .875 in. 1 (12 cm x 8 cm x 2.2 cm) Listings and Approvals UL listed CSFM: approved Ordering Information Model Description D461 Manual Fire Alarm Box D463 Double -Action Cover D465 Glass Replacement Rod D466 Backbox, Red 0 0 0 To Fire Alarm 1 0 Control/Communicator EOL Resistor Zone or Point 2 3 4 0 I Switch I I 0 O O D461 Wiring Connections Iso 90020 CERTIFICATE NO. A5137 2001 Radionics, a division of Detection Systems, Inc. P/N: 75-06561-000-C 03/01 The Radionics logo is a registered trademark of Radionics, Specification Sheet D461 PO Box 80012, Salinas, CA 93912-0012 USA Page 2 of 2 Customer Service: (800) 538-5807 FEMA REC'd l SLAB REC'd INSPECTOR REQUEST FOR FINAL INSPECTION CERTIFICATE OF OCCUPANCY/COMPLETION NEW COMMERCIAL BUILDING**** DATE 7/6 .3' y // PERMIT # [/ / l o ADDRESS 5730 Or andor PROJECT LCWC5 CONTRACTOR — The Building Division has received a request for a final inspection and a Certificate of Occupancy for the above referenced address. We would appreciate a final inspection of the site by your department. Approval by your department would result in a granting a C.O. for the address. If you have any issues that the contractor will need to address, please submit a statement for denial of C.O. or a conditional agreement to be attached to the C.O. Thank you for your cooperation. Engine( Public I Utilities Conditions: (to be completed only if approval is conditional) FEMA REC' d ld SLAB REC'd INSPECTOR REQUEST FOR FINAL INSPECTION CERTIFICATE OF OCCUPANCY/COMPLETION NEW COMMERCIAL BUILDING"" DATE PERMIT # ADDRESS 5730 0r6enalz PROJECT LcW c CONTRACTOR - The Building Division has received a request for a final inspection and a Certificate of Occupancy for the above referenced address. We would appreciate a final inspection of the site by your department. Approval by your department would result in a granting a C.O. for the address. If you have any issues that the contractor will need to address, please submit a statement for denial of C.O. or a conditional agreement to be attached to the C.O. Thank you for your cooperation. Engineering Public Works fh a v s Utilities Fire Zoning Licensinq Conditions: ( to be completed only if approval is conditional) FEMA REC'd SLAB REC'd INSPECTOR REQUEST FOR FINAL INSPECTION CERTIFICATE OF OCCUPANCY/COMPLETION NEW COMMERCIAL BUILDING**** DATE / PERMIT ADDRESS 5730 Or(a idd PROJECT CONTRACTOR The Building Division has received a request for a final inspection and a Certificate of Occupancy for the above referenced address. We would appreciate a final inspection of the site by your department. Approval by your department would result in a granting a C.O. for the address. If you have any issues that the contractor will need to address, please submit a statement for denial of C.O. or a conditional agreement to be attached to the C.O. Thank you for your cooperation. Engine Public Utilities Licensinq Conditions: (to be completed only it approval is conditional) 6H FEMA REC'd SLAB REC'd INSPECTOR REQUEST FOR FINAL INSPECTION CERTIFICATE OF OCCUPANCY/COMPLETION NEW COMMERCIAL BUILDING**** DATE7/6- I'S PERMIT # `/Wo ADDRESS 5730 Or(aq'dA PROJECT LcWt-'s CONTRACTOR — The Building Division has received a request for a final inspection and a Certificate of Occupancy for the above referenced address. We would appreciate a final inspection of the site by your department. Approval by your department would result in a granting a C.O. for the address. If you have any issues that the contractor will need to address, please submit a statement for denial of C.O. or a conditional agreement to be attached to the C.O. Thank you for your cooperation. Engineering Fire Public Utilities lZz 3 Conditions: (to be completed only if approval is conditional) LMBC0401 CITY OF SAMFORD 1/21/03 Address Misc. Information Maintenance 08:38:03 Location ID . . . . . 242775 Parcel Number . . . . Alternate location ID Location address . . . 3780 ORLANDO DR Primary related party SpecialTypeinformation, press Sequence Code ff App Enter. Free -form information Date notes 1.00 — 2.00 3.00 4.00 — 5.00 6.00 7 :-00 8.00 9.00 10.00 More... F2=Address F3=Exit F5=Motes display F6=Change display F10=Subdiusjpn notes F12=Cancel LMBC0401 CITY OF SAMFORD 1/21/03 Address Misc. Information Maintenance 08:37:41 Location ID . . . . . . . 242765 Parcel Number . . . . . Alternate location ID . . Location address . . . . . 3780 ORLANDO DR Primary related party : Type information, press Enter. Special Sequence Code(F4) App Free -form information Date notes 1.00 — 2.00 — 3.00 _ 4.00 — 5.00 _ 6.00 _ 7.00 — 8.00 9.00 10.00 More... F2=Address F3=Exit F5=Motes display F6=Change display F10=Subdiusion Notes F12=Cancel LMBC0401 CITY OF SAMFORD 1/21/03 1 Address Misc. Information Maintenance 08:33:08 Location ID . . . . . . Parcel Number . . Alternate location ID Location address . . Primary related party Type information, press Sequence Code(F4) App 1.00 CSUC UT 2.00 CSUC U-T 3.00 — 4.000' — 5.00 — 6.00 — 7.00 — OU — 9.00 — 10.00 — 242755 3780 ORLANDO DR Enter. Special Free -form information Date notes 3" HGAL d 3/4" LGAL HAUE SAME METER # 10102102 Y 70105251** More... F2=Address F3=Exit F5=Notes display F6=Change display F10=Subdiusion Notes F12=Cancel LMBC0401 CITY OF SAMFORD 1 21 03 Address Misc. Information Maintenance 08:32:45 Location ID . . . . . Parcel Number Alternate location ID Location address . . . Primary related party Type information, press Sequence CodetF4) App 2.00 CSUC UT 3.00 — 4.00 — 5.00 - 6.00 — 7.00 — 8.00 — 9.00 — 10.00 - F2=Address F3=Exit F16=Subdiusion Motes 223975 11.20.30.300-018G-0000 3780 ORLANDO DR LOWES HOME IMPROVEMENT CENTER Enter. Free -form information CONSTRUCTION TRAILER OMLY**MO SW**OMLY WA*.**-** Special Date notes 62802 Y More... F5=Motes display F6=Change display F9=Parcel Motes F12=Cancel F16=Related pty data Upham,*-jnc* Consulting Engineers, Surveyors &'Landscape•Architects . P.O. 'B6x 1105'9 265 Kenilworth Avenue • Ormond Beach, Florida 32174. 386) 672-9515 FAX (386) 673-6554 9 LB# 0003612 • •LC# 0000357 Visit us at: www.uphaminc.com January 27; 2003 . `. City of Sanford Building' Division P. O.-Box .1788 ' Sanford, FL 32772-1798 ' Re: Lowe's Home Improvement Warehouse - - 3780 S. Orlando Drive' - Sanford, FL 32771 • To Dan M. Florian, CBO The' finished -floor elevation of the structure located at 3780 S. Orlando Drive, Lot 3, -Live Oak Center) meets or. exceeds the requirements set' forth. in the ; City of Sanford Code Chapter 6, Sec. 6-7(a). , ' Sincerely, - - - William S Hart, PSM.#3905 r Ott .. ' V, ;'' . CAMy DocumentsVowes Sanford southeisA inished floor elevation.doc• rtUtKALtMtKUhNVT MANAUhMtNI AUhNUY O.M.B. No. 3067-0077 NATIONAL FLOOD INSURANCE PROGRAM Expires July 31, 2002 ELEVATION CERTIFICATE Important: Read the instructions on pages 1- 7. SECTION A - PROPERTY OWNER INFORMATION For Insurance Company Use: BUILDING OWNER'S NAME Lowe's Home Centers. Inc. BUILDING STREET ADDRESS (Including Apt., Unit, Suite, andlor Bldg. No.) OR P.O. ROUTE AND BOX NO. I Company NAIC Number I3780S. Orlando Drive CITY STATE ZIP CODE Sanford FL 32771 PROPERTY DESCRIPTION (Lot and Block Numbers, Tax Parcel Number, Legal Description, etc.) BUILDING USE (e.g., Residential, Non-residential, Addition, Accessory, etc. Use a Comments area, if necessary.) Non -Residential LATITUDE/LONGITUDE (OPTIONAL) HORIZONTAL DATUM: SOURCE: GPS (Type): fl° - #9 - ##.##- or ##.#####1 NAD 1927 NAD 1983 USGS Quad Map Other. SECTION B - FLOOD INSURANCE RATE MAP (FIRM) INFORMATION B1. NFIP COMMON" NAIVE b COMMUNITY NUMBER B2. COUNTY NAME W. STATE Sanford 120294 Semihole FL B4. MAP AND PANEL B5. SUFFIX B7. FIRM PANEL B9. BASE FLOOD ELEVATION(S) NUMBER B6. FIRM INDEX DATE EFFECTIVEIREVISED DATE B8. FLOOD ZONE(S) Zone AO, use depth of Wing) 12117CO045 E 4/17M 4/17195 X 39 ft B10. Indicate the source of the Base Flood Elevation (BFE) data or base flood depth entered in B9. FIS Profile ® FIRM Community Determined Other (Describe): B11. Indicate the elevation datum used for the BFE in B9: ® NGVD 1929 NAVD 198E Other (Describe): B12. Is the building located in a Coastal Barrier Resources System (CBRS) area or Otherwise Protected Area (OPA)? Yes ® No Designation Date_ SECTION C - BUILDING ELEVATION INFORMATION (SURVEY REQUIRED) C1. Building elevations are based on: Construction Drawings' Building Under Cmsti )cW ® Finished Construction A new Elevation Certificate will be required when construction of the building is complete. C2. Building Diagram Number 1(Select the building diagram most similar to the building for which this certificate is being completed - see pages 6 and 7. If no diagram accurately represents the building, provide a sketch or photograph.) C3. Elevations —Zones Al-A30, AE, AH, A (with BFE), VE, V1430, V (with BFE), AR, ARIA, ARIAE, ARIA1-A30, ARIAH, ARIAO Complete Items C3.-a4 below according to the building diagram specified in Item C2. State the datum used. If the datum is different from the datum used for the BFE in Section B, convert Bhe datum to that used for the BFE. Show field measurements and datum conversion calculation. Use the space provided or the Comments area of Section D or Section G, as appropriate, to document the datum conversion. Datum NGVD 29 Conversion/Comments Elevation reference mark used Does the elevation reference mark used appear on the FIRM? Yes No 46 '; • :3 o a) Top of bottom floor (including basement or enclosure) 48. 2 ft.(m) o b) Top of next higher floor WA. —ft.(m) ,' o c) Bottom of lowest horizontal structural member (V zones only) NIA. —fl. m) AP o d) Attached garage (top of slab) WA. —ft.(m) w rc`.'' o e) Lowest elevation d machinery ardor equipment 4- servicing the building (Describe in a Comments area) — —ft.(m) o f) Lowest adjacent (finished) grade (LAG) 47.8 ft.(m) Z.0o ` - o g) Highest adjacent (finished) grade (HAG) 48. 2 iL(m) o h) No. of permanent openings (flood vents) within 1 t above adjacent grade WA J o i) Total area of all permanent openings (flood vents) in C3.h WA sq. in. (sq. cm) SECTION D - SURVEYOR, ENGINEER, OR ARCHITECT CERTIFICATION This certification is to be signed and sealed by a land surveyor, engineer, or architect authorized by law to certify elevation information. 1 certify that the information in Sections A, B, and C on this certificate represents my best efforts to interpret the data available. I understand that any false statement may be punishable by fine or imprisonment under 18 U. S. Code, Section 1001. CERTIFIER'S NAME William S Hart LICENSE NUMBER 3905 TITLE Professional Surveyor and Mapper COMPANY NAME Upham Inc. ADDRESS CITY STATE ZJP CODE 265 Kenilworth Avenue A Ormond Beach FI 32174 SIGNATURE DATE TELEPHONE 1/27M (386)672-9515 FEMA Form 81-31, JUL 00 SEE REVERSE SIDE FOR CONTINUATION REPLACES ALL PREVIOUS EDITIONS IMPORTANT: In these spaces, copy the corresponding information from Section A For ILm nogcXpaDy Use: BUILDING STREET ADDRESS (Including Apt, Unit. Suite, andlor Bldg. No.) OR P.O. ROUTE AND BOX NO. Policy Number 3780 S. Orlando Drive CITY STATE ZIP CODE Company NAIC Number Sanfof d FL 32771 SECTION D - SURVEYOR, ENGINEER, OR ARCHITECT CERTIFICATION (CONTINUED) Copy both sides of this Elevation Certificate for (1) community official, (2) insurance agentlocmpany, and (3) building owner. COMMENTS WO 020618 File: Sanford Lowds Check here if attachments SECTION E - BUILDING ELEVATION INFORMATION (SURVEY NOT REQUIRED) FOR ZONE AO AND ZONE A (WITHOUT BFE) For Zone AO and Zone A (without BFE), complete hems E1 through E4. If the Elevation Certificate is intended for use as supporting information for a LOMA or LOMR-F, Section C must be completed. Ell. Building Diagram Number _(Select the building diagram most similar to the building for which this certificate is being completed — see pages 6 and 7. If no diagram accurately represents the building, provide a sketch or photograph) E2. The top of the bottom floor (including basement or enclosure) of the building is _ t(m) _in.(crm) above or below (check one) the highest adjacent grade. (Use natural grade, I available). E3. For Building Diagrams 6$ with openings (see page 7), the next higher floor or elevated floc (elevation b) of the building is _ ft.(m) _in.(cm) above the highest adjacent grade. Complete items C3.h and C3.i on front of form. E4. For Zone AO only: If no flood depth number is available, is the top of the bottom floor elevated in accordance with the community's floodplain management ordinance? Yes No Unknown. The local official must certify this information in Section G. SECTION F - PROPERTY OWNER (OR OWNER'S REPRESENTATIVE) CERTIFICATION The property owner or owner's authorized representative who completes Sections A, B, C (Items C3.h and C3.i only), and E for Zone A (without a FEMAassued or community - issued BFE) or Zone AO must sign here. The statements in Sections A, B, C, and E are correct to the best of my knowledge. PROPERTY OWNER'S OR OWNER'S AUTHORIZED REPRESENTATIVE'S NAME ADDRESS CITY STATE ZIPCODE SIGNATURE DATE TELEPHONE COMMENTS rl411r'r1:,. Check here if attachments SECTION G - COMMUNITY INFORMATION (OPTIONAL) The local official who is auMorized by law or ordinance to administer the com munitys floodplain management ordinance can complete Sections A, B, C (or E), and G of this Elevation Certfcate. Complete the applicable items) and sign below. G1: •The'u'6r ation inSection C was taken from other documentation that has been signed and embossed by a licensed surveyor, engineer, or architect who is authorized by state or,kx al law to.oertity elevation inn oration. (Indicate the source and date of the elevation data in the Comments area below.) G2. A community otficia),cmVeted Section E for a building located in Zone A (without a FEMAassued or cormnunityassued BFE) or Zone AO. G3. The fdlowing i' on (hems G4-G9) is provided for comrmunity floodplain management purposes. 1. G4. PERMTT NUMBER I G5. DATE PERMIT ISSUED I G6. DATE CERTIFICATE OF COMPLUWCEIOCCUPANCY ISSUED G7. This permit has been issued for. New Construction Substantial Improvement G8. Elevation of as -built lowest floor (including basement) of the building is: _. _fL(m) Datum: G9. BFE or (in Zone AO) depth of flooding at the building site is: — _ ft.(m) Datum: LOCAL OFFICIAL'S NAME TITLE COMMUNITY NAME TELEPHONE SIGNATURE DATE COMMENTS Check here if attachments FEMA Form 81-31, JUL 00 REPLACES ALL PREVIOUS EDITIONS t . CITY OF SANFORD FIRE DEPARTMENT FEES FOR SERVICES PHONE # 407-302-1091 * FAX #: 407-330-5677 DATE: I— V` r < 7_dl PERMIT #: bc ' JLZ0 BUSINESS NAME / PROJECT: ADDRESS: PHONE NO.: b Q r FAX NO.: CONST. INSP. [ ] C / O INSP.:C REINSPECTION [ ] PLANS REVIEW [ ] F. A. [ ] F.S. [ ] H- -to, [ ] PAINT BOOTH [ B N PERMI ] 11 TENT PERMIT I ] TANK PERMIT [ ] OTHER l>: 11, g .iJ p,L,_.. TOTAL FEES: $ (PER UNIT SEE BELOW) COMMENTS: 1." 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. Address / Bldg. # / Unit # S uare Footage Fees Rer Bldg. / Unt I S S u t- O NAL 1e,4 r 7 t4A d `fNJJ-L, Fees must be paid to Sanford Building Department, 300 N. Park Ave., Sanford, FI. 32771 Phone # -407- 330-5656. Proof of Payment must be made to Fire Prevention division before any further services can take place. I certify that the above -'is true and correct and that 1 will comply with all applicable codes and ordinances of the City of Sanford, Florida. Sanford Fire Prevention Division Applicant Signature r T Q - . .. '. ., .Tr - -, i - .... -• ;•-'.. . . .,., rr-s :+..1 '_"+.t^ -. w-•-"vT'-•."' --j --•,7v ^--r1 • - !•. .. ^:` . _ •'v' . SANFORD•FI'R'C'DEPARTMENT. -Fire'P 6e-ntjon- "•yiispection Form E-6 : Special Problems / Occupancy Load: PoS+ r1?2 n7 , rot,3w,JN J'= c qsso. J i 100 it 6 6Z d L..;JC •. 3 -,G s- f a . CAI( q - ffi CAII 14_ P: 16 0 r- is M aA IIA,A 7zS_4_ "Oe A) t# a ,!;' k S'mTo titer u : _ 1,7- The vi ation(s) identified above must be brought into compliance within workin days: Contact the ait'o ire Department, Fire Preventi n Division # (40) _3q pp . ' , FP INSPECTION 5/9) A a( S w, 47usAWe, 4,;\d •,s ad 3 'OF`SANFO'RD ti; CrA1 P:Ef IAIT'APPLIC T IO,Iy Permit Number. OZ— ODae I<_ o Date: !Z- io -- 20z The undersigned hereby applies for a permit to install the following electrical: Owner' s Name: 4.1 _A Address of Job: 37*0 C„„!Jd 041 r IF i 73 Electrical Contractor: 9 iF!/x,,.>t i o. Residential: Non -Residential: X Number Amount Addition, Alteration, Repair Residential & Non -Residential) New Residential: AMP Service New Commercial: AMP Service Change of Service: From AMP Service to AMP Service . Manufactured Building Other. Description of Work: 1' I- Orkloozz" Ap lication Fee: $10.00 TOTAL DUE: By Signing this application I am stating that I am in compliance with ity of Sanford Electrical Code. Applicant' s Signature State License Number mkA Ch r SI OF SAtFO'Ft©LTRI. °rA1PEf1111TAPPLIC 1'IO.Iy qZrmit Number. 62-'0006IG/O4 - Date: /.2-3<)- 2-a02 The undersigned hereby applies for //a permit to innsttall the following electrical: Owner's Name: C_E,J•T41' tS Address of Job: 37Sd Electrical Contractor: Residential: Non -Residential: By Signing this application I am stating that I am in compliance with of Sanford Electrical Code. Applicant's Signature State License Number d t v ;;; , CITY OF SANFORD FIRE DEPARTMENT FEES FOR SERVICES PHONE # 407-302-1091 * FAX #: 407-330-5677 DATE: O PERMIT #: e0a BUSINESS NAME / PROJECT:%C-9- Ce.eS— ADDRESS: go 4 c' PHONE NO.( 7 - 73 ~ /068' FAX NO. :(rI %a) CONST. INSP. [ ] C / O INSP.:[ 1 REINSPECTION [ 1 F.S. [ ] HOOD [ ] PAINT BOOTHe TEN PA , ERMIT I ] TANK PERMIT [ ] OTHER [ ] _ TOTAL FEES: $ v60. CO W- COMM 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. H. 12. 13. 14. 15. 16. 17. 18. 19. 20. PLANS REVIEW b4 BURN PERMIT [ J PER UNIT SEE BELOW) Address / Bldg. # / Unit # Square Footage Fees per Bldg. / Unit Fees must be paid to Sanford Building Department, 300 N. Park Ave., Sanford, FI. 32771 Phone N -407- 330-5656. Proof of Payment must be made to Fire Prevention division before any further services can take place. I certify that t ove is true and correct and that I will comply ith II applicable codes and ordinances of the City f S ford, Florida. r, Sanf rd Fire Prevention Division Applicant's Signature ce-'Vej, 3 Permit Number. 14 / / Date: The undersigned hereby applies for a permit to install the following electrical: Owner's Name: --5 S Address of Job: Electrical Contractor Residential: Non -Residential: Number Amount Addition, Alteration, Repair Residential & Non -Residential) New Residential: AMP Service New Commercial: AMP Service Change of Service: From AMP Service to AMP Service Manufactured Building Other. Description of Work: 1 S .4Ge-tile— S 6-LV1 1 6 xJ Cr- s f-L c Ks Application Fee: 10.00 TOTAL DUE: By Signing this application I am stating that I am in compliance with City of Sanford Electrical Code. Applicant's Signature C, pia ZS Z State License Number FEMA REC'd SLAB REC'd INSPECTOR REQUEST FOR FINAL INSPECTION CERTIFICATE OF OCCUPANCY/COMPLETION NEW COMMERCIAL BUILDING**** DATE716*-s' PERMIT # I A0 ADDRESS '3730 0r(an.74 PROJECT CONTRACTOR The Building Division has received a request for a final inspection and a Certificate of Occupancy for the above referenced address. We would appreciate a final inspection of the site by your department. Approval by your department would result in a granting a C.O. for the address. If you have any issues that the contractor will need to address, please submit a statement for denial of C.O. or a conditional agreement to be attached to the C.O. / Thank you for your cooperation. Engineering Fire Public Works Zonina C/ Utilities Licensinci Conditions: (to be completed only if approval is conditional) t tplft• 5-02 W CITY OF SANFORD PERMIT APPLICATION Permit No: ` t Date: Job Address: 'l 0 Icy• Permit Type: Building: Electrical: Mechanical: Plumbing: Fire Alarm/Sprinkler: Description of Work: j5V&1e Htf1 j= S r le 5 YS rL ''!' Additional Information for Electrical & Plumbing Permits Electrical: _ Addition/Alteration _Change of Service Temporary Pole _ New AMP Service (#of AMPS_ Plumbing/Residential: Addition/Alteration New Construction (One Closet Plus Plumbing/Commercial: Number of Fixtures Number of Water & Sewer Drainage Lines _Number of Gas Lines ppJ Occupancy Type: _ Residential Commercial Industrial Total Sq Ftg:/ ue of Work S 2Z 0,000 Type of Construction: Flood Zone: Number of Stories: Number of Dwellings Units: Parcel No: (Attach Proof of Ownership & Legal Description) Owner/Address/Phone: use 3 rv-,,oa r,,L. Ad*vW Phone: iJcio re- Art— State License Number Contact Person: —D oL&c` . •tom Phone & Fax Numbers leptle Holder (If other tha Owner): r ty o ,n £-- io I; o 1. Address: C Bonding Company: Address: Mortgage Lender. Address: Architect/ Engineer Phone No: Address: Fax No: Application is hereby made to obtain to do work and installations as indicated. I certify that no work or installation has Commenced prior to the issuance of a permit and that all work will be performed to meet standards of all regulating construction In this jurisdiction. I understand that a separate permit must be secured for ELECTRICAL WORK, PLUMBLIMG, SIGNS, WELLS, POOLS, FURNACES, BOILERS, HEATERS, TANKS, and AIR CONDITIONERS, ect. OWNERS AFFIDAVIT: I certify that all of the forgoing information is accurate and that all work will be done in compliance with All applicable laws regulating construction and zoning. WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY. BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may be found in the public records of this county, and there may be additional permits required from other government entitles such as water management districts, state agencies, or federal agencies. Acceptance of permit is verification that 1 will notify the owner of the property of the requirements of Florida Lien Law, FS 713. Signature of Owner/Agent Date Print Owner/Agent's Name Date Signature 6CContractor/Age6t `Z! l l Date ime - , . Signature of Notary- State of Florida Date Signature f No/ttary — Stat e o uy Elm ' 9. 2006 Owner/ Agent is _ Personally Known To Me or Produced 1D Date 3- 0 a Date Owner/ Agent is _ Personally Known To Me or Produced ID APPLICATION APPROVED BY: / L, /S& Date: qw— — Z_ Special Conditions: i1-.© 0 CITY OF SANFORD FIRE DEPARTMENT FEES FOR SERVICES PHONE # 407-302-1091 * FAX #: 407-330-5677 DATE:akhca- j `PERMIT #: BUSINESS NAME / PROJECT: ADDRESS: PHONE NO.: CONST. INSP. [ 1 F. A. [ ] F.S. TENT PERMIT I 1 TOTAL FEES: S 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13, 14. 15. 16. 17. 18, 19. 20. C / 0 INSP.:[ ] HOOD [ ] TANK PERMIT j 7 FAX NO.: REINSPECTION [ ] PLANS REVIEW [ ] PAINT BOOTH [ ]BURN ERM1T [ ) OTHER' / A vk- Q(`AxL;?- PER UNIT SEE BELOW) r Address / Bldg. # / Unit # Square Footage Fees per Bldg. / Unit Fees must be paid to Sanford Building Department, 300 N. Park Ave., Sanford, FI. 32771 Phone # -407- 330-5656. Proof of Payment must be made to Fire Prevention division before any further services can take place. I certify that the above is true and correct and that I will comply with all applicable codes and ordinances of the City of Sanford, Florida. Sanford Fire Prevention Division Applicant's Signature 3780 Orlando Der Lowe's Perznit nuznbers: 02-1610 LQ.YIS IAV Act. t v*e Zoo" ham, Inc.$ rgenlzetlon of Englneeme, Surveyors & Landscape Architects P.O. Bog 1105 • 265 Kenilworth 4venue • Ormond Beach, Florida 32174 386)672-9515 • FAX (386)673-6554 • LB# 0003612 9 LC# 0000357 Visit us at: www.uphaminc.com Date: September 18, 2002 To: Drew Brady Marcobay Construction WE ARE SENDING YOU VIA hand delivery THE FOLLOWING ITEMS: Shop Drawings Specifications Letter of Transmittal Attention: Project: Lowe's of Sanford Project No: Re: Revised Utility Plan Attached Under separate cover Prints Plans Samples Copy of Letter Change Order Copies Date Number Description 3 l Sheet C-8 revised date.9/18/02 r'` TiiT [.T A 11T Tl'f ALTC1/iTTTT _ _L __1__3 1- 1 Y l lli-do w 171X.Li 11N!'111U1P111 11,L CIO V1IHV AVY V%law". I For Approval Approved as Submitted Resubmit Copies for Approval For Your Use Approved as Noted For Review and Comment As Requested Returned for Corrections FOR BIDS DUE PRINTS RETURNED AFTER LOAN TO US REMARKS: Attached are three signed and sealed copies of sheet C-8 for submittal to the City Fire Marshall indicating his request to relocate the FDC outside of the building. The revision indicates a 12-inch check valve winthin a vault on the 12-inch supply line into the building and a 4-inch fire line and FDC outside the building in the landscape island. Copy to: R Goodman w/ copy H Bayless w/ copy Signed: IZ09W ' W. WCUZa, PE lep BP208I01 CITY OF SANFORD Global Location Inquiry - Building Permit Applications Property address . . . . . . 3780 ORLANDO DR Parcel Number . . . . . . . . 11.20.30.300-018G-0000 Type options, press Enter. 2=Application inq 3=Structure inq 4=Permit inq 5=Inspection inq Opt Appl Nbr Type Stat Date Tenant Nbr/Name 02 00002217 SIGN CL 9/17/02 02 00002216 SIGN CL 9/17/02 02 00002215 SIGN CL 9/17/02 02 00001840 WALL CL 7/18/02 02 00001610 NSTR CO 6/26/02 02 00001583 TCAU CL 6/21/02 02 00001574 COND AP 6/20/02 02 00001469 BURN CL 6/17/02 02 00001182 SDVP AP 5/03/02 02 00000450 FPLT AP 12/26/01 02 00000449 ENGR AP 12/26/01 F3=Exit F12=Cancel 1/17/06 BP208I01 CITY OF SANFORD Global Location Inquiry - Building Permit Applications Property address . . . . . 3780 ORLANDO DR Parcel Number . . . . . . . . 11.20.30.300-018G-0000 1/17/06 15:27:00 Type options, press Enter. 2=Application inq 3=Structure inq 4=Permit inq S=Inspection inq Opt Appl Nbr Type Stat Date Tenant Nbr/Name 06 00000173 TENT AP 10/14/05 05 00000246 TENT CL 10/28/04 04 00000454 SIGN CL 11/24/03 04 00000327 TENT CL 11/11/03 03 00001262 SIGN CL 3/10/03 03 00000993 ELEC CL 1/31/03 03 00000888 FRAL CL 1/15/03 03 00000884 ELEC CL 1/15/03 03 00000040 PPLT DN 10/08/02 03 00000004 FRSP CL 10/01/02 02 00002231 FRSP CL 9/18/02 F3=Exit F12=Cancel Richard Goodman, Construction Manager Florida Construction Office 901 SW Martin Downs Blvd., Suite 311 Palm City, FL 34990 Phone: (561) 463-1461 Fax: (561) 463-1462 Improving Home Improvement December 20, 2002 City of Sanford Dan Florian, Building Official P.O. Box 1788 Sanford, FL 32772-1788 RE: Prepower Inspection Request for the Lowe's of Sanford, FL 3780 S. Orlando Drive/Sanford, FL 32773 To Whom It May Concern: This letter is written to request a prepower inspection for the address referenced above. Please be advised that such building will not be occupied until the Certificate of Occupancy has been released. Sincerely, RICHARD GOODMAN CONSTRUCTION MANAGER Cc: Mike Harless Howard Bayless (Marcobay Construction) John Shepard (SIS3) Jason James LOWE'S Home Improvement Warehouse - Improving Home ImprovementTM - www.lowes.com January 21, 2003 SENT VIA MAIL AND FACSIMILE 407-330-5677 Robert Bott Deputy Building Official City of Sanford ' P.O. Box 1788 Sanford, Florida 32772 Re: Lowe's of Sanford, Florida 3780 S. Orlando Drive Dear Bob: This letter is to confirm the discussions at our meeting this morning regarding to the issuance of a building certificate of occupancy on the able referenced project. It was agreed upon that Mike McGibeny would release the final fire approval for the issuance of a certificate of occupancy upon the completion and successful inspection of the Life Safety Systems, Fire Alarms Systems and Fire Suppression Systems including in rack fire sprinklers, assuming all other building and site inspections have been finaled. Thank you for your time this morning and should you have any questions or if I can be of any further assistance, please do not hesitate to contact me. Sincerely, Xc: Richard Goodman, Lowe's Mike McGibeny, City of Sanford 116 SOUTH KENTUCKY AVENUE LAKELAND, FLORIDA 33801 CG CO2034 (863) 680-2293 FAX (863) 680-2443 CG CO22914 From: 863-680-2443 To:814073305677 Page:1/1 Date: 1/21/2003 5:33:24 PM MAR#OBAY AW CONSTRUtT10N January 21, 2003 SENT VIA MAIL AND FACSIMILE 407-330-5677 Robert Bott Deputy Building Official City of Sanford P.O. Box 1788 Sanford, Florida 32772 Re: Lowe's of Sanford, Florida 3780 S. Orlando Drive Dear Bob: This letter is to confirm the discussions at our meeting this morning regarding to the issuance of a building certificate of occupancy on the able referenced project. It was agreed upon that Mike McGibeny would release the final fire approval for the issuance of a certificate of occupancy upon the completion and successful inspection of the Life Safety Systems, Fire Alarms Systems and Fire Suppression Systems including in rack fire sprinklers, assuming all other building and site inspections have been finaled. Thank you for your time this morning and should you have any questions or if I can be of any further assistance, please do not hesitate to contact me. Sincerely, Xe: Richard Goodman, Lowe's Mike McGibeny, City of Sanford 116 SOUTH KENTUCKY AVENUE LAKE -LAND, FLOMDA 33801 CG CO2034 (863) 680-2293 FAX (863) 680-2443 CG CO22914 This fax was sent with GFI's FAXmaker FAX Server - For more information, visit: http://www.gfi.com An additional minus tolerance of 0.02" if permitted along the barrel of the pipe for a distance not to exceed 12". Weight The weight tolerance of pipe is minus 6 per cent for pipe 12" and smaller in diameter, and minus 5 per cent for pipe larger than 12" In -diameter, COATINGS AND LININGS Outside Coating - The outside coating for use under normal conditions is an asphaltic coating approximately 1 mil thick as specified in AWWA C151. The coating is applied to the outside of all pipe, unless otherwise specified. The finished coating is continu- ous, smooth, neither brittle when cold nor sticky when exposed to the sun, and is strongly adherent to the pipe. Inside Lining AMERICAN Ductile Iron Pipe for water service Is normally furnished with standard cement lining on the Inside as specified in AWWA C104. For other types of service, pipe can be furnished uncoated inside or with cement lining, asphaltic lining, coal.tar epoxy, Polybond lining or with other spe- cial Using as may. be required to meei qw dal service conditions and as agreed upon at time of purchase. For more detailed iniormation on coatings and linings see Section 12. TESTING To insure that the properties of the fin- ished pipe meet or exceed the requirements of AWWA C151 and those of AMERICAN's quality control program, continuous inspection and testing are performed. Spectrurn Analysis following magnesium treatment of the molten metel, a sample Is poured from each ladle for spectrum analysis. Within minutes, the amount of magnesium and other elements in the Iron is determined. This early verification of the metal compo- sition is a vital factor in the control of pipe quality. Tensile Test The physical characteristics of the pipe are continually checked by tensile tests made at a frequency of at least one such test during each casting period of approximately 3 hours. The tensile test specimens are cut longitudinally from the pipe wall, and are machined from the midsection for testing. The acceptance values for hest specimens are as follows: Each 180 and large d%meter ductile iron pipe Is hydrostatically tested to 75% of meld strength which results in higher test pressures varying to over 1,10c psi depending on size and thickness of the pipe. 8-6 0 AMERICAN Ductile iron.Pipe for Water or Other Liquids ANSUAWWA C1S1/A21.51 WORKING PRESSURES'AND MAXIMUM DEPTHS OR COVER for Standard Pressure Classes Ta61e Nei- 3-11 U1YINO CONDf110N9 8 a Pralont wdnef Mww"" Dom of cowIM Fos# iti i 11dsb w bL Taw 1 1y" 2 7ypo 3 T W9 4 Typo • 61 89 loot 8 360 0.25 28 31 7 47 65 11" 15 19 20. 46 1 IQ 28 44 14 250 0.25 1t tl^ tb 23 36 300 0.30 tt 13 17 26 42 1 4 19 27 44 B 260 0.30 1t 11'• 15 24 34 300 0.32 tt 13 17 28 39 15 20 28 44 iB 250 041 tt 10- 14 22 31 300 0.34 tt 13 17 25 38 0.35 tt 1 a 20 260 0.33 tt 10 14 22 30 300 0.38 ft 1a 17 26 35 is 19 ze38 24 200 Q33 tt 8— 12 17 25 260 0.37 tt 11 15 20 29 300 0.40 tt 13 17 24 32 350 Q 15 19 8 7 Sw name of and of tabl& t0okwktad peak of sows almwe 100 %K y wAWWLV WeRICAN Ductile Iron Fastite Joint Pipe Allowable Joint Deflection rY X Table No.-3-4 atze Nominel Uj%N Maimwn AWWwvnwWW Deflw:Yon K X OKW per Ungth In: COMMden ANWO 8 20 21 5` 21 j• 8 20 21 5. 0 20 21 5. 12 20 21 14 20 21 5, 16 20 21 S. 18 20 21 S. 20 20 21 51 4 20 21 30 1 20 21 tl• 38 20 17 4- 42 20 12 39 48 20 12 30 60 20 12 3• 12 3, e slnor ebaemtlt, tht 10'rnb iheli0 be i6fU tglad wRh tlp ppe muoruby K lV Io+t Yeelll- W t* Owe ma be dWWOWd w to the ma*rwn shown m". aim. d m,,= oo bUW on MW" TFbot Wow Special Fastite Deflection Bells SPeclal Fastift bells are available which allow greater maximum joint deflection as follows: Table No. 3-5 x vP422bL n 21 S• 48 17 4• 4 17 4. 60 17 4• 7 , Osad tfahnca u Wood on 204oct knplha 4( AMERICAN Fast -Grips Gasket Disassembly instructions Fast -Grip gasket joints may normally be disassembled if required. Disassembly kits, consisting of a steel shim holder and Special high strength steel disassembly shims, are available from AMERICAN for this purpose. For easier disassembly of a joint which has been subjected to separat- ing thrust or movement, first push the spigot back into the. rear of the socket -to unwedge" the'teeth. Using gloves to protect hands from sharp edges, insert a shim fully into the groove In the shim holder. Starting at the bottom of the joint, carefully drive the dis- assembly shim past the gasket between the outside of the spigot and- the gasket by striking the holder Remove the holder from the shim, progressively place other shims in manner all around the joint, and this Shims should be in. contact with one another to insure all teeth are disengaged from the spigot. Overlapping of some shims may be required to dislodge all teeth. After all shims are in Place, pull or jack the spigot out of the socket. Very tight joints may have to be separated by cutting pipe. The reuse of Fast -Grip gaskets after disassembly Is not advisers. Joint Extension After'lnstallation The Fast -Grip gasket locking mecha- nism is activated by rel- ative movement be- tween the spigot and socket. The joint thus allows for movement, joint take-up, and sub- stantial flexibility after installation. -Joints may --be extended -after assembly'to minimize Joint take-up in test or service and for further assurance of correct joint locking. This may be accom- plished by pulling or jacking the spigot away from the socket until firm resistance is encountered. This will not prevent prop- er joint deflection. In most underground installation, in- cluding most restrained bend locations, joint take-up is advantageous in that in- creased thrust resisting soil forces are gen- erated. Also, expansion and contraction due to temperature variations may be ac- commodated without excessive stress in the pipe members. The amount of joint take-up or line movement In buried re- strained pipelines is substantially limited by the surrounding soil. Therefore, system security and safety is maximized by filling and testing restrained sections of pipelines after backfilling. In any application where axial move- ment may be undesirable, such as certain bridge crossings, certain other exposed piping applications, or certain connections of restrained pipe sections at angles to rigid piping, special provisions may be' necessary to control unacceptable pipeline movement. Depending on job conditions and restrained pipe length, cumulative joint take-up can be substantial, particu- lady in exposed piping applications. t AMERICAN Fast -Grip® Gasket Assembly Instructions --Continued set. Any abnormal joint assembly loads or behavior, such as unexplained exposure of the assembly stripe outside the bell, may indicate Improper cleaning, gasket Insertion, spigot placement, or lubrication. In such cases, it may be advisable to feel for correct gasket positioning by passing a thin feeler gage between the bell and spigot all around the assembled joint. Any joint with apparent problems shquld be disassembled and corrected. (See Disassembly Instructions.) Field -Cut Pipe When pipe are cut in the field, the cut end must be properly prepared prior to assembly into a Fast -Grip gasketed socket. Using a portable grinder, place an approximately 'W to X" long smooth as- sembly chamfer or bevel on the outside end of the pipe. This bevel should make an angle of 30-45' with the -axis of the-- - r- pipe. Care should be taken to insure that all corners are rounded and no sharp { edges remain that might damage or dis- lodge the gasket. Allowable Joint Deflection for 4"-1 V Fastitet Ductile Iron Pipe with Fast -Grip Gaskets size Nominel LwAVOngth Maximum Romnmended Deflection x Y Offset per 20' Length (in.) Deflection Mille 4 20 21 oji.5' 6 20 21 5' a 20 21 5' 10 4 20 21 5' 12 20 21 5' 1d 20 17 4' 16 20 12 3' t Allowable deftw0on for Rex Ahg jokes with Fast -Grp gaskets is the creme as above to Fastlta OhrA AMERICAN when using Fast -Grip g&*m in Lak-Rhg bells. Assembly of Fittings Pipe and fittings joints can be easily assembled with current tools and methods used for many years In the assembly of Fastite joints. A line of "assembly yokes" and associated rigging are available which are particularly well suited for otherwise cumbersome -to -assemble fitting configu- rations (99° bends, etc.) fast -Grip gasketed joints .requiring a particular orientation (such as with bends) should be assembled in the intended ser- vice position. In some, instances this may be accomplished easier by first assembling the bend on.a pipe above the trench. The Jointed bend and spigot may then be low- ered (orienting as required), and assembled into place. Relative rotation of joint members to one another after assembly Is not recommended as it could cause damage or leakage. See Push -On Fittings Assembly Instructions in Section 4. Accewrles Blue Brute Is backed up by all the Items It takes for smooth installation of water pipe. Direct tees can be made with proper tapping tools. (See detailed Instructions on tapping In the "Blue Brute Installation Guide", TR-7041i) Cast Iron O.D. Available in 4", 6", B", 10" and 12" alZes, this pipe can be Connected directly into Cast and ductile Iron fittings without adaptors or complicated procedures. Short form specification scope This specification designates general requirements for unplasticized polyvinyl Chloride (PVC) plastic Class water pipe with Integral bell and spigot Joints for the conveyance of water and other fluids. Materials Pipe shall meet the requirements of AWWA 0800, 'Polyvinyl Chloride (PVC) Water Distribution". AU Class 1 DO pipe shall meet the requirements of DR 25, Class 150 pipe shall meet the requirements of DR 18 and Class 2D0 the requirements of DR 14. Pipe e All pipe shall be suitable for use as pressure conduit. Provisions must be made for expansion and contraction at each Joint with an elastomeric ring. The bell shall consist of an integral wall section with a factory installed, solid cross section elas(omeric ring which meets the requirements of ASTM F-477. The bell section shall be designed to be at least as hydrostatically strong as the pipe well and meet the requirements of AWWA C800. Sizes and dimensions shall be as shown in this specification. Joint design meets qualification requirements of ASTM F3138. Hydro Testing Each pipe shall be tested to four times the pressure class of the pipe for a minimum of 5 seconds. The integral bell shall be tested with the pipe. Standard Laying Lengths Standard laying lengths shall be 20 feet (t 1 ") for all sizes. Pipe stiffness The pipe stiffness using *Flay for PVC class water pipe Is contained In the table below: Class DR — Flay (psi) 150 18 354 200 14- 815 Quick burst test Randomly selected samples tested in accordance with ASTM D 1689 shall withstand, without failure, pressures listed below when applied In 60-70 seconds. Minimum burst Class pressure at 73'F (pal) 100 535 160 765 200 gas Drop Impact test Pipe shall withstand without failure at 73"F, an Impact of a falling missile, Tup C. at the following levels. (Per ASTM D 2444), Pipe Impact size_ fin.) ft./lbs.) 4 100 B 100 13 10D 10 120 12 - -- -- 120 There shall be no visible evidence of shattering or splitting when the energy is Imposed. J-rt luanufacturing 5 m': Flow characteristics and dimensions Flow chart Class 100-- Velocity Head loss Velocity Head lose Velocity Head loss Velocity Head loss Velocity Head loss ft./sec VIOC' ft/sec. sl/1001 ft./sec psili001 k./secPSI/100, ft./sec. psi/100, isla./ Pipe size inj min. 4 4.391.D. 6 6.301.0. 8 8.281.D. 10 10.161.D. 12 12.081.D. 100 2.1 00.10 200 4.24 M57 2.05 0.10 300 6.36• 121 3.07 0.21 400 8.47 2.07 4.10 0.35 2.39 0.09 600 5.12 0.53 2.98 0.14 600 8.15 0.76 3.67 0.20 2.38 0.07 700,. 7.17 0.99 4.17 0.27 2.77 0.10 800 8.20 1.27 4.76 0.34 3.17 0.13 2.24 0.06 900 9.22 1.58 5.36 0.42 3.56 0.16 2.52 0.07 11000 6.90 0.61 3.96 0.19 2.80 0.08 11500 5.93 1.09 5.94 0.40 4.20 0.17 2,000 7.92 0.69 5.60 0.28 2,500 9.90 1.04 7.00 0.45 31000 8.40 0.62 3,500 9.80 0.03 class i W1D 8 Gals./ Pipe else p4 min. 4 4.231.D. 8 6.09I.D. 8 7.981.0. 10 9.791.D. 12 11.851.0. 100 2.28 CIA 9 200 4.57 0.69 2.20 0.12 30D 6.85 1.46 3.30 0.25 400 9.13 Z48 4.41 0.42 2.57 0.11 600 6.51 0.04 3.21 0.17 2.13 0.06 800 5.61 Mao 3.65 024 2.68 a09 70D 7.71 1.18 4.49 0.32 2.98 0.12 2.11 0.06 800 8.81 1.62 6.13 0.41 3.41 0.15 Z41 0.06 900 8.91 1.89 5.77 0.51 3.84 0.19 2.71 0.08 11000 6.41 0.61 4.20 0.23 3.01 0.10 1,500 0.62 1.30 6.39 0.48 4.51 0.21 2.000 8.62 0.82 6.02 0.36 2,500 7.52 0.63 3,_000 9.03 i 0.74 Mih. 4 4.071.D. 6 5.861.D. 8 7.681.D. 10 9.421.0. 12 11.201.D. 0 , 2.47 0.23 200 4.93 0.83 Z38 0.14 300 7.40 1.76 3.67 0.30 2.08 0.08 400 9.86 2.99 4.76 0.51 2.77 0.14 500 5.95 0.77 3.46 0.21 2.30 0.08 600 7.14 1 W 4.18 0.29 2.76 0.11 700 0.33 1.43 , 4.86 0.38 3.22 0.14 2.28 0.06 800 9.52 1.83 6.54 0.49 3.68 0.18 2.60 0.08 1,000 6.93 0.74 4.60 0.28 3.26 0.12 1.200 5.53 0.39 3.91 0.17 1.400 6.45 0.52 4.66 0.22 1,600 7.37 0.67 5.21 0.28 2,000 9.21 1.01 6.61 0.43 2.500 8.14 0.66 3,000 9.77 0.92 Ca.nw"t of now a C - lad Image • on/ wulism . 17CITY 01.d rVCC;M Mtq oh Wad 90 spwWl Mdde dyw.fu , WhiCh IC CViNde dolnefar mmus Iw16f (111Ci %eu T Inanj. 3 Dimensions (ave sas Class 100 (DR 25)• Pipe Outside Nom. Inside T(min.) E Approx. Wt. s[a* (in.), die. (in.) ilia. (in.)'* thick. (in.) dim. (In.) De Ibs•/tt. 4 4.80 4.39 192 4.75 6.4 19 8 6.90 8.30 278 ' 5.50 6.0 3.9 8 9.05 8.28 352 8.25 11.4 6.7 10 11.10 10.16 A" 7.00 13.8 10.1 12 13.20 1 i08 528 - 7.80 18.9 14.4 ... ... - -- 8 6.90 6.09 383 5.50 9.0 5.3 8 9.05 7.88 503 6.25 11.6 9.2 10 11.10 9.79 817 7.00 14.1 13.9 12 13.20 11.65 T33 7.80 16.7 19.T e 6.90 6.88 .493 5.50 9.4 6.7 8 0.06 7.58 .646 5.25 12.1 11.6 10 11.10 9.42 .793 7.00 .14.3 17.8 12 13.20 11.20 .943 7.80 16.9 25.1 OF OwwPowlw Wive Is We eWgid..lMn.l.d1rl0.d by tM iNNnwm wW1 trocM ew T PftJ. M.M,n.l M.ide demur s.uals th..uuW. ftrP War minus We* IMakn.q T In*M V specifications Series 1390 Uni-Flange Block Buster Restraint Device for PVC Pipe Bell Joints U.S. Patent Number 4336959 e Uni-Flange Block Buster Series 1390 offers fast, economical, guaranteed restraint of PVC Pipe bell and spigot joints In new or existing installations in any soil condition. The Series 1390 eliminates the need for concreie thrust blocks and offers an alternative to 'factory restrained Joint- metallic pipes. The Series 1390 consists of two Series 1300 split restraint devices. One is installed on the pipe spigot and the other behind the pipe bell. The two are connected to each other with special T Bolts or double ended rods (provlded). Advantages Provides restraint for new, or existing, in -ground piping systems 3W contact and support of the pipe wall Machined to exact tolerances Pad to Pad' feature... cannot be overtightened Visual Safety Feature... easy to verify correct installation Rated at full rate pressure of any class of PVC Pipe, minimum 2:1 safety factor Meets Uni-B-13-94 Two 11rd-Flango Block Buster Swiss 1300 rtestreint devloes - 9, - 24' Sizes: Ductile Iron per ASTM ASX Grade e5.4lf-12 . ASTM Am Svupwrsl steel Side clamping Bolts and Nuts Threaded Nods - Hlph strength, low alloy steel ANSI / AW WA CIIVA21.tt. Suggested Specification 2" - 12" Series 1390 Installed 14"-W, Series 1390 Installed Restraint Devices for bell and spigot joints of PVC Pipe shall consist of split restraint rings, one installed on the spigot, connected to one installed on the pipe barrel behind the bell. The restraint devices shall incorporate a series of machined serrations (not "as cast') on the inside diameter to provide positive restraint, exact tit, 360` contact and support of the pipe wall. Restraint Devices shall be of ductile iron, ASTM A536, Grade 65.45.12 and connecting boltsshallbeofhighstrength, low alloy material In accordance with ANSI /AWWA C111/A21.11. All Restraint Devices shall have a water working pressure rating equivalent to the full rated pressure of the PVC Pipe they are installed on, with a minimum 2:1 safety factor In any nominal pipe size. In addition, they shall meet or exceed the requirements of Uni-B-13-94, Recommended Performance Specification For Joint Restraint wiceo For Use With Polyvinyl Chloride (PVC) Pipe. Notarized certification from the manufacturer of the etraint device shall be provided with submittals. Restraint Devices for bell and spigot joints of PVC pipe shall beUni-Flange Block Buster 1390 or approved equal. 10 Unl-Flange® Block Buster Series 1390 Pipe Restraint Restraint Device for PVC Pipe Bell Joints Restrainer Restraining B iA Serratiwls 2" -12" Sizes Restrainer Restrainer 4- C Restraining R d T7A B L-.. - Tj I1 r-- 1 I J 1 1 r , q SerreUona 14" - 3611 Sizes NWL Alm. PVC S7.p. PVC:PtFtMRMPO.P" 6iorr pli U.11... A 1-1/8' B APPrl K 6.1/4' C AAwr: t0 tRAe7grls p /Roos CUWM Batu AM1tNOX. Wr 8.9 eap: 2 1 5/8' x 12' o. N' 4 6/8' x 3-1 ' 20 2.375 UFR1390-3-2 WA 3' 3,500 UFR139"-3 WA 1-1/8" - 7-11/16' 10 2 5/8' x 12' 4 5/8" x 3-112' 10.4 4' 4.500 UFR13 4.00 UFA1390." '' 1.1/8' 9.1/8• 12 2 3/4' x 17' 4 518' x 3-1/2" 13.8 41' 8.625 UFA130D,S-8 8.90 UfRf 90•C 1-1 - 11-1/8' 13 2 3/4" x 17" 4 ri! ' x 1 17.0 a" 8.625 UFR1390-" 9.05 UFR1390-" 1-1/4• 13-7/8' 15 2 3/4' x 17-' 4 3/4' x 4' 272 10' 10,750 URR1390-6.10 11.10 UPR/390-C•1 1 • 1 1 4 4" x 24" 4 1 7/6' x s" 48.4 12' 12.750 UPR S•1Z 13.20 J-01011390-C-12 1-318' 19-1/1• 18 4 3/4" x 24• 4 x 6' 49.0 14' 14.000 UFR1390.6-14 15.30 1 UPR1390-G14 4• 72• 24 6 3/4• x 00" 8 7/8' x 7' 110.0 19' 16.000 UPR13904.16 17.401 UFR13 8 4" 24.2' 28 8 314' x 30' 8 7 7' 120.0 19' 1G.9A UFR1390-6-10 19-50 UFR1300-C-18 8• 26.5• 28 8 3/4- x 30" 8 1' x T 130.0 27 20.000 I UPR13904-20 21.60 UFR1390•C•20 S. 28.81 28 8 314• x 30" 8 1-1/g" x 9• M.0 24• 1 24.000 1 UPR13 I 25.00 UFR1390-C-24 5' 32 8" 28 2 W4' x 36" 8 1-118' x 8" 420.0 30' 30.000 UFR1390.640 32.00 UFR1390-C-30 10' 40.9' 38 14 1' x 4O' I is 1.1/8' x 1 • 547.0 38' 36.000 UFR1390-&36 30.30 1 UFRI3904!!.367.2' j 38 1 14 I 1' x 40• 18 x 1 7 Uto; I% • lore Items are Ivor-nelurr+amo Installation Instructions 2"- 12" - - 1. V 2. 1. As6errlbie spigot pipe w+d to bell, L Assemble Serie31390 cramping ringe 3. Ir sad threaded rods and nuts as usurp standard prooeduro. onto spigot pips And Pet behind boll and as shown and tighter) ruts behind restrainers. shown ( use restraining rods as a guide to Do not ovemighlsn ruining nift position restrainers) and tighten bolts and nuts to recon mended torques 1. ASBGWM pipe bell 2 As6omble one metrainer on spigot end 3. Connect the tNv restrainers using of plpa, and one behind pipe bell. Use rode provided. Place a washer behind rosWJnhg rod as guide to position re6tralner "Gars.- Tighten all nuts. Do restrainers. Tighten all damping bolls to not over -tighten ruining nuts. Note for 14- through 36" 1390 torque roalrnmendGd on restrainer label. These products require a washer behind the restrainer Bar. These are provided. Stated torque values are the minimurn requirement. U-11 Apply lorque to each side, ensuring the gaps between the peas remain even. UL) SOLED TYPE;UF 600 VOLT IRRIGATION CABLE SPECIFICATIONS: UL TYPE OF 600 Volt Uuderground Feeder Cable per UL 493 14 AWG • 10 AWG has a 60 mil PVC wall 8 AWG has a 75 mil PVC wall 18 & 16 AWG has a 45 mil PVC wall AWG WGT/MFT PUT=UPS 18 Solid • 13 4 x 500 Ft. 16 Solid ' It ' 4 x 500 Ft. j 14 Solid 28 4 x 500 Ft. 12 Solid. 37 4 x 500 Ft. 10 Solid 51 2 x 500 Ft. 8 Solid 76 1 x 500 Ft. Or on 2,500 Ft. reels. There is no UL listing for this product. We manufacture it with the same compounds and standards as the UL to assure product quality and performance. 13 AWG MULTI -CONDUCTOR TYPE OF IRRIGATION CABLE J SPP ICA'rrONS: TYPE UP 300 VOLT IRRIGAMON COMMOL CABIX AWG WGT/MFT. LIST/MFT. PUT -UPS 18 -'2 OF 18 4 x 500 Ft. 18 - •3 OF 25 4 x 500 Ft. IS- 4 UP 35 4 x 500 Ft. 18 -' S U$ 42 or 18 - . 6 UP 50 18 - . 7 OF 59 4 x 250 Ft. All 1 H AWG soft drawn bare copper IS---8 UP 68 PVC insulation Is- 9 OF 76 Heavy duty 30 mil PVC jacket 18 -.10 UP 84 Rip cord for easy jacket peel back 18. -12 OF 97 18 -43 UP. 104 2 x 500 Ft: - or 4 x 250 Ft Or on 3;500 Ft. reels. 3 MVG GREEN POOL GROUND No. Q1 Put Lbs. AWG Cord. Ups lY M _ 8 1 500 Ft. 66 - 2500 Ft. SPEr're•rtnt te. Wood Reels 8 AWG Soft Drawn Copper with 45 Mil UL Listed PVC Compound i SPECIFICATic Ns• AWG WGT/PUT•UPS _ 14 Solid 12 Solid 25 LB. CALL 10 solid >~ox 8 Solid SPOOLS PRICES w \ -..I A. MW0 e d do a01i 10< K i11 darad0 a o d -- 6 w o 1 e ds. iZ rdo above tM oft reef The ao6010" bwl a6al ie 4e 1*9 "MOOMW bdoerQdpe 11e detoetablo r r 7 b' smor ar odve lowoo 1o3 igoi ieo m S WI o p C b= ILas !m--U-aftrwoZs ieotic yis wid 1C Data add adk aft ,omb fr d"brdAL Ted at neorsood plaple4 aw eaa ab eee be To ddo bk rdat vim vM d Baer s u w f (,0005`i idii R oev pb1M s Ls o a p,000 gj 8. All phems Ad be pwmi- - - holbw eeas idewfi eM or twmlikmaae!a 6eptabptds **o dtbsPitblrar. ltlo Was dw eat s e Maimmig ADgmft ddo:IIAr no and ft p+aioCli I Sin o"l0abstMsaiwiwibDDave. 'las dWN be inn" W& dU o sparIVhr dw ae31q s o& i aeiapabN hod M Tis 76pot Aiia3as eae w PAW" UM be dw ad ab wo° edc oiw o l °p° dn aeec es a akuaAin d Y ASIU Into 7.D t {pasbaq i AS' t Diii 1I p C mam boffn. R4 IL41ir[DQs7i p= +mm bdft eel e oatrd iod a1a aemeoioa IP= LDPE stiara bet Lpm ra d mcmk =wowt 7ib.++d ds Feiel whit d atoed dind/ a c i ed ago oo iridr tls 0` ape aft eodediabove 1Id0 spa+6od 1RM RA M UE ORM PURPLE FMOUSON UNDERGROUNM MM 601 7tMp Road O fando Flodds 328p1 407) MD-7473 FEATURES/BENEFITS AME1tICAN FLOW CONTROL SAMPLE SPECIFICATIONS SERIES 2500 RESILIENT WEDGE VALVE FEATURES/BENEFITS The Series 2500 Ductile Iron 230 p.s.l. Resilient Wedge Gate Valve is designed for use In potable water, sewage, fire protection systems as well as Irrigation and backfiow control systems. DuctBe Iron Construction The dub111e Iron body, bonnet and wedge provides strength and a pressure rating that for exceeds the requirements of AWWA C509. Strength more than doubles that provided by cast lion designs and the pressure rating Is 250 p.e.i. All this strength and higher pressure rating Is provided in a compact, lightweight, and easy to handle valve. Fusion Bonded Epoxy he Series 2=1 valve Is fully epoxy coated both on the interior as well as the exterior. The fusion bonded coating Is •ippllod pilot to assembly so that even the bolt holes and body -to -bonnet flange surfaces ore fully epoxy tooted. Triple 0-ring Stem Seals The Volvo features triple 0-ring stem seals. Two 0-rings are located above and one O-ring Is located below the thrust color. The lower two O-rings provide a petmonontly sealed lubrication chornber, The beneih being that the valve will be easy to operate over a long period - of lute. The upper 0-ring assures that sand. dirt or gilt Cannot enter the valve to Cause damage to the lower 0-rings, This Is especially Important for burled and sewage service applications. Thrust Washers Two thrust washers are used. One j The Sodas 25M Ductile Iron Resltterlt Wedge Gate Valvehasthesestandardfeatures: Fusion Bonded Epoxy Coating • 250 p.s.l. Pressure Rating Complies with ANSI/AWWA 060 Rubber Encapsulated Wedge 2504 Raised Face Flanges Triple 0-ring Stem SealsAvailable Ductile Iron Body, Bonnet and Wedge, Operating Nut VL-PM in Allowable Configurations SAMPLE SPECS Volvos shop be resillent wedge tyoe. Volvo body, bonnet and wedge ahoy be constructed of ductile iron. The exterior of the ductile iron wedge shall be encapsu- lated with nitrile ruober, The wedge shall be symmetrical and seal equally well with flow In either direction, There shah be no exp03ed metal seoms. edges or screws within the waterway. Tne stem shall be bronco in full comphonce with Section 4.7 of AWWA C509. Wrench nut shah be constructea Smoolh (No Pocket) Waterway 100% Bottle Tight Closure Of ductlle Iron. Wrench nut shall have four Hats of stern connection to assure even distribution of operating nput torque to the stem. AN body -to -bonnet and bonnet - to -cover seals shall be O-rings. Flat gaskets shall not be allowed. Stem shah be ssla!ed oy three O-rings. The too two 0-rings shall be raplacooble wltn valve fully open and while subject to fub rated working pressurt. O-M93 set in a cortridge shah not be allowed. Valve shall hove thrust wo$hers located above and below thrust Is IOCated above and one located below the thrust color. These thrust washers assure easy operation of all times. No Flat Gaskets The body -to -bonnet and bonnet -to -bonnet cover seals are pressure energized O-rings. This eliminotas the need for excessive bolt loading which Is requited by designs that use flat gaskets. The O-rings are reusable which ellminotes-down•tlme during any - needed repair. The $odes 2500 Rethlont Wedge Gate Volvo Is furnished In configurations that ore listed by Underwriters Loboratorles. Inc. and approved by Factory Mutual Research Corp. count to assure easy operation of the valve. All internal and external ferrous surfaces of the valve bode and bonnet sho!I have a fustor bonded epoxy Coating, complying with AN51/AWWA C550, opplled electron• taticolly prior to assembly. 2.50# raised face flange$ snol, 09 provided when required. Valves shall be equal to American Flow Controls Series 2500 Ductile Iron Resiliant Wedge Gate Volvo. 4 SECTIONAL DRAWINGS/DIMENSIONS AMERICAN FLOW CONTROL SERIES 2500 RESILIENT WEDGE VALVE BUIMMAL DATA VALVE SIZE 1 2 1 2-1 /Z ' 3 4 a 8. 10 12 9UANTITY NRS OS&Y DIRECTION OF 0PENING CCW CW END CONNECTION f U — INDICATOR POST FLANGE YE5 NO OTHER REQUIREMENTS e C MECHANICAL JOINT (MJ) TYTON* (M 0 CLASS 250 RAISED FACE PVC THREADED (SCREW). OPTIONAL 04b CONNEC71ONS r DIMENSION VALVE SIZE 2' 2-1/2' 3- 4' 6- B' to, 12. End to End -1AJ x MJ 8-114 8-5/8 11 12 12-1/2 14-3/4 16-5/8 End to End -FLxFI 7 7-1/2 8 9 10-1/2 11-1/2 13 14 End to End - TY x TY 13-1 /2 16-7/8 18-1 /2 20-1 /2 22-3/a End to End - FL x MJ 10 11-1 /4 12 13-7/8 15-6/ 16 End to End - FL x TY 11-114 13-11 / 16 15 16-3/4 18-3/16 End to End - FL x MJ Topping 10-1 /8 11-1 /4 12-5/8 13-7/8 15-5/ 16 End to End - PVC x PVC 10-314 11-1 /8 11-3/8 End to Erd - Threaded 6-1/4 7-3/8 7-3/8 End to End - Class 250 Fla. -go 11-1/8 12 15-7/8 16-112 18 19-3/4 A 9-1/4 11-1/32 11-27/32 13-3/9 16-3/4 20-3/16 24-1/6 27-1/2 8 2-1/2 2-1/2 2-1/2 2-1/2 2-1/2 2-1/2 2-1/2 C I 4 5-7/32 5-112 6-5/8 5-5/8 D 1-1/8 1-114 1-7/16 1-5;8 1-718 2 E 3-3/4 4 4 4 5-7/32 5-1/2 F 2 NPT 2••1/2 NPT 3 NPT I Hondwheel Diameter _ 8 8 8 10 12 14 16 16 No. of Tuns to Open 11 11 13 13 19 26 32 38 1lnderwdters Laborotolles Listed chd FoWory Mutual Approved for Allowable Confl9umlions. 0i FEATUREWENEFUS AMERICAN FLOW CONTROL A SANUM SPEC OCATIONS 51/4" B-84-B FIRE HYDRANT FEATURES AMeWW Flow Control's Ametioa - Daring 5.84-8 hyvfant Incorporates over 80voon of experience In design, mo'rufactue and field wrperience.Ttlls meois dependable and efficient operation when needed. Introduoed In i 984, the 8.64.8 hydrant is rated at 200 p.s.l. arid Is seat tested at 400 p.sJ. This hydrant meets or exceeds all reriremw to of AWWA C502 for dry barrel hydants. the 8.84•B Hvdranl Is loaded with the features you expect from o.high quality fire hydrant. The all bronze not and drain ring assure that the B-84-B hydrorrt is easily repaired by Imo one Optional UL-fllA The 0-64-1 hydrant Is rated by Underw filers Laborolor" Inc., os meeting their storxiod tX 246, latest edition. The Factory Mutual Research Cotporation has approved the 8•B&B. Both Underwriters Laborat0rl6s and Factory Mutuol Research Corporatlon require trot we c=W- tently manufocture and test ou hydrants In full compliance with their stringent requirements. tour facittles are stb)W to periodic in,•pecttons to ass'e we are in compliance Wth their standores. The B-B&B hydrant has these standard features: pos"Wo compmaslon, fast • dlwd, lightweight, dls- • CentdhMally cost high closing drama - assembly wench - strength dudrle iron, lovwr Travel stop located In top • Easy 36V rotation of no=le barrel of i ydrard section • f Baled lubdcadon chanter Dronsftab once seating • 8- pYotlle Yon M.J. base BRNIFiTS j SWkV loaded MM-pail Drdm I There are two drain ports and four drain ouftfa as a standard featire on the 6.84-Y hydrant. The rod spring oswroc drains close after opproxi- motety three turns of ffw operating nut. This important safety teotue prevents wadvoA! that Con happen on 1 rydro rf designs that do not hose this hvolt fit feohue. SAMPLE SPECS Re hydrants shallrrwet or exceed AWN A C502. latest w4on. rued working pressure sholl be 200 p.s.i., tesipresaue shall be 400 p.s.i., and hyd a* shol Include the Wowh; we= design redo: fie main verve closure ahou be of the compression type. TrcMc feahxe to be designed for easy 36CP rotation of nozzle section cluing field In"afloon. sealed Lubdeonon Chamber Seals opwa ling threads from water and debris which greatly reduces rou- tne molntenonce. Top Travel Stop Hui Helps prevent stem buckihrg and domoge to brorua components which rnW occur It exco lve torque is appltedn the fuil open position. The rrdn voNe opertng shall not be less i'rcn 51/4' and be designed so that remavol of oil working parts con be occorrplished w4thout excowting. The bmmo seal steal be tt-,reoded into mat- Ing rmocls of Uronze. The arohng sys. tem or the hydrant shall be txonze and posillvely actMotod by thG r. taro oper• 00V * d Hyckort ;Mains shot cbse aomglet* otter nor n mare than three Axns of the operating mr. There 2 st•, or be a rninimun of (2) internal ports axi 141 droin port outlets to the exterior of the hydrant. Drain shutoff to be by direct compression closure. LOW hydrant borlel ahoy be mode of ceniritupoAy cast duciue lion. Fdotbn items not to excswl 3.0 RS.I. at I 1000 gpxm though 411V purper nozzle. hydrants shoe be 9WU I b Arra icon Flow Controls Amorican-purling 01iAMSMCAN. W/a" 5-84-8 FIRE HYDRANT DAMUM Dimensions . It M sim M u P R I'S T TO B151411 17 MEC"AMICAL JvIPIT VASE 81><o Y." IfM ay6b8 4M KM I" PM 4 4- 'A a• eu 2% 1 r 1 ou 6 - 9i FLAMM RAan eu 77 e-u M 71 t AN d wmw.N IA sOlhas @ "A/ also JR KR 6w" HR - 4 9i 3 l Ya A 9K TbM 41 W LX 1-00 Tyler/Union SAMPLE SPECIFICATIONS 3' THRU 240 MECHANICAL JOINT DUCTILE IRON FITTINGS shall be produced In accordance with all applicable terms and provisions of ANSI/AWWA CI53/A21.53 and ANSI/AWWA C111 /A21.11. NOTE: Finings are cement4ined and sed- cooled in accordance with ANSI/AWWA C104/A21.4; also available double cament lined or bare. See -list price sheet for details. MECHANICAL JOINT SSE -DUCTILE IRON CLASS 350 FITTINGS JOINT DIMENSIONS W INCHES Sm A Diu. B C Dia. D Dio, F Div. J Dio. K' Dio. K% Dio. L M S T X Diu. 3 316 2.50' 4.84 4.94" 4.06 - 6.19 7.62 7.69 58 62 39 33 4 4.80 2.50 5.92 6.02 4.90 7.50 9.06 9.12 60 75 39 34 T/s 6 6.90 2.50 0.02 8.12 7.00 9.50 11.06 11.12 63 88 43 36 Vs 8 9.05 230 10.17 10.27 9.15 11.75 12.31. 13.37 66 1.00 AS 38 10 11.10 2.50 12.22 12.34 11.20 14.00 13.62 15.62 70 1.00 47 A0 12 13.20 2.50 14.32 14A4 13.30 16.25 17.88 17.88 73 1.00 49 A2 7/s 14 15.30 3.50 16.40 16.54 15.44 18.75 20.31 20.25 79 1.25 56 47 II/s 16 17AC 3.50 18.50 18A4 17.54 21.00 22.56 2ZSO 85 1.31 57 50 18 19.50 3.50 20.60 20.74 19.64 2125 24.83 24.75 VW 1.38 68 54 20 21.60 3.50 22.70 2244 21.74 25.50 27.08 27.08 1.02 1 A4 69 57 r/s2425.80 3.50 26.90 27.04 25.94 30.00 31-W 31.50 1.02 1.56 75 61 1/4 BENDS T•14_Y Sko No. Yix3 4 x3% 4 3/a31/Z 6 s/,X3'/s 6 x3'/s 8 x3'/s B s/4x4 10 s/4x4 12 3/.K4 12 s/40 14 3/,K4'/s 16 90• Binds 1/4) 4S° sends (1/8) 221/. Bends (1/161 111/4' (1/32) Sise T Dlmondoes A R Weight Dimensions A R Weight Dimensions A R Weight Dimensions 3 34 4.5 4.0 20 2.00 3.62 16 1.50 4.98 15 A 1.25 R 7.62 Weight 154355.0 4.5 26 2.47 4.81 22 1.82 6.66 21 1.55 10.70 206 8 37 6.5 7.5 6.0 7.0 48 3.50 7.25 38 2.59 10.50 37 1.81 13.26 33 10 39 41 9.5 9.0 68 107 4.00 5.01 0.44 10.88 59 81 2.85 11.90 51 2.06 15.60 48 12 A3 10.5 10.0 141 5.98 13.25 111 3.35 3.86 14.35 16.90 67 80 2.32 2.56 18.36 20.90 6) 7914 16 51 12.0 11.5 220 5.50 12.06 164 3.93 17.25 148 2.59 21.25 1313213.0 12.5 264 5.98 13.25 202 3.98 17.50 179 2.62 21.0 1598 20 69 15.5 14.0 410 7.50 14.50 289 7.50 30.19 292 7.50 60.94 287 24 60 62 17.0 20.0 15.5 18.5 305 695 0.00 9.00 16.88 18.12 348 8.50 35.19 364 8.50 71.07 346 475 9.00 37.69 460 9.00 76.) 2 457. 51-97 Tyler PipeN'il'11011 Mvision a I%O. Box 2027 Tyier, Texas 75710 9 1903) 882.5311 Union Fovn&y Company 0 P.O. Ban 30 0 Anniston, Alaboma 36202 1205) 236.760' 3 Sample Specifications Mechanical joint restraint sbaii be incorporated into the design of the follower gland. The restraint mechanism sball consist of a plurality of itldivldually-actuatcd gripping surfaces to maximize restraint capability. Glands shsil be manufactured of ductile iron conforming to A$rM A536.80. The gland $ball be such that it can replace the standardized mtchaaica1 joint gland and can be used with the standardised aucbaoiai joint bell conforming to AN31/AWWA C1II/A21.11 and ANSWAWWA C133/A21.53 of latest version. Twist off outs, slued same as teehead bolts, shall be used to insure proper actuating of restrainingdevices. Mw restrait"ll glands shall have a pressure rating equal to that of the pipe ua whieb it Is used_ The restsa mite gland& ball have been tested to AMU P1674-96, be listed by Underwriters Laboratories, and be approved by pactory Mutual. The restraint shall be the i18AA iron Sate Z000pV of approved equaL Patent Whim -don " The products presented hash are covered by one or more of the following patents; 4627774,4896903"71175. Listings and Approvals Sizes 4' through 12' are listed by Underwriters ' Laboratories, Inc., category HjKF "Flttings, Retainer ippc," with a deflection angle of five degrees when used on UL- listed, Claps 150 PVC pressure pipe and a UL-listed appurtenance. The llsting number is EX2836. Sizes 4' ihrough_ 12" are approved by Factory MuWQ for use on approved DRIB PVC pipe; and sizes 4" through 10" are approved for use on DR14 PVC pipe and mecbanieal joint appurtenances. The.2000PV res:ralat exceeds all requirements of AM[ P2674.96. Special Notes EBAA.SeaITM gaskt:ts are provided with the 501 and 36" 2000PV restraints to facilitate easier assembly of the mtchanlcal joint, and are required on the above refereaaed sizes to obtaln the pressure ruiags and safetyfaaors shown. --! - For test pressures above the rated pressures, consult the engineering dcparbaent of BBAA Iron, Inc. for reeoaa- mendattOAs. Dimensional Data nV Ping 00 SERIES C D F J M X rIP on PFWWNM Mpg MO ` vimOFFr&s 2003PV 4.84 92 1 86 9 80 5.19 0.50 3A 4 4 9.8 5.6 7.82 3 7.02004PV EL02 1.66 In 4.00 7.p0 7.50 9.80 ' 0.50 0.50 7/8 7/8 4 4 10.3 9.5 9.13 4 8.8 r 4A 43.3 t'V 10.17 1.88 9.15 11.76 0.62 7/8 0 8 6 8 13.0 12.1 11.13 6 12.1 8.9 g,83 2wwiN IZ22 2.10 1120 14Ao 0,92 7/6 8 8 14.5 17.0 13.8 13.38 8 18.3 9.05 6.83 - 2012PV. 14.32 2.10 13.30 1825 0.76 7/6 8 8 19.0 16.0 15.63 10 26.0 11.1 10.76 2014PV 2018PY 18.40 18.60 2 25 2 25 16.49 18.76 0.88 7/6 10 10 21.7 16.1 20.9 1788 2048 12 14 31.4 47.6 132 131 12.75 2018PY 20.60. 226 17.58 19.68 21.00 23Zg 0.88 1.13 7/8 7/8 12 12 12 12 23.8 23.0 22.03 18 32.0 17.4 2MGFV 22.70 2.28 21.79 25.50 1.25 7/a 14 14 25.9 28.0 25.1 WAS 18 61.8 19A 2024" 2030PV 28.90 8329 2.73 2.70 25.99 30.00 1.42 7/9 16 18 32.3 27.2 31.5 27.13 31.53 20 24 79.9 92.9 21A 25A 20MFV 39M 2.70 32.22 38.52 36.88 43.76 1M 1.50 II/8 11/8 20 24 20 38.6 37.7 39.12 30 128.5 32.0 24 • 44.0 44.0 40.00 38 161.3 38.3 A- 8F.CTION A -A 1CG7 sun 8-9 EBAA*IRON 7M s Your connection to the futute"rar P.O. BOX 857 EASn AND, TEXAS 76448' USA 234 / 6* 1731 $00 / 433 1716 FAX 254 / 629 8931 amalLebsaacmdand.net visit our Website:www.ebia.eom sans. it awa ' Mechanical Joint Restraint For Ductile Iron Pipe 8AMPLE SPECIFICATION MwAvnkal pint ratraWt Ad be Wourporeted Into the darn of the Lower ould. Thu 1estruk" toad alsm shall sealisl of Indwidwlly Aatwted wvsidea vat b avwo their resistaroe w pull-out as pr ws Arse or twml form kleveae. The dwim oha be oapable of full mocha" a defftWo dump assembly and the flaar3sliw of the jest .hall be asaimalowd atur burial. Ths joilst nauvim rby and Its wesIgN components rha2 be made of `rude OD49.10 dua2e Iron cordarmIns to ASTM A53044. TMe wedsea shad be duoula Iron hat wasted to a retmimvm bwdmas of 70 sWs. 04ou taiwu of the Maud abd be etaob that It can be and with the wsdardlnd mactmird pint bdl modormb% to AmWkwWA G1111A31•t1 win ANWAWWA CUSfA210 of the lato t ravtsbrt Torgw >InWg twhtoff ruaA ahell be used to lnemn puopw astwUon of the mWaWbV wedsa. T%o mechar" Mm retrain shag be avallable In do ihm dwo4ls falyolstu Inoh slow. Thw shss have a rated workbrd psvatlslet of ISO Dd in Oka sklan Inch and w4or and ice prl In alaso elpltaen Inch 0t vu& fam"lphl ktoh. Tto dwloaa Ahab U Brad by Uudwwrlwav LabaatorW up d wou&h the tweaty-four Inch on and ADptoved by TadM Mental up t eaugh *o twelve boob %[ wt. Tbt mUvhn elutl be the sepia 1200 MEOAUMP ratatat as predso•d by UM kvm In. or approved equal. BRIEF SPECIFICATIONS, FOR 1100 SERIES XMINAL 146 a1a e11=11 1yta Ol Amu= ta t'oats teA 11m l RA= s>esstlAts 1103 a1 dw e 1104 7.2 300 e nee 13.0 vet e IN$ Is. S00 10 1110 ia.e 3e0 a IAIS 32.7 two As 1,14 ev.t 000 l0 113 156.1 360 to Ilie om 0 a0 no 74.e 200 34 Isu 13e.e 230 31 1130 so& 250 M 1136 2w.e 300 n 1142 610.2 aw 48 1144 713.0 aeo For loot prewura above the rated prvswtw shown mmuuh tlw ousbwerk deptrtman of ZMA bay Ism., for reoommertditbaa 26AA bed sashes are proVlded whb the so• Htloto 4e- 10GAwG MITIJAW. Ake previdad wish the dr and a• logo an elfin b%* T49kA. The d plot and bolls are prVrlded to fadkaw eadw, aseombly of do modes drat pat wd a w regW W ors ft abuts nfawioad slaw to obtatr tbt pasture mqp p Sold afew ho wwwo. s For Folems mbq Isle dWWw raa1 &M& plsw swnua th; chine for our dealp reconvoordatkna As of the M 9Fft ttomptaant are made of duath bva. The wedges, aw Wat treated to a haldno a rarsde of 1f0 to 470 NOW The product Is cased wkb the aamt uphakk meftr a wftd her the pipe and tkdW. Ike 1100 Wife IS ktwtdad for t on dmdb knows Floc The rwb%bm own be used m Vey bon pipe v Yu p4s Is sot Zero* ao rodad and is In atsasd aMdki n and had a witside diwesolx, that tau be accomoodaud For won bdorlottimw an the wo of the MIM41 G raelntnt on Fey woo An 1ek for Coruertaru' 3110asn number MI. . 1100 oerim anbeold toot the used on plain mass Rulads, v yw aawisr o the rood to bwtal Ita s 2200 actin in an wwwwwdoeal eannar lobw mwit M" loan pot rem olmadalima. U3MG6 AA"D APPROVALS 1"d119SRM A too N29ALVO Sam 1- Verosssh 24- are SMO by Vn&mwkm Laborate la, Im., atosory 1 81u "I'Wrrda, ldeWW Type,• with A ddLstioo sods of five dograe (a' thrtrlQt 32"1 toad Iwo and a half depves 11J• lhrousA LI"1.74r Wtind !lis nuebw Is CUM 21sw r through 1r ary Factory Mvasal approved A REAR VIEW FRONT VIEW M D 1 V Ise ' I DA2. :T C U SECTION A -A' } SECTION 0-8 I O.t2 i G) NUT ®SPACER SHOULDER 13OLT Q WEDGE 4C BERM C Is P i 1N I X I-X0.0ts wouG a M0. 0ss 11011re r as lreallr,e ete3e7tID K. step A4 ail 400 Me oer at, a 0 1.114 Noe rat 110/ iai 3AT 4.00 Ab O.rt a 4 1030 eto a.1A Rep tAt SAY TAR sic off 1 e olio am TUN it" 1941, ail e.10 63.7s I'm 4 0 14.46 34.10 Lair 1110 1A.i3 C11 ttio t•.ae Tao 6 e 1 ts40 1WAo WAS lau uas ail tat tau 13,; K a ' a 1e.10 1e.10 17.36 1114 1SAO ate 11A4 tan 1ae 4 t0 t0 110a4 was MAN Ills 11110 A.N 17a4 33.00 law I1 V Wo life U40 1104 sa40 ate 19.e4 31.2E 143 14 as is 34.TO UA0 a4ra the taro 1.1e st.r4 sumo t.at N H a.W WON aroo 40 a1441J1 le Is UA4 U44 Slia 1. i0 ss.1T seat s.tt 1V. N so 30.11' Sass w.11 Mss0NNy.fl si 1'1, a. a. a1A7 Q 17 41ao 4. te OAST tall tit 2N. 2t as AT410 soafAoase1.1e slat tie The Ames Backllow Preventer. Lighter, Shorter, Better Plowing Than Any Other Application ThekM 3000eaprobo thepotabb wa(arayftam byproventing beckflow from firs protoctlon systems the decks also ddecb leaks or unaudw. tied use of waterfrom fro protacflaon lines. Operation In the Incldence of minima! water flow, the valve cbppermmalm closed so that go water flows through the bypass loop. When major water Row la require, the water pressure will open the main valves to allow fug water Now. 0 Installation The 300dss should be insW10 with adequate dearameandaasyaccessb billy for maintenance and tasdng. fie 3000" may be lnatalled veMCWy or horizonl1eq Rafter to local codes for spacl/iclnstalisdon requiremanta Features Lowest documented haad loss ftre orros ve 800 fedes stainlaes flee! peed free) construction, 4ox shorlerend ro end dmanflonf torcorrp ct, Inexpensive InataUetion, Faaaollantrorretroftlnfbpitlorre. 50% ligbtarin welghy reduceslnswiWoon and handling coats wpyfarvtcabreln rre, rue special tools Pretestedcam-check(patentcd)'assemb/yforlongtevrr,n;llablNty,bwh dloss, ease of servicesbu ty. Single twaboltproovedstybcoverlorquickendessyoccem. OWyASSE toil approved assemblyror veRka/end honsontelopplicatlona WelnUTA. Had km equal to lane thanaingb detfctorchock valve, ' O National Approvais Approved by natloml appmvof agencief, *' kME%.S. FLUID CONTROL SYSTEMS Pat. is, 046,525 r t r/r'arvoarnwnaAtrw nd,a,11erowuaw.n.y y............... .....................»....... _ .... e.... _......_.» ......... i y+......_....... r uo eoe.......... ..»....................... » MOPM roe.,«wrRo.erY,sr.,ere..o,.n.nn I1 •.ry.» ....... ..d....................... y •. ...... e 10e MO t bIPR/IVY% eoo srw e'+rieAOtgiwlAlweerN iYpd 6el,Mn. iAr..Il..w... Specifications The dortble Choir detector assambry owisrata of two independently operating, spring lWad Om valves, two UL, FAI, OSY resident .vwgp pate valves, and bypass assembly. The bypass assembly consists of a meter (costs A. or gabu), a double check indvdr!g shut oB reives and regitrWOWcoda. Eechwn memshambeintwdyWded&ndprOWdaa positive dip tight d0su1e against MV#f$e Now. Com4hoO dudes a r"'(19R974V? 14A..5 Taninran Av:rrn Iq Pr) Rnw I .M7 Physical Characteristics Sizes - 2 , 3', 4 ; 6', 8 ; 10 , 12' Rated worklnp pressure-175psi Hydrostatic Pressure -350psi - -• - Tenn perature range - 3ZF -1 t WF Bodymaterlal - 3o0 series stainless sees! Flange dimension In accordance withAM" Class D Assembly shall beASSE 1048approved for vertical installotions, rorrar+ owes+raar rtrr,,.+roew.,.„a•. 10' OvWelepfMRowCMMeOferiNu or w w.nw w+l •• a d... t......... ........ ......... ... . ... ....... ...•................ BYO 000 AhrAMt6/ en YI00 WY lrwcwwauaRe. ca.+aawr,t•ya4oa,..a;rw.t•• ibr aaM/Gt AQ 51047ress steel cam a74 and spnng, rubber ,'aced disc and a replacea* seat The body shaNbe mpnufadured from 300 series stainless else( 100% tead! rme, through the wa!er Key, wiyf a single two -bolt grooved style accsas ccvdr Ab:pedal tools shall be regUmd torsenddng. OW&V check dvfvdor ahallbe3000m. Contect the factory formmllrc approves Wn/ Irltcrr,rl r -A Qri77R FdX R.'ZA stag-4C1w ..n' r. wn G M b a a U 7 d O k a a 0 CITY OF SANFORD, FLORIDA APPLICATION FOR BUILDING PERMIT PERMIT ADDRESS C_ nirelri n PERMIT NUMBER V /?IM Total Contract Price of Job (oS 7Xf. 00 Total Sq. Ft. Describe Work 41-7drrc/ 0v nd Fir a 11AA i,,/ Fran, P U. J. Type of Constructiort Flood Prone (YES) (NO) Number of Stories Number of Dwellings Zoning Occupancy: Residential Commercial Industrial LEGAL DESCRIPTION q t (please attach printout from Seminole County) TAX I.D. NUMBER H-2.6 -30-306-n7Lr:_0n61 7 //-in _In.3nr% i_nnn., i/-tft .Tn. OWNER L O 1n/c''S H oM a C,e n+'c'itJ Ztyc_ PHONE NUMBER ADDRESS PO }dX 1111 e,is% :-i,`eEi,A l f 2.9 61i6- ( 0&L CITY /yp,,rA )Ah 1krZOnlh r, ESTATE a L, ZIP %gLJ-G- Oa TITLE HOLDER (IF OTHER THAN OWNER) ADDRESS CITY STATE ZIP BONDING COMPANY ADDRESS CITYs- ARCHITECT L/PhA ADDRESS P.O. B i CITY U.v n ./ i STATE ZIP STATE f/- ZIP :? Z171 MORTGAGE LENDER ADDRESS CITY STATE ZIP lmi:L 4 CONTRACTOR o x 5L17_11 A/ lU, (/ ? Cuny. Se,ViLPS :r,, C, PHONE NUMBER ADDRESS P 0. ST. LICENSE NUMBER /354/trlo0a11491 CITY Le,agwond STATE / ZIP 32-7S2--1219 Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installation has commenced prior to the issuance of a permit and that all work will be performed to meet standards of all laws regulating construction in this jurisdiction. I understand that a separate permit must be secured for ELECTRICAL, PLUMBING, MECHANICAL, SIGNS, POOLS, ETC. OWNER'S AFFIDAVIT: I certify that all the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. A COPY OF THE RECORDED COPY OF THE NOTICE OF COMMENCEMENT WILL BE POSTED ON THE JOB SITE WITH PERMITS NO LATER THAN SEVEN (7) DAYS AFTER THE PERMIT HAS BEEN ISSUED. FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOU PAYING TWICE FOR THE IMPROVEMENTS TO YOUR PROPERTY. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT. NOTICE: In addition to the requirements of this permit, there may be additional restrictions applicable to this property that may be found in the public records of this county, and there may be additional permits required from other governmental entities such as water management districts, state agencies, or federal agencies. ACCEPTANCE OF PERMIT IS VERIFICATION THAT I WILL NOTIFY THE OWNER OF THE PROPERTY OF THE 'REQUIREMENTS OF FLORIDA LIEN LAW, FS713. irw*******************w*tr**w**************/*************w**w**rr***w********w****1*itlr* H ,y Z 07.0c 61 Z, O O a' t Signature of Owner/Agent & Date Signature of Contractor V& Date 0 V'< w 1< Z Type or Print Owner/Agent Name T e r Prin Coutr cto Name oz v 3 n n m L O O Signature of Notary b Date S' nature of•Notary b to Z Official Seal) (Official Seal) 025 FF jAceO ` 7°o tr " c a 3 0 z >• row G O N 0 ro N a Na Ode• Z a E• M aroo Application Approved BY: Date: q ' Z FEES: Building Radon Police Fire Open Space Road Impact Application PERMIT VALIDATION: CHECK CASH DATE BY ORIGINAL (BUILDING) YELLOW (CUSTOMER) PINK (COUNTY TAX OFFICE) GOLD (CO. ADMIN) THIS APPLICATION USED FOR WORK VALUED $2500.00 OR MORE CITY OF SANFORD FIRE DEPARTMENT FEES FOR SERVICES PHONE # 407-302-1091 * FAX #: 407-330-5677 DATE: 17 ' PERMIT #: BUSINESS NAME / PROJECT: Lo %&e,5 ADDRESS: 3 A PHONE NO.: 34-90-7 I FAX NO.: CONST. INSP. [ ] C / 0 INSP.:[ ] REINSPECTION [ ] PLANS REVIEW Y`u F. A. [ J F.S. [ J HOOD [ ] PAINT BOOTH [ ] BURN PERMIT [ TENT PERMIT TANK PERMIT [ ] OTHER TOTAL FEES: $ (PER UNIT SEE BELOW)- L•I COMMENTS: Address / Bldp,. # / Unit # Sguare Footage Fees per Bldg. / Unit 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11, 12. 13. 14. 15. 16. 17. 18. 19. 20. Fees must be paid to Sanford Building Department, 300 N. Park Ave., Sanford, FI. 32771 Phone # -407- 330-5656. Proof of Payment must be made to Fire Prevention division before any further services can take place. I certify that the above is true and correct and that I will comply with all applicable codes and ordinances of the City of Sanford, Florida. ZL l ./ Sanford Fire Prevention Division Applicant's Signature NNI V 1 Improving Home Improvement December 20, 2002 City of Sanford Dan Florian, Building Official P.O. Box 1788 Sanford, FL 32772-1788 Richard Goodman, Construction Manager Florida Construction Office 901 SW Martin Downs Blvd., Suite 311 Palm City, FL 34990 Phone: (561) 463-1461 Fax: (561) 463-1462 RE: Prepower Inspection Request for the Lowe's of Sanford, FL 3780 S. Orlando Drive/Sanford, FL 32773 To Whom It May Concern: REr,Fivr:n DEC 2 4 2002 This letter is written to request a prepower inspection for the address referenced above. Please be advised that such building will not be occupied until the Certificate of Occupancy has been released. Sincerely, 4RRICHARD eGOODMAN CONSTRUCTION MANAGER Cc: Mike Harless Howard Bayless (Marcobay Construction) John Shepard (SIS3) Jason James LOWE'S Home Improvement Warehouse - Improving Home ImprovementT" - www.lowes.com STATE OF FLORIDA COUNTY OF POLK The foregoing instrument was acknowledged before me this 6`h day of December 2002 by Richard Goodman who is personally known to me or who has produced as identification and who did or did not take an oath. ' Notary PublicP&j' Lida Notary Public, State of Florida My comm. exp. June 28. 2004 Comm, No, OC950448 Stamp / Sea] MICHAEL McGIBENY - #32 barricade request.doc it SANFORD FIRE DEPARTMENT m e m o r a n d u m To: Michael McGibeny, Fire Marshal From: Deputy Chief Ransom Date: October 30, 2002 Subject: traffic request Can you get with the appropriate agencies to see if we can have the slow down turn lane that is being constructed this weekend in front of fire station #32 barricaded off. We would need this barricaded to protect the fire truck and its personnel as they back into their unit into the station. It would need to remain there until this fire station is relocated to the new fire station on Airport Blvd. 12-22-1995 6:24PM FROM P. 1 t Permit No.: - U, ` Job Address: -3/ 8 O r CITY OF SANFORD PERMT APPLICATION S o tJ Date: WL-Ulk i.O, o D 2f u Permit Type; Suildlog. Electrical blechanical. _ Plumbing Fire AlarrWSPAWIT Description of Work: 1 N S T A L-C__. L.J I} ((, . $ 1 ' &-7-j S r 0 /L (--j E w t W r-a S T Olt it.0c-i c Te-..- r, LobJe/SrI1)b µc- tfnFfLedcme.,, r VA.tc-HotlSILf Additional'Iuformatioa for Electrical & Plumbing Permits Eleetrieal: —Addition/Alteration _Change of Service _Temporary Poic _Nrw AMP Scrvia (/ of AMPS ) Plumbing/Residential: Addition/Alteration New Construction (One Closet Plus Additional) Plumblag/Commercial: Number of Fixtures Number of Water & Sewer Drainage Lines Number of Gas Lines ram, Occupancy Type: Residential v**Commereial _ Industrial Total Sq Ftg: Vtlue of Work: S_ TTypeofConstruction: S ( Flood Zone: Number of Stories: Number of Dwelling Units: J Patoellto:..I1-7-0-3 0-3 00 -o 1 aH-o.0oo Attach-ProofofOwnership & LAprDlscrip ) 41__ Owner/Address/Phone: O W 5 K e 1-A F L Ci1JTrr(L- t= C_ p. 6 o 7c 1 (1 1 N o A-T 4 W 1 ILIL.F-5 q Contrnaor/Address/Phone: STEJ.) =C J CA w.5 , iVtC1P.) (_1 Lz j C: o g- P 3 o ( /V Ci (_ D L bLA M t L4 C, Z7 7 03 ` pate L'eense Number: F- S '- Q O O O q- 0 Contact Person: 12- Erg E c- O I Phone & Fax Nuinber(g .3 Z Z4 -_S_S7_q_6 PRFA 1c Title Holder (if other than Owner): . Address:. Bonding Company: Address: Mortgage Lender: Address: Architect gn Cif n-N C4.tJs rb tZ CG r f.1 Cr- _ PharcNo:: ' f Z3 Z O • (% t f Address: L C>Wit:T , 11A.APt> 1,t) / L(p_- Fax No.: 2-3) "f Z 6 77 `F 7 Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installation bnis commenced prior to the Issuance of a permit and that all work will be performed to meet standards of all laws regulating construction inthisjurisdiction. 1understand that.aseparate:parmitmustbc r.ELEC1RICAL1i/0Rit,.PLUMBING;SIGNS; LLS, POOLS, FURNACES, BOILERS. HEATERS, TANKS, and AIR CONDITIONERS, etc. OWNERS. AFF.InAV1T_.ireuify.thar.alLof •andphap-all work-wiiFbodonritr<omp . all applicable laws regulating construction and zoning. WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE O COMMENCEMENT MAY RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY, IF YOU INi& ND.TOOSTAiN-FINA)4CING;4CONS16%T hFTORNEY Bis C_RECX YOM. ' NOTICE OF COMMENCEMENT. N07lEfiOn addition to -the regniv a ems restrictions applicable to tlris yroperty that may by famd in the public room* of this county, and there may be additional permits required from other govamental entities such asJ water management districts, state agencies, or federal agencies. A of le CAMROW permit is verification that I will notify the owner of the properly of the requirements of Florida Liar Law, FS 713. s' 8• Z j ASrgnattaeofOwner t Da_.•_ ij C - U' T C'-c.rril cam- v • T r t C>^vt edAgernt i Naar ctor/AkenYs Niifne ' g Z/pZ tatyS1At o cretin Dire'" E M D0 oast Bug" M no" 16My commi- g• MY Cdtlmleaion OD06421e tiaion W4210 'notad` Expires June 17 2006 oc 17 2005 Own / Ag is...Personally Known to or Contract is _ PersonallyKno to Me or ID Produced r APPLICATIOq APPROVED BY: J O Date: Special, Cmditions: sr 3 ZZ-Z4Z_,/ f Seminole County Property Appraiser Get Information by Parcel Number Page 1 of 1 d © D PARCEL DETAIL r Scmintslr C'sx/nly L in•ices Q„ Y 1 Inl K. kint tic xnit,rd Ff. 327. 41) SM, GENERAL Parcel ld: 130-300-018H Tax District: S1-SANFORD 0000 VALUE SUMMARY 10- VAC Owner: LOWES HOME Dor: GENERAL- Value Method: Market CENTER INC COMMERCI Number of Buildings: 0 Own/ Addr: C/O WM BYNUM MARSHALL Depreciated Bldg Value: $0 Depreciated EXFT Value: $0 Address: PO BOX 1111 Exemptions: - Land Value (Market): $677,792 NORTH City, State,ZipCode: WILKESBORO NC Land Value Ag: $0 28656 Just/Market Value: $677,792 Property Address: Assessed Value (SOH): $677,792 Facility Name: Exempt Value: $0 Taxable Value: $677,792 SALES Tax Bill Amount: Deed Date Book Page Amount Vac/Imp WARRANTY DEED 05/2002 04414 1258 $2,755,000 Vacant Find Comparable Sales within this DOR Code LEGAL DESCRIPTION SEC 11 TWP 20S RGE 30E BEG SW COR LAND HIDDEN LAKE PH III UNIT 4 RUN S 78 DEG 35 MIN 20 SEC E Land Assess Frontage Depth Land Units Unit Price Land Value 145.47 FT S 11 DEG 24 MIN 40 SEC W 70 FT S Method 78 DEG 35 MIN 20 SEC E 224.22 FT SLY ALG SQUARE FEET 0 0 169,448 4.00 $677,792 CURVE 428.34 FT S 78 DEG 58 MIN 50 SEC W 346.08 FT N 11 DEG 01 MIN 43 SEC W 627.45 FT TO BEG NOTE: Assessed values shown are NOT certified values and therefore are subject to change before being finalized for ad valorem tax purposes. J- Gl 0 3 C,iZLAlZL v E Engineering & Construction Department PO Box 1 11 1 North Wilkesboro, NC 28656 Hwy 268E, East Dock N. Wilkesboro, NC 28659 Phone: (336) 658-4000 Fax: (336) 658-3257 Improving Home Improvement August 2, 2002 City of Sanford, Florida RE: LOWE'S OF SANFORD, FL Dear Sir or Madam: Please be advised Harlan Laws Corporation is authorized by Lowe's Home Centers, Inc., property owner, to act as agent for Lowe's Home Centers, Inc. to apply for permits and install signage. Sincerely, LOWE'S HOME CENTERS, INC. 4 Mike Harless, Director Engineering & Construction, South Swom to and subscribed before me this theordjk7f day of 2002. Notary Public LOWE'S* Home Improvement Warehouse - Improving Home ImprovementT" - www.lowes.com HA14LAN CORPORATION Signs of Success Durham, NC Phoenix, AZ AuPS1,6, 24 Canoga Park, CA City of Sanford, Florida Re: Lowe's of Sanford, FL Dear Sir or Madam: Please be advised West Central Florida Permits, Inc., is authorized by Harlan Laws Corporation, to act as agent for Harlan Laws Corporation, to apply for sign permits at the above listed Lowe's location. Sincerely, HARLAN LAWS CORPORATION of Whittington Sworn to and subscribed before me this the 6th day of A gus , 2002. ry Public My Commission Expires: Is --a i - os 304 Muldee Street • Durham, NC 27703 • Telephone (919) 596-2124 • Fax (919) 596-0421 Letter of Transmittal Date: B 12- , d Z To: tJ I c-D 14 G- JDC- P T From: C.C. Re: LOOES C F- S r\k-,) F Q) j-L 1) L s v A Per- m, -r f S ti N VO 5 1 Cmz S . Z-7 S C S a T p /-- 1 0 C, , L l S C C t J 1 T-+ C T*) 7 c o rJ S C z Ij -t c P,--) sz: M , T I- P/GIe--- - C-(p WEST CENTRAL FtORIdA — TEIEPNONE 941/322-8540 FAx 941/322-2424rMIE-MAIL FORPERMITS@AOI.COMP i 2630 223rd Street East, Bradenton, FL 34211 32'-5 1/4" 31'-6" I 8" WOOD BLOCKING (BEHIND WALL) y y h i 0 14. 5" H.I.W. LETTERS TO HAVE BLUE RETURNS L(3) 8" x 8" DEEP RAGEWAY5 SCALE: 1/4" =1'-0" PERMIT #pL titi`5 OFFICE COPS' 1'-5" RED DOTS REPRESENT PRIMARY EXITS THRU 90 CONNECTOR W/ 30" OF WIRE THRU WALL) 6'-10 V2 " 1) 5ET 7-9" / 6'-6" & V-3'/a" INDIVIDUALLY ILLUMINATED LETTEK5 FABRICATED OF WELDED .080 ALUM. (11" DEEP)LETTEK5 TO CONTAIN ALUM. BAFFLE5 TO 5EPAKATE NEON FROM TRAN5FOKMEK5 & WIRING. LETTER5 FINI5HED IN WHITE ENAMEL. FACES OF 3/16" WHITE ACRYLIC W/ FACE TRIM TO MATCH RETURN5. INTERNAL ILLUMINATION BY (4) ROW5 OF 6500 13mm WHITE NEON TUBING W/ ELECTKODE5 INTO GLA55 HOU51NG5 (NO DOUBLE BACK5). NEON POWERED BY FRANCEFOKMEK P-TYPE 60mA TKAN5FORMEK5. 5EKVICE DOOR5 & D15C. 5WITCHE5 IN5TALLED INTO EACH LETTER. ALL WIRING U.L. APPROVED. (277v) LETTER5 MOUNTED FLUSH ONTO FASCIA VIA NON-COKRO51VE FA5TENER5, FLAT- BAR/TAB5&3/8" 5TAINLE55 5T/EEL 15TEEL ROD.. 5CALE :1/4" = 1'-0" 5 1,-5" 31 1'-5" 4'-3" 2'-4" 4'-5 1 Lf7 U N RACEWAY N I 5 in 3/8" ALL -THREAD THKU-13OLT5 (HOLES TO BE 5EALED) T uLO N o U N LD END VIEW im wW 06z Q_wZ O JJ Zap0tL? E.I.FS• Fww>oOW RED) ZWOO`Z ¢N U aiw=0 Fr o>ozV 34Wwgw 3IWawza. Ir4H L) nx=W awaQ ix` Q {-- O F- it Q Z 2 Uriiz iILx099 Z zaOOLJ-Qy r 00 2 JO WOWCraq- I__ OU w W way `-0 p1 W UZ2?7aZ0 IMF HARLAN LAWS CORPORATION IDENTIFICATION SIGNS U. S. 70 & NC 98 Interchange Drawer 15070 Durham, N. C. 27704 919) 596-2124 FAX 919) 596-0421 This design is the property of Harlan Laws Corporation and cannot be used or distributed without the approval of said company DRWG.# : M711200 DATE: 3 Nov 00 REV. DATE: LOCATION: FILE : 7ft9 Std Letters JOB # : DRAWN BY: BAINE SCALE: r7 N 9 CHANNEL w Q i A ARM X 4 WOOD BLOCKING 3/8" THRU—BOLTS W/2 WASHERS & 1 NUT MIN 6 PER LETTER PLYWOOD 31'-6" 32'-5 1/4- 5" 8" HANNEL LETTERS oC"1 <n 0 PLYWOOD EXISTING 2 X 4 WOOD BLOCKING 3 8" NRU—BOLTS W/2 WASHERS & 1 NUT 48" C/C MAX MIN 18 BCL TS PER RACEWAY ALUMINUM RACEWAY EXISTING Note: Cornerstone Engineering, Inc. is registered to provide engineering services in the State of Florida as Cornerstone Engineers, Inc. NOTICE: EIFS CORNERSTONE ENGINEERS IS RESPONSIBLE EXISTING FOR LETTER / RACEWAY ATTACHMENT TO WALL ONLY. SECTION A —A 1 /2"=1'-0" M ANDRE%V K. LEWIS FL P.E. # 56418 GENERAL NOTES: 1. All design, fabrication, installation and construction shall conform To the following specifications, unless specifically not,sd otherwise on the drawinq: The 2000 Inter:ational Building Code The 2001 Florido Building Code American Institute of Steel Construction, Inc Manual of Steel Construction (9th Edition). American Welding Society ANSI /AWS D 1.1-98 Structural Welding Code — Steel he Aluminum Association Design Manua!, Current Edition.. 2. Ail component:; shall be as listed below, unless noted otherwise: All structura! r1uminum shall be 6063—T6, or equal. Mechanical wa! fasteners shall be installed according to manufacturers specifications. All ferrous anc non—ferrous materials shall be adequately se„crated to prevent corrosion. All bolts in co itoct with aluminum shall be galvanized or--tcir,less steel. Stainless steer bolts shall be .AISI 304 or 316. Steel bolts sh::;l be A325 or equivalent. All exposed materials shall be properly protected from weatnerir.o and/or corrosion. 3. All field welds mall be made by a welder certified in, the specifie J position. 4. The structure 7as been designed to withstand a maximum design pressure of 41.7 psf 100 mph t- 30 feet, fastest mile) (ASCE 7-93). The structure has been designed to withstand a maximum resign pressure rof 36.8 psf 130 mph @ 30 feet, 3—sec gust) (ASCE 7-98). 5. If existing anc p-oposed conditions are not as detailed in this design drawing the installer shall notify the; engineer immediately. 6. If the integrity of the existing wall is sub— standard, the installer shall notify the engineer immediately for re —design. HARLAN LANVS CORPORATION US 70 & 98 Interehan2e - Durham, NC 27704 Lowe's Home Improvement Warehouse Wall Mtd Ltrs Sanford, Florida CORNERSTONE ENGINEERS, INC. 302 COLLEGE ST. P.O. Box 1029 MADISONVILLE, TN 37354 PH (423) 420-1741 FAX (423) 420-1747 Project #: 021382 Dwg #: B0888 Date: 07/15 Drawn By. CRS Scale: 1 /4"=1'-0" Sheet: 1 of 1 T N N 10'-9 " F,, = Primary Electric Exit (277 Volt) Primary Exit Acrylic Face Flat Bar Tab w/ 3/8" Non Corrosive Fasteners Jewelite Trim Raceway 277 v. Transformer 13mm Neon Tubing SCALE: 114" = 1 r-o° 3 AMPS Per Raceway - 6 AMPS Total The recent change in Article 600 of the National Electric Cede Garden Center Letters on Raceways requires neon transformers to have secondary ground -fault protection. This NEC charge requires all UL listed transformer (1) SET 2-77 V-8" ILLUMINATED LETTERS FABRICATED OF WELDED ALUMINUM ( .063 SIDE, .080 BACKS, 5" manufacturers to incorporate secondary -circuit ground -fault DEPTH ). RETURNS FINISHED IN WHITE ACRYLIC URETHANE ENAMEL ( EXTERIOR & INTERIOR). protection, commonly known as the UL2161 requirement. FACES OF 3/16" WHITE ACRYLIC WI 1" WHITE JEWELITE TRIM. The Electrician must use the following procedure: INTERNAL ILLUMINATION BY 13min (EGL/4500) WHITE NEON TUBING W/ ELECTRODES INTO GLASS HOUSINGS. TRANSFORMERS (6CmA) & WIRING LOCATED IN CONTINUOUS ALUMINUM RACEWAYS. ALL 1: The HOT, NEUTRAL.. & the GROUND for each circuit must WIRING U.L. APPROVED (277V ). DISCONNECT SWITCH ON END OF EACH RACEWAY. be designated for neon transformers only. 2: There must be NO other equipment on this circuit RACEWAYS FINISHED TO MATCH FASCIA. back Polarity of these wires must be maintained all the way back to the pare) box. NOTE: 277 Requires Orange or Red Code to (HOT) NOTES TO ELECTRICIAN Gray or White Code to (NEUTRAL) 1. Each letter in "LOWE'S" sign wil! have the branch circuit wiring exiting through front wall and willGreenCodeto (GROUND) tie into the appropriate letter junction box as shown above. Coordinate exact power entry location with the sign manufac-urer at the time of sign installation. Electrician to connect pigtail to branch circuit wiring. 2 All signs are fumished with factory mounted disconnects. v P p Signs of Success 304 Muldee Street Durham, N.C. 27703 Tel: (919) 596-2124 Fax: (919) 596-0421 horlanlaws.com This design is the property of Harlan Laws Corporation and cannot be used or distributed without the approval of said company Phase: 0 Conceptual Design Development Final Production DRWG.#6: M789502 DATE : 19 Feb 02 REV. DATE LOCATION: Various F LE : GC 2-1-ines SALES REP.: House DRAWN BY: BAiNE SCALE: As Noted CI'ert LoWE'S proved by NOTICE: CORNERSTONE ENGINEERING INC, IS RESPONSIBLE FOR RACEWAY ATTACHMENT TO WALL ONLY. RACEWAY/LETTER DESIGN IS THE MANUFACTURER'S RESPONSIBILITY N 1 r 00 N Co CHANNEL LETTERS 10'-8 5/8" A N 00 I•I Q B ,. D ; r I. II II II N Cal 7 L J A CHANNEL LETTERS EXI`;aTING TA 1 X 1 SEE NOTE ELEVATION VIEW 3/8'-1'-o' TI N G TA 1 X 1 SEE NOTE 3/8"0 THRU—BOLTS W/2 WASHERS & 1 NUT 6 — PER RACEWAY 2" CHANNEL ALUMINUM MINUM RACEWAY SEC -DON A —A 1 /2'=1'-0- NOTE: EKSTTNG TA 1 X 1 IS THE F R -%McWORK FOR THE EXISTING GARDEN CENTER WALL. EACH 2" ALUMINUM DIANNEL CROSSES A MINIMUM OF THRE'=. TA I X 1 BRACES. THE 2" ALUM CHAN'-IEL IS TO BE BOLTED TO THE TA 1 'Al 1 AT EACH INTERSECTION WITH 3/8" DIAM STAINLESS STEEL BOLTS. 2" CHANNEL ALUMINUM UMINUM RACEWAY Note: Cornerstone Engineering, Inc. is registered to provide engines. Ong services in the State of Florida as Cornerstone Engineers, Inc. ANDREV,' K. LEWIS FL P.E. # 56418 0C:Jt Kfil f\II 1Ih-\- 1. All design, fabrication, installation and construction shall conform to the following specifications, unless specifically noted otherwise on the drawing: The 2000 International Building Code The Florida Buiiding Code 2001 American Instit:;te of Steel Construction, Inc Manual of Stee' Construction, (9th Edition). American Welding Society ANSI/AWS D1.1-98 Structural Welding Code — Steel The Aiuminum .association Design Manual, Cur: ent Edition. 2. All components shall be as listed below, unless noted otherwise: All structural aluminum shall be 6063—T6, or equal. Mechanical wa!': `osteners shal! be installed according to m-3n.ufacturers specifications. All ferrous and non—ferrous materials shall be adequately sepc-eted to prevent corrosion. All bolts in con -act with aluminum shali be galvanized or stainless steel. Stainiess steel :jolts shall be AISI 304 or 316. Steel bolts shall be A325 or equivalent. All exposed materiais shall be properly protected from weathering and/or corrosion. 3. All field welds s^all be made by a welder certified in the specified -,,osition. 4. The structure h;:s been designed to withstand a maximum design pressure of 41.7 100 0 3C,: psf mph feet, fastest mile) ASCE 7-93). The structure has been designed to withstand a maximum de:,ign pressure of 36.8 130 psf mph © 30 feet, 3—sec gust) (ASCE 7-98). 5. If existina and proposed conditions are not as detailed in this design drawing the installer shall notify the engineer immediately. 6. If the integrity or" the existing wall is sub— standard, the installer shall notify the enain.eer immedictely for re —design. HARLAN LAWS CORPORATION US 70 & 98 Interchan,<_:e - Durham. NC 27704 Lowe's Carden Center Wall Mounted Cabinet Sanford, Florida CORNERSTONE ENGINEERS, INC. 302 COLLEGE ST. P.O. Box 1029 MADISONVILLE. TN 37354 PH (423) 420-1741 FAX (423) 420-1747 I Project P. 021381 1 Dwg #: BO887R I Date: 08 15 n9 Drawn By. CRS Scale: 1 /4"=1'— Sheet: 1 of 1 10'-5 " Primary Exits 13 RACEWAY #1 :3 AMPS D N D N = C ; T ; D SCALE : 3/4" = V-0" RACEWAY #2 : 3 AMPS RACEWAY #3 : 2 AMPS 8 AMPS TOTAL Jewelite Trim Primary Exit 13mm Neon Tubing Raceway Acrylic Face 277 v. Transformer Flat Bar Tab w/ 3/8" Non Corrosive Fasteners NOTES TO ELECTRICIAN 1. Each letter in "LOWE'S" sign will have the branch circuit wiring exiting through front wall and will tie into the appropriate letter junction box as shown above. Coordinate exact power entry location with the sign manufacturer at the time of sign installation. Electrician to connect pigtail to branch circuit wiring. 2. All signs are furnished with factory mounted disconnects. The recent change in Article 600 of the National Electric Code requires neon transformers to have secondary ground -fault protection. This NEC change requires all UL listed transformer manufacturers to incorporate secondary -circuit ground -fault protection, commonly known as the 111-2161 requirement. The Electrician must use the following procedure: 1: The HOT, NEUTRAL, & the GROUND for each circuit must be designated for neon transformers only. 2: There must be NO other equipment on this circuit 3: The Polarity of these wires must be maintained all the way back to the panel box. NOTE: 277 Requires: Orange or Red Code to (HOT) Gray or White Code to (NEUTRAL) Green Code to .GROUND) 4Int HARLAN LAWS CORPORATION Signs of Success 304 Muldee Street Durham, N.C. 27703 Tel: (919) 596-2124 Fax: (919) 596-0421 harlanlaws.com This design is the property of Harlan Laws Corporation and cannot be used or distributed without the approval of said company Phase: Conceptual Design Development Final Production DRWG.# : M789802 DATE: 19 Feb 02 REV. DATE: LOCATION: Various FILE : ILY RW SALES REP: House DRAWN BY: BAINE SCALE: As Noted Client: LOWE'S 2.zproved by N I N N I N 10'— 5" IA Rr'. 1 = IA FI FVATION VIEW 3/8'=1'-0' BLOCKING NOTE_ THE INSTALLER SHALL BE RESPONSIBLE FOR FOR SECURELY FASTENING THE WOOD BLOCKING TO THE BUILDING FRAME USING STANDARD CONSTRUCTION PRACTICES. 5" 8" v LL a 2 ANNEL LETTERS SECTION A —A I'=1'-o' PLYWOOD 3 /8"0 THRU—BOLTS W/2 WASHERS & 1 NUT 48" C C MAX MIN 6 BOLTS PER RACEWAY 2X4WOOD MINUM RACEWAY A WAY GENERAL NOTES: 1. All design, fabrication, installation and construction shall conform to the following specifications, unless specifically noted otherwise on the drawing: The 2000 Intem,itional Building Code The 2001 Floridc Building Code American Institute of Steel Construction, Inc Manual of Steel Construction (9th Edition). American Welding Society ANSI/AWS D1.1-98 Structural Welding Code — Steel The Aluminum 4ssociation Design Manual, Current Edition. 2. All components shall be as listed below, unless noted o- herwise: All structural aluminum shall be 6063—T6, or equal. Mechanical wall fasteners shall be installed according to manufacturers specifications. All ferrous and non—ferrous materials shall be adequately sep(3rated to prevent corrosion. All bolts in contact with aluminum shal! be galvanized or stainless steel. Stainless steel bolts shall be AISI 304 or 316. Steel bolts shall be A325 or equivalent. All exposed materials shall be properly protected from weathering and/or corrosion. N 3. All field welds shall be made by a welder certified CORNERSTONE ENGINEERING INC, in the specifies! position. IS RESPONSIBLE FOR RACEWAY 4. The structure -ias been designed to withstand ATTACHMENT TO WALL ONLY. a maximum design pressure of 41.7 psf 7-93). RACEWAY/LETTER DESIGN IS THE 100 mph ® ;30 feet, fastest mile) (ASCE MANUFAC'NRER'S RESPONSIBILITY. The structure has been designed to withstand a maximum design pressure of 36.8 psf 130 mph ® 30 feet, 3—sec gust) (ASCE 7-98). 5. If existing and proposed conditions are not as detailed in this design drawing the installer shall notify the engineer immediately. Note: 6. If the integrity of the existing wall is sub — Cornerstone Engineering, Inc. is registered to standard, the ;nstaller shall notify the engineer provide engineering services in the State of immediately fo- re —design. Florida as Cornerstone Engineers, Inc. ANDREW K. LEWIS HARLAN LAWS CORPORATION US 70 & 98 Interchanse - Durham. NC 27704 Lowe's Indoor Lumber Yard Channel Letters Sanford, Florida r CORNERSTONE ENGINEERS, INC. 302 COLLEGE ST. P.O. Box 102902MADISONTVILLE, TN 37 354 420-1747 0 PH (423) 420-1741 FAX (423) Project # 021380 9 #: B0880 Date: 07 15 02 FL P.E. # 56418 Drawn By. CRS I Scale: 1 /4"=1'-0" Sheet: 1 of 1 1 I,_ St) I 4) #8, (1) #8G IIN 1' C lip lltW".'qi'lW NL I \ I LP1A - 27.29 6.9 AMPS. 4BOV, 10 CONTROLLED BY EMS L.P1A - 31, 33 I 6.9 AMPS, 480V. 10 CONTROLLED BY NIGHT LIGHT Ch'Mff l l l Il U HI-35(FG) HS) N l °• 1 NOTE 5 Q,35(F-G) Ni r-i SLA - 8, 10, 12 9.0 AMPS, 480V, 30 \ CONTROLLED BY EMS SLA - 28, 30 II 11.5 AMPS, 48OV, 10 I CA(CONTROFLBY NIGHT LIGHT CIRCUIT 9-1 BC(F 2, AB 5) #8, (1) #8G IN 1"C ::/ SLA -2.4.6 12.7 AMPS. 480V. 30 CONTROLLED BY EMS SLA - 24. 26 9.2 AMPS, 48OV, 10 CONTROLLED BY NIGHT LIGHT CIRCUIT 5) #8, (1) #8G IN 1"C 5) #8, (1) #8G IN VC SLA - 7. 91. 11 12.2 AMPS, 480V, 30 CONTROLLED BY EMS SLA - 27, 29 9.2 AMPS, 480V, 10 CONTROLLED BY NIGHT LIGHT CIRCUIT SLA - 1, 3, 5 5.3 AMPS, 48OV, CONTROLLED BY S SLA - 23, 25 9.2 AMPS, 48OV, 0 CONTROLLED BY NIGHT LIGHT CIRC IT 5) #8, (1) #8G IN VC 11-1- I o m- 177 NL MOW BC K35(F( J Wcu. RECEI E BANFORD BUILDING DEFT. 1IESE PLANS ARE REVIEWED AND CONDMONALLY FLUID CONTROL SYSTEMS SEP Z O ZOOZ gCCEPTED FOR PERMIT. A PERMIT ISSUED SHALL BE CONSTRUED TO BE A LICENSE TO PROCEED WITH THE WORK AND NOT AS AUTHORITY TO VI EODEL-_3-000.--D.CD.A.Y., CANCEL. ALTER. OR SET ASIDE ANY O , PROVISIONSOF THE TECHNICAL CODES. NOR A L ISSUANCE OF A PERMIT PREVENT DEPT FROM THEREAFTER REQUIRIU I I N CHECK DETECTOR ASSEMBLY TION OF ERRORS ON THE PLANO, CONSTRUCTION OR OTHER VIOLATIONS OF THE CODES. For Fire Protection Systems 1f PERMIT #b OFFICE COPY am Description The Ames 3000 DCDA protects the potable water system by preventing back/low from lire protection systems. The device also detects leaks of unaumorized use of water from fire protection lines. Operation In the incidence of minimal water flow, the valve clapper remains closed so that the water flows through the bypass loop. When a major water flow is required, the water pressure will open the main valves to allow lull water flow. Installation 3000 DCDA Assemblies should be installed with a minimum clearance of 12" between assembly and floor or grade, and should be installed where there is easy accessibility for maintenance and testing. 11 Features Fabricated steel body provides a substantial lighter weight unit than cast or ductile iron. Functional in horizontal or vertical positions. Available with hot dip zinc galvanized coating or fusion - bonded Ames Guard epoxy coating. Prevents backllow from lire prevention systems. OS& Y RW Gate valves are approved by UL & FM for fire protection systems. 300 Series stainless steel interior working parts reduce corrosion and provideslonger valve life. Shortest end to end dimensions available in the industry. Low head loss. Fully servicable inline. Factory assembled and tested. National Approvals UL, USCFCCCHR, ASSE, FM, AWWA The Ames Company founded in 1910 has long been an industry leader in producing fittings and valves for pipeline systems. All Ames products are manufactured at their 60.000 sq. ft. facility in Woodland. California, insuring quality control & prompt service. C LI Ames 3000 DCDA — Weights & Dimensions (Inches) Bypass Assembly Not Shown) Model Size A B C D E IFOpen G NET WT with gates NET WT w/o 3000 DCDA 4" 45 'h 27 'h 17 5/8 3A NPT 5 233/+s 15 320 lbs. 120 lbs. 3000 DCDA 6" 58 7/8 37 7/8 20 118 VA NPT 6 293116 17 480 lbs. 180 lbs. 3000 DCDA 8" 68% 45'/. 23 1/8 NPT 7'h 37-/. 19'k 780 lbs. 275 lbs. 3000 DCDC' 10" 83% 1 571h 23 7/8 1 3/4 NPT 9V4 48 1 22 1120 lbs. 1 345 lbs. The Ames 3000 DCDA is designed to prevent back/low from fire protection lines into 1 the municipal water system. The assembly 4 13 consists of two independently operating, spring 12 loaded check valves, two UL listed OS&Y gate 11 valves, and a bypass assembly. 9 The bypass assembly consists of a meter 8 which registers in either gallons or cubic 6 measurements, a double check backflow 5 preventer including shut-off valves and 0 required te_stcocks. 15 The Ames 3000 DCDA is manufactured for ease 13 of installation, dependability, durability, and 12 in -line maintenance. The main body is built 1 o from heavy-duty steel with a galvanized or 9 fusion bonded epoxy lining and coating. All 8 internal parts are made from stainless steel to 6 prevent corrosion and are easily replaceable 5 for service or repair. o SEE AMES MODEL DCDC LITERATURE A•4101 Other Specifications Flow Characteristics (Including Shut -of Valves) W an vn an mo e.. 10.. zoo 400 600 NO IWO Flow (GPM) Developed by USC Foundation for Cross Connection Control and Hydraulic Research M*. Unit comes assembled with bypass which includes water meter and backflow prevention assembly. NATIONAL APPROVALS— Testcocks are included. UL, USCFCCCHR, ASSE, Rated working pressure 4", 6" 8", 10" (175 PSI) FM,AWWA Flange dimensions and holes in accordance with AWWA Class D. All internal metal parts are 300 series stainless steel with exception of removable bronze seat ring X WcoS. sn, ASTMB62-82. Body nameplate provides nominal size, direction of flow, PSI rating and year of manufacture. FLUID CONTROL SYSTEMS Body material ASTM A36. Ames Company, Inc. • 1485 Tanforan Avenue • P.O. Box 1387 • Woodland, California 95776 • (916) 666-2493 PRINTED N THE U.S.A. DCDA-2 9/93 Central Sprinkler Company 451 North Cannon Avenue, Lansdale, Pennsylvania 19446 Product Techn 13aI Description Data Central Sprinkler Head Cabinets are constructed of a metal enclosure with a hinged cover designed to provide on -site storage of an emergency supply of sprinkler heads and a sprinkler head wrench. NFPA 13 requires a. representative number of each type of sprinkler head used in a sprinkler system to be stored in a cabinet on -site to allow for immediate removal and replacement of sprinklers which may have operated or become damaged. Central Sprinkler Head Cabinets are manufactured of heavy gauge steel with knock -outs to accommodate either''/s" or %" N.P.T. threaded sprinkler heads and are painted an attractive red enamel. They are available in three (3), six (6) or twelve (12) head capacity. Model: Sprinkler Head Cabinet Style: 3, 6 or 12 head Standard Finish: Red enamel Mfgr. Source: Non -domestic 3 sprinkler heads 6 sprinkler heads 12 sprinkler heads Dimensions: 3 head - 5' high x Tk' long x 2%" deep 6 head - 5' high x 14" long x NO deep 12 head - 5' high x 143E long x 5' deep Weight: 3 head - 1.5 lbs. 6 head - 2.3 lbs. 12 head - 4 lbs. RECEIV p _ ) SEP p 201 t Hr.. 26 C. (: TM ` 19 2,001 ' 15. 3-3 FR T7 1334653-93.46 P, u1 03 Early Suppression Fast Response Piendefft Sprinklers , Pulsar' m ESFR 25' m, K=252 GENERAL DESCRIPTION The Star Pulsar ESFR-25 Pond" Sprinklers (Re,. Ffpare1) are -Early SWprtssion Fast Response AxinX;VF Ftav- kV a nominal K-fagot of 26 2. They we .auppressbn mode aprirtlders, and their use is especially advanta- geous as a means of eliminating the use of Wreck sprin- kWs, when prolecling high -piled storage. The Pubar ESFR-25 is primarily designed for use with storage WOO of most encapsulated or non-encapsu- tated oominon materials inCfuding cartoned unexpanded Pbtics of W 10 40 h. (12.2 m) and with telling Freights ofupto45it (1&7.m). in addition, the proieclion of some storage arra+tgements of rvH paper and rubber tires canbeconsideredaswell. The Pulsar ESFR 2S provides the system designer with ttydra+7liC and sprinider placemml options not presently Available to the traditional ESFR sprinklers itatvkg a nvnti- nal K-Faofor of 14.0. In partic uIar, the Pulsar ESFR-25 has been designed to operate at stbsiantiaNy lower and head pressures. as compared to ESFR sprinklers havinganominalK-Factor of 14.0. This feature oilers 11adbility when sizing the system Piping, as wall a$ possibly reduc- ing or eliminating the ne+td for a system tits pomp. Also, Ute Pulsar ESFR-25 permits use of a maximum deflector - to Ceilingdistance of 18 inches (480 mm) versus 14 inces RW Mtn); and, it storage arrangement of up to 40fl. (12.2 m) with a cefling height of up to 45 ft. (13.7 m) does not require in -rack sprinkim as do ESFR sprinklershavinganominalK-Factor of 14.0. The Pulm ESFR-26 Pendant SprinMer is also Listed byUndsr*lXars LabomloriO3 Inc. (UL) yard by UL for use InCanada (C-UL) as a 'Specific Application Early Suppres- t:fon Fast Resporas Sprinlder" gs k d mled under the UL and C-UL Specific Application Desipn Criteria section. The specilic application listing provides for reduced pres- We design for the Protection of certain com roodiiies. APPkcatiorrs for the Pulsar ESFR-25 Sprinklers are ex- pand" beyond the current recognized kWallation stand- ards. For information regarding research fire tests which may be acceptable to an Authority Having Jurisdiction e.g.. flammable liquids. exposed plastics. and aerosols), please conUO the Technical Services Department, STAR SPRINKLER INC. SIN Solo WARAMW 7ha Adsor ESFR-25 Sprinklers daser bed hfntia must be installed and rnarinldbted In oompifWWV Wo MIS d4xw men; as Well as with fhe aAaftab* atan&vds of Ore Ma. Nona! Fire PWect Asvoaation, in adbfdon to the stand aids otany other authorises havirtgMbdescvr (e.g. Factory Mutual Reseaxh Corporation). Fariure fo do sv . mar impair rite Wegriry or these devices. Me omw is respVM We tar malntafa ft his irre prokcbonsystemAnddatricesAnpropereperadn9condition77reiristallirt8contractororspdrddermenufeetwershould be ca000W&d relative to any questions. OPERATION The fusible link (heat Coitector) assembly is co need of hvo artk hahves which are joined together by a rim lark of solder. When the rated tsmtpersturs Is rsachad, the solder mans and the two lank halves saparata. which them allows the sprinkler to activate and ilow water. 414-170-CpOW . OMS58.52M • FAX 414-570, 5010 wv.w sie.aprwYcbi. avm 1-4.1.11 2-00 Jlt1 i9 ?5r71 1S=39 FR TO 13346538348 P. 02.03 Page 2 sae TECHNICAL DATA STAR SPRINKLER INC. WRENCH BOTH Sit LMK ASSE 75 TEMPERATunr AATIMG FIGURE 1 PULSAR ESFR 25 PENDENT SPRINKLER Approvals UL and C-UL Usted. FM Approved. Listirrps and approvals only apply to tf e service condi- lions in the Design Criteria section.) Matrimuln Wonting Pressure 176 psi (12.1 bar) Pips Thread Connection 1 Itch NPT Or ISO 7-R1 Mcharge Coefficient . K - 25.2 GPMirpsit)2 (382.9 LPMlbarV2) Tempetature Ratanggss 185-Fl74-C or214°F/1D1-C Mich Natural Brass Physical Characteristics (Ref. Figure 1) The Pulsar ESFR-25 utilizes a dozincitication resistant bronze alloy frame. The strut and hook are monel; the but- ton. d911eotor. and compression screw are brwf¢e. The gasketed spring plate con>s1s16 of aberyllium WxW dse spring that 13 sealed on both its ins;de and outside edges nth a Tettont gasket. and the two halves of qte fusible Ink assembly are nickel. Patents U.S.A. Patent Number 4.590,729. 5.629,532, and 6.059.044 are irrVlirt ble to the Pulsar ESFR-25. other patents are pending. DESIGN CRITERIA UL and C-UL Listing Crlted a The Pulsar ESFR-25 Sprinklers are UL and C-(1L Listed as 'Early Suppression Fast Response Sprinklers' for in- staMbon per NFPA 13 or other applicable NFPA stand- ards. UL and C-UL Specific Appllcation Listing C Iteria The Pulsar ESFR-25 Sprinklers are UL and C-UL Listed.. as 'Specific Application Early Suppression Fast Re- sponse SpdnWW for use in in accordance with NFPA 13 to protect "- Ie-. double-. and multiple row rack sionage and palletited and solid pile storage (no open containers or solid shelves) d Clm 1,11,111, and IV commodities en- capsulated or unerloapsulated and cartoned Group A un- enpanded plastics when it UaMed with the blowing slor- age and ceiling heights and minimum design pressures_ Maximum MaXh Mrm Mlnlmutn Storage Cenkm Flouring hot He, Ft (m) FL ) psi (bar) 40(12.2 35 45 (13.7) 40 (2.7) 10.7 4D (12. 25(1.7) 30(9.1) 35 (10.7' 20 (1.4 25(7.6) 3D (9.1) 15 (1.0 When applying the specific application listing criteria, the Pulsar ESFR-25 Sprinklers should be insWled using the same installation obstruction and construction criteria, as well as deflector-lo ceiling distances, as is applicsUe for Early Suppression Fast Response Sprinklers having a nominal K-Factor of 25.2 per NFPA 13. FM Approval Criteria The Pulsar ESFR-25 Sprinklers are FM Approved as 4- Early Suppression Fast Response Sprin)ders- for installa- tion per the applicable FNt Loss Prevention Data Sheets. TL#4 19 ' 200115: 39 FIR 1- a.i-/ 1 FrtTING SIDE* 7owARDS SPPMKLER r0FnT"G IN WRI M STAR SPRINKLER INC. FIGURE 2 W TYPE1 SPRINKLER wtemc i INSTALLATION The Pulsar ESFR-25 PvndeM Sprinklers are to be in- stalled in accordance with the tolbwlng instructions: AWE Damage to the Amibfe Lir* AsAssembly during installation canbeavoidedbyhandlingthesprkW" by tine Irame arms only (r.e , do not apply pressure lu the fusible Link Assemb/ Y), and by using the appropriatd spr Wen wrench. Dlamased sprinklers rnusi be replaced A leak Wt i inch NPT sprinkler pint ahmM be obtained whh a torque d 20 to 30 #Jbs. (26,ar to 40.2 Jymj. Nigher awlsoftorquemaydistortthesprir*w inlet Wjh cpr4v. quest leakage or iMPOirm9nt of the sprinkler. I. The Pulsar ESFR-25 Sprinkler nwst be installed in the pendent position. 2. W11h prpC thread 30Al0M apptled, hand tighten the sprirWer W 49 tI v sprinkler fitting. Do no apply pross;xe to the Unk Assembly. and harxlle the Pulsar ESFR-26 Sprkhlder only bytheFramearts. 3. Wrwtdt WMvn the Pulsar ESFR-25 Rp&g*r t>skV orb tl1eW-Typa t SWIr lcler Wrench (Rai Figure 2) and by 4rtlr Pals, seating the wench with the spririlder wrench 4. Aker kisfalatieorl, inspect the Link Assembly of each pulsar ESFR- 25Sprinkler Iordamage. in particular, verify that the LinkAssetr>bly and Hook are pos*x1ed as ilusirated in Figure1. and that the Lrdc Assembly has not been bent, creased, or broad out of ks normal position in any way. DaffkMPd aprinklem must be rspLWVd, Pigr, e 3 MAINTENANCE AND SERVICE The Pulsar ESFR-25 must be maintained and serviced in accordancewiththetoaowin9instructions: NOTE Befory dosing a Ire proreckw system main control raMe formaintenancewtx* on thv firs protvcrion system which ItcontrolspermissiontosMKdowntheaflegedEreWo- tecmsystemsmustbeobtainedfromtheproper "ri- desandallpersonnelwhomaybeafleGedbythis $coon mustben0lified- 04AW40c sprinklers must never be shipped or stored Where their temperature Will exceed 100-F13f3°C and they nr_'st n= yr be pakited, puled, coated, Or Otherwise al- tered after leaving the Wort' Modified or over -heated spdrllclers must be replaced. Care must be exercised to avoid damage - botore. dur- ing. and aher installation. Sprinklers daplaged by drop- ping, striking, wrench twk1/rF5ppsge, or the lira, must be replaced. It is recomrnertded that autornaft sprinkler systems be in- spected quarterly by a qualitled inspectjon Service. ORDERING PROCEDURE Please Specify: Pulsar ESFR-25 Pendent Sprinkler (91648) W Type1 Sprinkler Wrench (E2B49) Refer to Price list for W complete listing of Part Mxn- berswithrespect10temperatureratings, etc. AVAILABILITY AND SERVICE Star Sprinkler Inc, products and devices are available eoMaaOugh aS !work of independent dWalbutors. name end address of h Starrdstriibbu yotuor area LIMITED WARRANTY Seller warrants for a period of ene year from date of ship- ment ( warranty period) that the products furnished here- underwillbefreeofdetectsInMateialandworkmanship. For further details on WarrantK contact Star Sprinkler Inc. s rco ". r r d: 011 v , IttON. a KI'7= 31 O _ TM Storage Marwlactured by: Central Sprinkler Company451NorthCaruionAvenue. Lansdale. Penny Product Description The Central Model K17-231TM Automatic Sprinkler has been tested and listed for storage occupancies. Fu0-scale fire testingofhighdiallengefiresinstorageoccupan- cies using low required operating pressures was conducted and was successful. The fire tests results show pressures as low as 7 psi (0.5 bar) can be used with the Central K17-2311. This results in very low Pressure requirements that can save cost by reducing branch line sizes, increasing the spacing, eliminating boosler pumps, and upgrading existingdensities. The Model K17-231 TM is used with the area density curves of NFPA 231, 231C. and 231 D. It is essentially a Standard Spray Sprinkler with a 17.5 (?.Z4 metr c) K- Factor. The larger K-Factor allows the Pressure to be reduced when compared to ELO. LO. or standard orifice sprinklers. This reduction in pressure results in cost savings on the overall system. The K17-231' differs from the ULTRATm K-171 by its brass deflector, the markings on the deflector, and the K-Factor. 19M Technical - Data MO": K17--2317" Shy= Upright. Pendent Orifice Size:.775 (r97nxn) K-Factor 17.5 rW 4,*6*j Thread: vv evn" N.P.T. Temp. Rating fibmtelft usped 2WFM3,C - Green 2e6-Fn41'c - Mw Approvals: Ut- cUL, FM - Upright Only Maximum Working Pressure: 175 psi (rz. rbed Factory Hydro Test 100% at 500 Psi W.5bw) Standard Finish: grass Patent: Pe Pressure COMParison Density 071,W) L.O. Model A PSI (bar) ELO.231 K17-231Tw PSI (bar) PSI (bar) 35 (14.21 113.6 (r.3) 9.42 (0.6) 7.0 (0.5) 40 (r6.3) 24.4 (r.7) 12.3 o.B( ) 7.0 (0.5) 45 (f8.3) 30.9 (2. r) 15.6 (1.1) 7.0 (0.5) 50 (20.4) 38.1 (2.6) 19.2 (r-3) 8.2 (o.$) 55 (224) 46. 1 04 23.3 (r.$) 9.9 0. 60 (24.4 54.9 (3.8) 27.7 (r.9) 11.7 (0.8) 70 (28.5) 74.7 (5.2) 37.7 2.5) 10.9 80 (3 6) 97.5 s. 49.2 (3.4) 20.9 (1.4) 90 (36.6) _ 12_3.5 (B.5) _ 152.4 62.3 (4.3) 26.4 (1.8) 1.0 (4Ct71 7p,5) 76.9 (5.3 32.7 (2.3) Standard Spray Automatic sprinkler Fla. 3-4.0 4 2 54 Model K17-231I'm Upright K'! 7-231 TM 6 Model K17-231TM' Pendent Approval Guide Standard U.L. FM* NFPA 13 Yes Yes NFPA 231 Yes Yes NFPA 231 C Yes Yes N FPA 231 D Yes Yes Upright Only z v Design Data The Model K17-231TM Sprinkler is Listed for standard'sprk*jer placement and flow and pressure requirements as specified in 1hiS data sheet and NFPA. The K17-231 rw is not Listed for use as a "urge drop^ spdnlder, nor as an ESFR" sprinidter. The following Parameters must be incorporated into the design of automatic sprinkler systems utilizing. Model K17- 231' Sprinklers for NFPA applications: I. Minimum sprinkler spacing is 6 feet (1.e m). 2. Maximum coverage area is 1 oo sq. fl. (9.3mr) 3. Automatic sprinkler systems must be hydraulically calculated using densities from the NFPA Standards 4. Minimum pressure is 7 psi 0.5 bar). Y.& Product Description Insta.11ati3- The Model K17-231TM Sprinkler incorporates the Glass Bulb actuating assembly which Provides aesthetic appeal wiht high dependability. Glass Bulb Operation: The Model K17- 231TM now incorporates the latest in heat es Op technology. The erating consists of a liquid. filled 5mnt diameter frangible cape that is only 2.0 cm in length. The glass bulb capsule operating mechanism contains a heat sensitive liquid that expands upon application of heal. At the rated tempera_ lure, the frangible capsule ruptures thereby releasing the orifice seal, thus Operating the sprinkler. All Central Model K17-231r" sprirmustbeinstalledaccordingNFPAStandards. Deviationsto come requirements and sta orations from t alteration to the ner itself any sprinkler itself wig yr Will warranty made by Central Sprin Company. In addition, installation m also meet local government provisiot odes' and standards as applicable. The system piping must be groped sized to insure the minimum required rate at the sprinkler. Check for the pi model• style. orifice size, and temper, rating prior to installation, install sprir klers after the piping is in place to avc mechanical damage; replace any damaged units. Wet pipe systems jnust be protect( from freezing. Upon completion of the installation, system must be tested per recognized standards. In the event of a thread leak, remove the unit apply new pipe joint compoun or tape, and reinstall. Installation Sequence Step 1. The unit must be installed in W. upright or pendent position. Step 2- Use only a non -hardening pipe joint compound or Teflon, tape. Apply only to the male threads. Teflon is a trademark of the DuPont Corp. Step 3- Hand tighten the sprinkler into the filling. Use a wrench to tighten the unit into the filling. A leak -light joint requires only 7 to 14 ft.-Ibs. (9.5 to 190 Nm) of torque; a tangential force of 14 to 28 Ibs. (62.3 to 124.5 N) delivered through a 6' (150 mm) handle will deliver adequat torque. Torque levels over 21 ft.-lbs. (26 NR) may distort the orifice seal, resulting in leakage. The sprinkler shall, per NFPA, be oriented so the frame arms are parallel With the branch line pipe. wayrtxwe Quick ResponseUpright, Pendent, Recessed Pendent AutomaticSprinklerK- Factor = 11.4 (164.4 Manufactured by: Central Sprinkler Company xSlNorthCaonnnAvenue. Lansdale, Pennsy Product Description The Central Model ELO-231 GB OR Aulomalic cpr"der n Extra Large Orifice Sprinkler thathast,oen Proven for storage occupancles by full-scale lire lesling at Foctory WlualanddesignedtoControlhChallenge rites in storage occupancies vw!h relatively Ejw required Pressures. The ELO. 231 G6 OR is now available in a grass t),Ib Oe+rgnk as well as the traftona! tenter sire! design. Lowerenj bead Marl pressures allow more pressure 10beavailableto: Reduce Pips size Increase Spacing Eliminate booster pumps Upgrade elslating densttles 1.Yitr1 the APProval o1 a Tentative Inlerirn ArrPrldnant by ,4FPA, the ELO•L,.I1 GB OR became the first Extra Large Orifice standard spray sprirklyr * be alk)wed for use in NFPA 231. 231C. 231 D and 231 F occupancies With the area/densiry Curves. The minimum Operating lxessure Itt:'10 psi (0.7bark This rs the oNy modification of the 231, 231C. 251D and231FStandards. r1.6 10 prr.5 ,-bar) minim", press.,, is reqLd/vd for NFPA ;.3 r. 231C. 2310. 231 F =, d Fyn D"" r, the FEO-031 15 EX Listed rpr NFPA 13 2AP*Car* ns 1"tA a rr..rPimwn or 7 ps, l0.49 bsq Approval Gulde Standard U. L. F.M. NFPA 13 Yes Yes NFPA 231 Yes Yes NFPq i31C Yes Yes NFPA 2g1/) Yes \'os NFPA 231E Yes I Yos metric) 19446 Toti- Anical DataModel: EL0. 231 or EL0-231 GB Syr',' Upright, Pendent.--Rec. Pendent Recessed Pendent U.L. only ESCulcheon: Model ELO 13ecessed 2-piece) Wrench. ELCNESLO/ ESFR Combination Partx 1073 Now For the nroesasd conngurxVpr , on,, meINode EL0RAcesaw( 2p)ece) Escutcl- eorr maybe used, S-botituNa.) or other rrcesaed' Aactrtclrrrons may rrrrparr the operAtinQ "I'00 V0 Ana distdbwA n wffem. For thePpndontvetAwknorrreCettldescutchAons :rrctr * 2 A Yc cw 401 may be used butAntraptn"prra>rrr Orifice Size: 0.64' 116.3rrm) K-Factor: 11.4 (164.4nlarriq Thread: " i20---")N.P. T. Temperature arld Co:a: 155'F/689C . Rod 2W"R"C " Greer W'F/141 ` C - 61ue APProvals: V.L. U.L.0 . F.M. Minimum Operating Pressure: Maximum '10 PSf ( 0.69bar) Working Pressure: FAtaO H 175 Psi (12.7 bar) rY Ydro Test: IDD% a1 Standard Finish; 5W Psi (34-5 star) ti Corrosion Resistant Coatings;. See Page L6ngth: 31/q• (7g A ar il) We'll: 1'/.- ( 47.3 rrlm) Weigh: 4.8 oz. (136 grams) Head Guam: G. 2 (U.E.:ire1lor Uprght utllyd F.M.. IW-,vWW C079N d Penrls/ irl ELO-231 11 ( 16.3mm) Orifice Automatic Sprinkler a. 3- 1 o.o 0-12 4 4 7-- ;=, CENTRAL SPW -GA Figure 1 EL01-231 Go OR Upright Sprinkler PAGE 02: ELO-231 GB Figure 2 OR Pendent 20 -ow F19 w 013 L 2 3OW Mr Figure 3 ELO-231 GO OR Recessed Pendent x 314*m x mwwn) r. C. Face of iedtxkv oupling kv One MOCW ELO (?-.Cwece) Recessed Eas"cheop N T LTl) !I:- Z 1/4 :"T. i!L2--- IML Mon. I- 2 1 03/'3f. UC1 i !: ll? 3ijq gy : mac, cNTRct_ `pFK f.-A PAGE fly APDrovals entl Listings x yancy StyN Temp Fie Ong (-FI Ci U. L I Pendent i 15"e. ROCessed PendeM ; 15 201N93. 2MI41tSib• 2oof9J, 2ti6f11tUprght ' 15i .2ooRl.9.2M.141 FM. _ , va,dern 155/68Upright . 21XV141 U.l.::. 'Pendent 1 ri9+t1 15.Sra6. 200M. 2MI415 U.L. Lsrlryyss Corrosionasrpl Rese r>r 5/eS. 200103. 2W141 DesignINData The Model ELO-231 Extra Large OrificeSprit4' is Listed tar standard sprinkler Placement and standard flow and Frestrtx>: requirements as specified to NFPA 13.231, 231 C. 231 D and 231 F. 771e EL0-231 !s not Listed to, uas saa ' ts pe drop- xPrinkler nor as an ESFA'• arprhrifrt The following parameters must be -- ir'corWrated into the design o' autonlalic sprink:W systems Ulil 60119 Model ELO-231SPnnkiersIOrNFPAapplications: 1. Minimum sprinkler spacing is rifeVl!r.8m)_ 2. Maxirrum coverage area is 130 9% fl.(rz r nrri ter densities below, 25 9p'wsQ. t . (ro.2 Uhorri in NFPA 13.231 and 231C 8MW Catlons. The Maxtrlurn coverage area is 1 oo sq. 1!.1..3 n l';r NFPA 13,231 and 231C applications with densities 01.25 gPnVSq. ft. (10.2 On' above. 3. Autorllatic sprinkler systems must be hydrat,ficaily calculated usingtheareVdensitycurvesofNFPA Standards. a Minimum Sprinkler discharge P'esst,ra is 10 psi(J 7 bare (X 9em' r36,a Lem) for NFPA 231, 231 C. 231 D and 231 F applications aw 7 :)sg0.5 bar) t.r NFPA 13 applications. Factory Wtuel's I tc*8 Prevention Data Sheets contain requirements thatdifferfromNFPA. Fintahea five. GYworn---- i are", ch nwne, Printed• areas. C11ron e. Fainlyd• Brun.CNarno. Wax. Lved. Wax ever erase. Chrbnie, Paaltaq, 1ilrax. Lead. Wax-ovor-LealBracts, Chrome, Pentad erase, Chrome. Painted Product Description The ELO-231 is VL and ULC Listed as a 411Or- 7 -mi ELO Standard Spray Sprinkler as rekinlOncOd by NFPA 13. Also. The ELO-231 is a standard spray storageoccupancysprinklerasrater, erlced by NFPA 231. 231 F. 231 C. 2310 and FaClpry Mutual's Approval o1 lho ELO-231 is for all areafdensity rrlelflods of design. Th:s is rky I;mited 13231, 231C and 231 D typeoxuaancles. (See Faporytilufuar`S ioss P. evanfion Pala Sheers to• dvtafj The Model E1_0.231 Sprinkler inrorpo- rates the center-sbu" aetua*V 3ssem- bly oraglasstubheatresponsiveeterrent. CenterStrut OpMgon: A lus"o alloy is sealedintoabronzecenterstrutbyastailyessstealball, when Ilse alloy rnelts at itssledtemperature, Via ball Is forced 1,pTWard into the canter Stroh, releasing the two eMCtorsandOpera" ft sprinkler Unlike most Other spriMtler designs, the alloy lo riot WOW 10 almoaphenc Conditions that covid avert is proper functioning. Its also Ias$ susceptible >G rt' echan cal damage since there are Protruding elements. extending beyond the spllrlkler ranee Class Bulb Operation: The Model ELO- 231 GB now !p orporates thelatest in heat responsive 91sss bulb tgcWology. The operatingmechanismconsistsofaliquid-1000 5mm diameter !rangible caFsule that is o 11y 20 mm In length. The 9WS t: tr:b capsvie operating mechawsm IrOntains 3 heat sensitive liquid 1hal excandc upon applicaliorl 01 heal At the sled tempuratura, the frangible cap,, ruptures thbrehy releasing the cri!lce seal. Thus >pefeNnQ he sprinkler. Instaliati M Central Model ELa23t nhier Host be installed atx n9 M current NFPA Standards. Deviations from the require•-nents and standards or any alteration W the sprinkler itself VAI void any warranter " lade by Cerxral Sprinkle Company. In add?bon, installailon rnus also meet local goverrwrlent provision>. COdel, and standards as eoi.'iice4e, T4e system pi ire must tie properly s1z9d to insure 1-te minimurn re0red th rate et the sprinkler. Check for trio pros modal. Style, oriktt •ize, aria ternporatu rating prior 10 i rstatlabon. ,*41all $On. klers after the pipxl9 is in pace so avoid mechanicai damage; r,piace any damaged units. Wet dPe systems must be Prolectad from freezing. Upon completion of the i(1%aMlicn, a:e system must be tested per recognize,, standards. In the evert Of a thread leak. remove the unit, apply new pipe join) campotnw, Or tape. a!7d tairlstan Insullatton sowen v Step 1. The unit must be insl311ed tn..19 up69N of Pendent ppsidon. Stop 2. For Recessed Perloerlt Sprinklers. Lbe face of the sprinkler fdnq should be installed a nominal ar,' (2p mm) (:L3J8' !9.5 .,aril behtt•d the ceiling line. Adjustments are made via the push -on escutcheon. Step 3. Use only a non-haMening 0i,,e joint compot, no or Te:od1' tepe. Apply only to The male threads. Teflon is a rradernarx of :ha DuPcr r Corp. ENTRAP SFW, i3a Step 4. Hand tighten the -. the sPllnluer Into o Sprinkler U" an to havts rinklerWrench. tfte unit linenlralWrench, to b the ihliAleak-t t equires k i 7 ng. tgh Joint r ry to 14 tt lsf Systems by s 1'ified irisboot ^^ Length d time petyra- Ibs. of for 9ue(s S Ile r9 o fun,), a tangentialforceof141028ibs.(6?310 V4.5N) such k l 60bns can vary due to accesei. mlyr a+nbleM atmosphere, delivered through a 8•(rso,,w ! handle vrlN water supply. and mo activity. dellver ade0mte t Over 21 ft.-tbs. (28 6. Torque rt thelevelsmaythe 00 not a8arnpl 19 reassemble or Otherwise reuse a spd kler that tiesori6oeseat, resul leac1skage. 711eWright m leakage. P ght sPM'n r shall. per NFPA, operated. Replace e^y Wrinkler exhibit- in= corrosion Of damage- be oriented so the frarne arms are parallelMriU, dine branch lino ppe- always U39 new tur lera of the same type and lempere- as replecema,ts EEOIESLOVESFR Cortnbinatlon Wrench (Part 1f1073) Y Because the diiseharge pattern is Crrcal to prol8c"prh of life and property, nothlog srtpuld 0e lturg or attached to thespnnklerunitfftatwoulddisruptthe Pattern. Such obstrucfio,,, must bemreoved. In the event that ".1WnlctionhasalteredOleoriginalconrtguratltxt, additional sp,lrtklers should be Installed tonVinteintheProtectionlevel. Oo not attempt to replace sprinklers without rust remoying 'be fire protection system from service. Be certain to secure permission town ail AuVWrrpes HavingJurir, and mollify all personnel whomaybeaffectedduringsystemsr j excessive tempefguures At .Honeyyam replaced ed be, The miltirntxrh r YMV JWiwill detail regulation . lacertwnt rBgvlrements Sold Guarani": Central Sp.inkj., y willrepairarxVw'Wece arty uptsn_. o.to 06 oefogwo in rnat Prfal c workmanship within a Period Of one year from. the date of shipment Please rbler to thecurrentPriceLIsTforfurtherdetailsofthewarranty. Ordering Information Ordering Information: When Placing an order. indcate the het product name. Please Specify:he quantihr, mode!, style. orifice size, lOrnperahtre rating, type of finishorcoat;Al. and sPrir*ler wrench- fire wa1Gh du utdown. Avallab(( hy _W S1ylee: Central iSarecomrne 9 merntenancp pens nded precaution. spr,rhklers, valves, =r-969069$. and other Care & To remove the systern from service products are ava)lable thoDWho-A the 1de, first •efer to theoperatingU.S. and Canada. and Inlemationat,y. gumandvalveinssystem SnTh IMou9h a network of Central S waterbonDaineprinrimaintenanceR drelievePresswe ,n the pipes distribution cantors. you may wri[e Sprinklers rnusl be handled care#UNy. TheyshouldnWbeTransportedorstoredwhere amblenl temperature may exceed 100° F138"C. For best re-surts_ store them inadry, cod location on the ,Vral shipping Package. Do not install sprinklers that have been dropped or visibly damaged_ Sprinklers sboUld never be Painted. coated, plated, of altered in any other way from rnanu(ac- lured condition or lhey may not function Properly Any sprinklers altered In such manner must be replaced. The owner is lesponsiMe for The proper operating Condition of all fire proitUon devices and accessories. The NFPA Standard 25 entitled, -1,L pectior Testing andINairlfenanceofWater -Based F,-7v Prvlecbm Sysferrta', contain guidelines and mMamum maintenance requirements. Furthermore, the local Auftwify Having WndVVmmayhaveadditionalregula- ons and requirements for maintenance. 1106 lg. and inspection that must be obeyed. 01M Crntral Sprinkler Company Pr 90 in U.S.A. emove Irw exrstirq unit and install the duectly to Central Sprinkler Company, or replbcement, using only the specify Call (215) 362-070D for the dstriputor Sprinklerwrench. Be certain to Match nearew you. mcdel, style. oritit:e, artd temperature rating. Patents: Patents are penCing Afireprolect;o,t system thal has been shut tilt Sete• an activation should be Converalon 7eb19: returned to servico imrrmiOat knpw 1 Inch = 25,400 mm the entire system for damage ar4re ! foot — 0.3046 M Of repair as necessary. Spthklers that Ptace 1 find = 0.4536 kg yid not operate but were s rinkitorSbj6d to 1 fool poured = 1.36 Nm elements ementsof combustion or 8.8951cpS EENTRAL Central Sprinkler Company 451 N91h Carvgn Averk,o, L r,,dple. pA 19446 PHONE ( 215) 362.070D FAX ( 215) 362-53e5 0. 0689 bar 0. 0703 kgtcmr 1 U. S. gavon = 3.705 dm, 3. 785 liters Conversiuns are approxxrate. OPTIMA r" - a rV9510red fradernaric of Central SprinklerCorllprry. EL0 231 4 E.o-231 - svi 112 K-factor - S1WxJWd & Quick Respon" Uprlght A Pendent Pendent Fusible Solder & Glass Bulb Type mAutoatic Sprinkler Tyro Fire Products --- www.cenlra!sp.-inkler.com 451 North Cannon Avvnue, Lansdale, Pennsylvania 19446 -• USA Customer Service/Sales: Tel: (215) 362-0700 / Fax: 1215) 362.5385 Technical SerAces: Tel: (800) 381-9312/ Fax: 791-5500 Genera! Description The Central Model ELO.231, ELQ-231 BV & ELO-231 SVOR, 11.2 K-factor Upright b Pendent Intermediate Level Automatic Sprinklers are designed for use in sprinkler systems having spinklers at multiple'elevations in th9 same area. Intermediate Level Sprinklers are primarily dosigned for us-3 in rack storage sprinkler systems, where their thermally Sensitive elements must be she:lded Irom thr7 water spray o` nigher elevation sp.,l:ikIors which could operate ear'ier during a lire. Inteimecl-We Level Wrkiers are also used in applica- 00 .S such as beneath oper, gridded caNvalks: The upright version of the Imerrredi. ate Level Sprinkler is created using an r:u•Ight Model ELO-231', ELO.2?1 BV or ELO-231 SVOR Standard Spray Sprinkler and a separate head guard/ water..sheld assembly (WSa-2). Tie Pendent version is created using a penden: Model ELO-23i, ELO-231 BV or ELO.231 BVOR Standard Sprat 5iu'trtlder and a separate water sheil(i WS-2) that is -threaded on the 314" NPT of the sprinkler prior to installing the sprinkler into the fitting. 11 there is a possibility that the Model E1.0-231, ELO-231 RV or ELO.231 BVUR Standard Spray Sprinkler may be exposed to mechanical damage, a head guard assembly fG•2) can be added to the Sprinkler. These sprinklers are available w;th wax, .ead. or polyester coal'rigs, as appficat)lo. These coatings may be util"?9V to errecd Ihn life of coapar alloy sprinklorg heyord !hat which wou%l otkerwise he obtained when exposed to r?onosive 31mosDheres. Alncr,uph w..tx, leatt an4 polyester CG. I xi sF,rinhl9rS navy p lr.F.:q :he standard cerro8ion tests of the applicable approvalagencies, the testing is not representative of all possible corrosive.atmespheres. Consequently, it i$ recommended that the end user be consulted with respect to the suitability of these corrosion . resistant coatings for any givQn corrosive environment. The etlects of: ambient temperature, concentratlon of chemicals. and gas/rhernical velocity, should be coraldered, as.a min`•murrl along with the corrosive nature W.the chemical to which the _:prinkl,•rs'wiR- he exposed Operation: Model ELO-231 - A fusible alloy is sealed into a bronze actualiab rod center strut) by a stainless steel hall Wren the alloy melts at its rated temperature, the ball is forced upward into the center strut, re yasing the rNo ejectors and operating the sprinkler. Model ELO-231 BV & ELC-231 SVOR - The glass bull: contains a iluidwhich expands when exposed to heat. When the rated temWature is reached. the. fluid vxpa rds suff:ci.gnUy to shattvr.thN glass btdb, which then ailows the Wirlklar 10 activate & flew water. WARNINGS Tie Model F.LO-231, Sta291 i3v s ELO- 291 EVOR nlerme*diale Laval Sprinklers described herein must be instated and maintained in carrpli- onee with RNs doCament• a.,;'W311 as with the ApWicable standards of me National Fire Prniect,'on Associalion, in addition to the slaiidards of r3 y otherawhoritie3 hrrvrnyjurisdrrlinn Failure to do so may impair the Integrity of these Ck-wces. The owner is respnn.;dire for maintain• ilig them hr& prow,.Tor, system and dovices in proper operating condrhor. T he inslalri.,g contrackrr or sprinhlerr manuf4viurer should be• coatarlF>1 nralive rn any ytn+stion.. Intermediate Level Automatic Sprinklers I'•+ o 3-11.0 Nal,aw.gonance2dt,. 14Zi1 BV A ELOif0f &1 OR htlBrtite le Level Sprnnkkrn; must be m dritamed and serviced In aocordanoe wfth the fouovring instruictions. NOTES Before dosing a Are yr swoon systern main control Mho for mawgirnruice rrork on ltte fire pingacbon system it conbok, VWrrd5&tn to shut dow77 dre aNecrad nre p iotrcrion vyste-ns Burst be obtained trot» the F.roper euviod s Ar, 1"mannel veho may be afkded by this actlan must be mewed. Sprinklers which are found to be leaking or exht fto visible signs of con-os'o-r must be replaced. Automatic wd0jrays must never be sWpped or stored wfteie tholr tempera- turos Will SXZ W 1Ca°F/3M and they must never t" Palmed, 06ted, coated Of otherwise altered after Ieavirg thetEGtory. Modified or overheated solder type sprinkluis rra,is; 5e replaoe^J. Glass bulb spr!nklers thal have been exposed n corrosive products of Ccinbuslion• but have n-Dt ope-ated, should be replaced if they carii-M be completely Gleaned by w1ping the %pdnkier With a Clblts or by ftshing it with 3 soft bieAv brush. care must be oxerr3sco to avoid damage - before, during. and after instaUtion. Sprirtkiers damaged by droWgo, striking, wrench twisv slippage, or the like, must be re .aced. A19o, replace any sprinkler that has. a r:radced bulb or that has fist ligukf from its bub (Rot.-Irsta lla6on Section). FrecW." .visual tiwapectlons are FOCOnl111erid9d b6 krtitit;lty peltormedforwax, lead, aMW / ur P01YO ;ter coined spdrtklers. after the inna11atign has beets completed, to %sdly itte integrity of Is watt aldror lead ooBUr arberealler, annual inspections per NFF1A25 should sittflG`e; however, Instead of inz-peding from the float level, a randorn sampling Of 6011" p visual inspentiors should be made. so as to better determine R10 exact sprinkler cane tion and the long term integrty of the wax, lead, aWix polyester coating. as it may be aftected by the corrosive corxiitons present The owner is. esporlsW for the inspection, testing. and malmanartce of their fire Protection systern and drvicss in eornplianccl with this cowment, as wail 93 with 8're applicable stands of The Natiortat Fire Prutectior .4SSOCIaliol e.g., NFPA 251, in additions pwe standards of arty oiler auitrGritieS having )iried Ilion. The I•wstalling ca: rractrjr or sprit Ader in inufacturer r.:4-- Uki bo conWicled rl "w? to ary gaurllons. Wdirill. ft9d bi shed Warranty Products mEvKftC u W by. r*= n*.: Products are wartanlecf solely to the ' ori*W Buyor for tan (10) year:¢ agak* dvf" In meaorlittaid wotim rev. . when paid for and property metaled grid rtlairU- ' led under no-W. ' `± i4 soxAce. This wit Wjty: tiirill elµwtre ten (1 t)) years . from dale of shtww 1•py Tyoo F br Products. N warranty is gwn for' products or componertfa nvvAgedured by coirq **% nd dffiated by awrw#;hb with Tyoo Fke Prodirclg of f X prodim aril coarponentg ,vtiktit have boon 'AJ a to misuse, krprpper k tlprt, 00606lod, or. wfic h have rid been lrwtfd4 wieint~ mooieed or. reppkW In socordavnce with appp pf r la.Standw s of th.,eyRt a{{..it nel Flm r „'leclon Associatim, a b e standards of any other Aitlttoran Havtrig Ju adcborc Materials found by Tyr..o FeF Products b be defective Shelf be e0ier Warred or replaced, at Tyco Fire. Products' sole option. Tyco Fire hrtxk=s neither assumes, nor authorizers arty person to awime for ft, any other obligation in connco4on with the sale ol pirodxft or Parts of producis.'Tyoo Fire . Products shalt riot be mWoneibse Tor sprinkler system deeign. onlom yr irm*w role or iririumpiritg inlon yWSM supped by Buyer or Buyers repre6ant riv s, IN NO EVENY : 4-iALL TYGO FIRE P-RODUGTS BE LIABLF, IN CON. TRACT, TORT, STRICT LIAWJTY OR UNDER ANY 0TI4ER LEGAL THEORY. FOR INCIDEW.AL, Ih1DAECT.SPECIAL' OR CONSEQUENTIAL DAMAGES. INCLUDING BUT NGT si IED To LABOR CHAnMs, FibGAR ) USS X- VMEt}-R TY04 FIRE PRODUCTS WAS INFORMED Aq= T Lt f'O.FSj BLn v OF SUCH DAMAGEA, AND ti t NO EVENT Sf LL T- YCO FiRE. PRW- UCT8' Ly"ILM D(CEED AN AMDUNI- EQUAL TO THE SALES PRICE. odder,• uta fiyl produa two. AVOW si o* the quwAky, mar el; Byte. cam size, tatripertt s raking, type ol rirdh OF Coaling, and st;+rir!4derwrgryA Ref Numbers. opre Isf tx cohit of FWI t'arbn is a hMMmadrof ft aftrit Gal. DRY SPRINKLEI Luminous Standard dt Quick Response Dry Sprinkle; h" (15mm) Orifice, 1" NPT (1C=-5 XXXX - X X X - "A" Dimension 3230 1 L—in mn Dry Pwoov 1- NPT 1 Luminous Dry Pendcrr 1• NPT 3232 Lumirous DryPender l 1- NPT 2-Pc. Recessed Esc7Adwm 3233 um LiroasDry UprV 1- NPT Sprjnder 0i 3234 Lumiwus DryHSw 1- NPT Standard ESCUIOMM 3235 Luminous Dry HS Fxt m 1- NPT Standard Escuktw n 3240 Lumious OR DryPendent 1- NPT 3241 L. wnious OR DryPendent /- NPT Deep Ce&^9 EsaAcheon 3242 Liwr xw s OR DryPendent 1- NPT 2-P EsaAdreon 3243 Luminous OR Dry tWgtd 1- NPT 3244 Luminous OR Dry HS1N 1- NPT Standard 3 4 1 M1( 141M 2 15 317 4 217 5 286 6 360- F(182- C)' E)ample; For a dlromt'./ctlrome firwsh Luminous Dry Horiwntal SWewap SprinIder. standard response pipe length of 10-1/ 2','and an operating temperature of 135-F ( 570C). the correct order number would be: 3234-111012-f to- 1l2") V NOW: Orders to be placed in 1/ 4' ilcrements. Model 323aW40 Data sheet reference number. Model 323113241 Model 323? M42 1-6 2 11/ 1 6221 Data sheet reference rxxrlber: 1-6.2 11/ 1-6.221 OHta sheaf relererrce number 1.6.2 1111. 6221 Model 3233/3243 Model 323413244 Model 3235 Data sheet reference rwmber1-6.2.31/ 1-6.2.41 Data shoat reference number. Oats shPe1 reference rM' r 1.6.3. 11/ 1-G.3.2J 1.6.4.10 Phone: (414) 570-5000 or (800) 558.523G - Fat (414) 510-` IO or (800) 87"1?95 - Stanp"kr PAeCK coin 44 Quick Response Upright, Pendent, Rec. Pendent, Sidewall & Rec. Sidewall Glass Bulb Automatic SprinklersManufacturedby. Central Sprinkler Con pang451NorthCannonAvenue, Lansdale, PennsyMania 19446 Product Description The Central Model GB -OR b GBLO-OR Automatic Sprinklers embrace the ultimate in advanced design features, They incorporate the I 1 NFPA Standards, They are available in I / - 03,Smrn), 'k' (12.7mm), and'/.- (i 1.1mm) orifice sizes and 1359F (57-C), 1559F WC), 200'F (930C), ant 250'F (121-C) temperature ratings -The Model GB-QR b GBLO-QR Sprinklers are available in Brass, Chrome, or White and Black painted finishes. tech a est to glass bulb Operation. The glass bulb capsuletechnology. which result in a much smaller, operating mechanism contains s heet- more attractive sprinkler. The operating sensitive liquid that expands uponmechanismconsistsofaliquid -filled 3 mm application of heat Upon reaching the rateddiameterfrangiblecapsulethatisonly20temperature, the frangible Capsule rupturesmminlength. thereby releasing the orifice seal TheTheModelGB -OR & GBLO-OR sprinkler then discharges pre - AutomaticAutomatic Sprinklers are intended for n 1 water n a e- installation in accordance with current ined spray pattern tol rlhol or extinguish the fire. Technical Data Model a orifice Deflector and Temperature wed Standard Thread Style K-Factor Rating Escutcheon Approvals Size NPT' GK0-OR LJP,i^ "/a (115 rrrm) 155•F&B-C ELO RecessedPendenta8.0 (1 t4 metric) 200'FAWC Rec. Pendent 250'F/11M Supporl ctrorne. a ' F714 W4' 20 mm) CUP 12.7 mm) 135•F/57'CFOR5.6 to0 metric) Uarim a a 155`F/68•c Brass, UL, ULC, Pendent '/» (11.0 mm) 200-F/93-C '- Chrome, a a MEA 1/L' 42 (60 metric) 250-F/1 /6•C Painted 066-92•E Volll) 15 mm) GB -OR 135•F/57•C Upright a '/. (12.7 mm) 155•F/68-C Brass, Chrome. a Pendent 5.6 (80 metric) 200'F/93•C - Painted FM 1/2' 250-F/1/6•C Pendent 15 mm) 12.7 mm) OW 5.6 180 mebic) 135•F/57'C GB ResJ ORRecessed Brass, UL. ULC, 155•F/68'C Pendent '/» (11.0 mm) 20VF/93*C WPDrt'eupSuppoACup a a MEA Painted 1/2' 15 mm) 4.2 (60 metric) 466.92-E VoLlll) GO -OR 135'F/57•C Recessed ; (12.7 mm) 155-F/6B-C Vented Rec. 5.6 (80 metric) ems• Pendent 200'F/93-C Support Cup•• Chrome, a FM 1/L• GB-00 — Painted 15 mm) i •F c GB Rest on 5.6 (50 metric) Recessed Brass. UL. ULC. I/rsioe.all 2110'F/93•C SAWPaI cup chrome, a a MEA Painted (466-92-E VoLllq 15 mm) GO -OR ••• '/r' (12.7 rnm) 1•F/57-C sidewall 5.6 (80 metric) 15535•F/68•C _ Brass a FM200'F/93-C chrorw 15 mm) 1ir"p'rO1 dn9 pressure 175 psi (12.1 bar, The '& (12.7 mm) -W_ Upright PendentRecPendisULandULClistedwithama>omryn rrwfvrg pnz$U aIP-W and of 2W Psi (17.3 bar), Available Won Factory hydro Teat 100% ® 500 psi (34.5 bar) P'airoed Vendors are 1/1, cUl• and ULC listed as'Conosiwr ResistFAYA4pp1AroralIonNcc. Pendord sprit f ora regoiras the useParl W Wnrdders. of a vented suppohM71Chrome. 93072 Brass. arrd M73 Whhe. cW. Ga esSFewwa# d rocual sad ;idowaD Is UL and ULC 651-d rot I ig/d and Ordinary tiaiordis6rnitadpl.roval to ligld Hazard Oct 'aicios unty. 17/32" (13.5 min 1 /2"(12.7 MM) 4 7/16"(11.0 mm) Orifice Automatic Sprinkler n GBLO-QR 17/32" Recessed Pendent 1 2 3(4'(50.8mm) Min. 1 21/4'(572mm)max. j SUPPORT 1 / CUP 1 I Model ELO —-- Rec. Esctllclleon I l 1VU1N3z) f N ; I I i 3 1/4' 8l3 mm) GB-QR 7/16" & 1/2" Upright &Pendent 1 1/16' Pirtle kxkates 27mm) 7/16' (11 mm) small orifice sprinkler ly1 1/2. (SO mm) Ire (50mm) Pintle indicates 7116' (11 mm) ( 27 mm) small orlfKv sprinkler to GBLO-QR 17/32" Upright &Pendent FINISHtU CEILING LINE GB -OR 7/16" & 1/2" Recessed Pendent 2' (50 mm) Min. SUPPORT 2 1/4' (57mmN) Max. / CUP GB AesJ'OR FACE OF REDUCINGF.sallt leon COUPLING W4' (19 mm) Max. ' 318" (95 mm)Wn FINISHED CEILING LINE Pintle irrdicates 7/16' (11 mm) snap orifice sprinkler 2 TV 73.0 —) SuPPOd cuP for Model GB OR with FM Approval has slots in the IacO• the standard U.L version does not, 7 J1," 15 '98 10:35PM W1T ST LOUIS SALES P.Zi4 BU.LL MOOSE YUaRj3o)E Schedule 10 and Schedule 40 FM Approved S ' . pp Sprinkler Pipe Bull Moose Tube Company is a recognized producer of quality pipe products. Our Schedule 10(NPS 3/4"-3") and Schedule 40(NPS 3/4"-2") are FM Approved, even though these products do not require separate approvals. Bull Moose Tube made the decision to have them approved for your peace of mind. Our Sch. 10 and Sch. 40 have been through the same rigorous testing as .our other fine pipe products. Bull Moose Schedule 10 Pipe Vibe's Sch. 10 and Sch. 40 pipes are made to ASTM A 135 and ASTM A795. These products are supplied With our Durs . Shield 30 tJV lacquer coating but can be 3Lpplied without the coating so they 'can be hot --dip galvanized to meet FM requirements for use in dry systems in accordance with the zinc coating specifications of ASTM A795 or ASTM A53. I NominA Pipc Siic O.t). I.D. Npm, Wall Wcight/F1 Oundlc Siu 314" 1.050" 0.884" 0.083" 0.857lbs/fl 61 1" . 1.315" 1.097' 0.109" 1.40lbs/ft 61 1-114" 1.660" 1.442" 0.109" 1.81 ibs/ft 37 1-112" 1.900" 1 1.682" 0.109' 1 2.08 IWO 1 37 2" 2.375" 2.157' 0.109" 2.64lbsKt 37 2-1/2 2.875" 2.635' 0.120" 3.53lbs/ft 37 3"' 3.500" 3.260" 0.120" 4.33lbs/ft 24 Schedule 40 Pipe Nominal Pi t Sits O.D. I.D, Nom. Wall Weigbt/Ft undlc Sizc t 3/4" l 1.050" 0.824" 0.113' 1.13lbs/ft 61 1, 1. 31 S' 1.049" 0.133" 1.68 Ibs/it 61 1-1 /4" 1 660" 1. 380" 0.140" 2.27 lbs/ft 37 1-1 /2" 1.900" 1.610" 0.145" 2.72is/it 37 2" 2.375" 1 2.067" 0.154" 3.65lbs/it 37 For edodional Information, oontact your 18191pIrroon today at (000) 325-4487 or (314) 537-2600 In the U.S.A. or from Canada call (800) 882.4866. ME T. ct ul c An ® 9001 WAMIb cwVw lr PRODUCT DESCRIPTION FlmLoc k St& 0% rigid cou- plinq hies a unlgne, patented angle -pad deslgn Whkh allow" the bouadngs to Qum whUe damping this grooves. By permlttirg the hou*W 10 SWO on the angled bolt pads, rigidity b obtained. F0gniM DIMENSIONS Rated at 175 PSl (1200 kPa) for wet and dry•sprinkler systems; Schedule 10 roll grooved or Schedule 40 cut or rod.grooved steel pipe Style 005 is rigid and does not permit expansion, contracuon or angular ellection. S 13 1' T Tj_• Style 00 FireLock Rigid Coupling The FfmLock "system pro- v$dW rigidity for valve con- nections, are mainm long atralgbt runs. Support and hanging requirements correspond to NFPA 13 Sp[lnkler Systems. Angle - pod design permits assembly by removing one nuVbolt m scissoring the housing over gasket. This reduces comp nents to handle during e"kWY: sPeeds and ease: installation -on PiPe grooved to Victaulic specifications. v-craviic Company of America - P.O. Box 31. Easton, PA 18044-0001 • 4901 Kaaslors-Aae Rd., Easton, PA 18M - 6101559-33300 • FAX' 610/250.88 r 7 S O,OCh G Otli! 95 IG&A 7/45 • M,Na er.p 7r myY VI[L n++e0 n l: ; iNkCompanydMrwi;a O C:az+y yr.i 19p5 N:'aWt Clroa.y d An.y+w I ctaul:c' PRODUCT DESCRIPTION FlreLodt Products comprise a unique ey9tm spedflm W 1 designed for fire pmtecUm services. AmLodc attinps are a CAD -developed, bydmdy- namlc design wbkh have a shorten center -to -end dlmen- sion than standard fittings. A noticeable bulge allows the water to make a smoother Patented w DIMENSIONS P" Non11t1O1 /1ctw1 Ska sue 1 1 1 Y• 1 1 32 2 Z375. 50 eo 3 No.001 2t4 Z875 3.a 65 73.0 m C1oE»1 3O.D. aoa010 II I 3 3.500 . 100 1143 e s 5 5 563 125 141A No.002 6 C - 150 lee.3 e 8.825 2w 719.1 CqE No. 003 3.13 79 3.38 se 00 102 ea 12 5.60 1a a.81 t73 C b E Wei Inches Eat wn Lba. 70 0.1 I 1.4 Lac 14 tum to maintain the same Am chmmerlsocs as start- dwd fuA flaw flahQs. FUeLOdr Style 005 rigid cou- pUnp bps a unque. petented aD*p Doti deWp wbdcb allows the bw3Wps to offset while damping the grooves. by permitting the housings No. 000 4S• Ebow CODE W0% Inches Eac wm LbaJ 510 W Z25 2.2 S7 1.0 1.e er a0 7i 1Z6 &a b 7 83 W3 3A e•3 e1 16 4.2 9.3 FireLocl Fittinc to slkde on the angled bol Pads, rigidity is obtained. F1reLock fittings are designed for use excbsiw With St* 005 FireLocic cc PUMP. Use of other prodw My resuh in bolt pad Interference. No. ON No. 006 SWWW Tie COP CBE welum E fo E WN6 111t:I1es Each 111e11Os Eac ra 1 Lb6Jwq am LbsJ 0.88 0.3 22 0.1 0.88 0.4 22 0.2 2.75 Z4 0.88 0.6 70 1.1 22 03 3.00 3.6 0.88 1.0 76 1.6 22 0 S 3.13 3.9 71 1.e 3.38 5.3 US 1.2 ed Z's 22 OS 4.00 8.7 1.00 2.4 m 3,1 2s 11 1. 1 1.00 1. t 124i?• 7.1 2S i•1 22.7 ;I 1.00 5.9 110 3 25 2.7 1.94 38.7 1.19 12.7 170 17.e 30 5.e ViclavGc Company of America • P.O. Box 31, EaslOn, PA 18044pQ(ii • 4901 Ke341er9vt0e Rd., Eamon, PA 18040.81CV559-3300 • Fes' 1,1p/,,0-8817 SO.UF 1: fd)7,95 :OMI 7/L6 Orir ia•p Tl•Owt i...nsJ^' 74 rVlcto At Gvr:ry d nc ^nwao Cct+K Jr iP75 Vlc:,vJ:c Comperry d nw•c: Threaded Fe#tin Ductile"'Iron ANSI B16.3 Perrnsylvanla 1t te spr1rikler ComWW Product Technical Description Data Central Sp" DucWe Iron threaded Modeb 811, 812,.813. 814, 815, 816, fittings conform to ANSI 816.3 and 817, 818,:$m, 825, am, are higher In strength and more 827. Wl 718 corrosion resistant than cast Iron SW: Elbows, Tees, Unions, Caps, fittings. The additional strength is f xtensbn. Pieces. Bushings, Provided by the ductile properties of :and Pkw the steel making up the fitting. This fs APProvals: U.L, U.LC., F.M. accomplished as it Is with all ductile (So* CenW SPAsvbmftW sheet iron by adding MagnesJum while -the f *X&" LlsWWApp mW IM"w iron is stir hot. This provides an advantage as the fittings are not as Wrench: Standard Poe Wrench susceptible to leaks or craddng and Thread: N.P.T. they are also fighter than standard Material: Ductile lron cast iron. e Pressure: 300 psi Weis Caution: Installers who have not Q : royals usedductileIronthreadedMingo _Vpp before shouldbeInstructedtfnatthehitting Is atronger.than the pipe SSW over- Ughtening the fitting can CMts leaks and cause damage to Pipe threads. In gomirid, them Is about one - halt a turn dMorent* between cast Iron and ductile Iron fittings. Apply Teflon tape or pipe Joint compound on the pipe threads and tighten two to three tuns beyond hand UghL See Central Spririk submittal street for axed Usting/Approyal kt w=tbm Installatiol Apply Teflon I" or pipe joint compound on the pipe threads and tighten two to three turns beyond hand tight. Rfl pro. 21. 3.0 i Fire. U-ept.N_____ Connection With wall plates and -breakaway caps an-;,taclureo by: Central Sprinkler Company vonn Cannon Avenue. Lansdale. Pennsylvania 19446 Product Description e Mocet 86A (straight pattern) rooet 868 (90_* pattern) Fire z-ar"nerrt Connections (FDC) are h' x 4' single Clapper a --ese•rype connections. They are s.y-ec to Provide a supplementary ppry connection for automatic systems of all types, as ec oy NFPA 13. st:aignt and 90- panern Fire c__:!7rneni Connections are cast grass clapper. brass swivel s ano a brass hinge pin. The TO SPKR' and 'F.D. a: a cast in raised levers on ne Fire Depanment a :.eCPer oesrgn allows for one ets to be pressurized during epanmenl Conriect ons are. a y :nstalleo 18' to 5' above s-ee graoe, nowever local codes stanoaros may contain special eme ts with regard to specific C a::or e(ali Plates e Walt Plates are constructed of rosron resistant aluminum alloy cast -in raised litters. The, raised e7ers on the round Wall Plate are J SPKR ' and -FIRE DEPT. s. _ C_ Caps The breakaway Caps '-! the protection of the 2'h' inlets on the Fire Department Connection are supplied In heavy-duty plastic or cast aluminum alloy. They can be easily attached to the'swfvel logs of the Fire Department Connectlon using the eye bolls supplied with the Caps. Technical Data Model: 86A (straight pattern FDC) 868 (W-paltem FDC) Size: Outlet - 4' (wmrry N.P.T. Inlets - 2W t64 mm; N.H. Std. thread Approvals: V.L., F.M. Maximum Working Pressure: 30o psi Standard Finish: FDC - Rough brass Wall Plates - Red enamel paint with raised letters painted while Caps - Red plastic or red enamel paint Weight: FDC (straight) - 7.8 fbs- (3.S kp) FDC (901) - 9.3 W. (pzkp) Wall plate • 11,0z. (sr?yranu) Cap - 3 oz. (as pans) Mfgr. source: Non -domestic Dimenslons: Wall Plate - 93/40 (248 mm) O.D. 09 Nv, 28.7 D 8''OPOT-T-E—R_,BELLS PBA-AC & PBD-DC DIMENSIONS BELLS FIG. 2 WEATWERPROQF BACKBOX BOX HAS ONE THREADED Vr CONourr ENTRANCE IFm T owG ns-z FIG. 3 WIRING (REAR VIEW) D-C. BELLS (OBSERVE POLARITY) W.0 00 MOWccwnKk P ML on 00-W-Lw selmolc M, O O.LIL71bCiq 3LPOWW0" IS MUM M N AM Wr LLA W AS 3147W NOTES: 1- ODSERYE POLAR"Y TO RING D.C- 6ELIS. 2. RED WIRES POs1TWE (t). I DICK WIRES NEGATIVE (—)- DWG- 1776-3 A. C: "BELLS WNW MW emon onsum Wo OL 0 ram= M Ol=MWJI UMDM=" IT RMMM USE 11 00 OW LEAW 03 3HOW NOTE: 1• W"Of MM U ST 6 X- 0W—% TFAW X CAM EXTRA TM M SEPARATELY 2. AFM P*- or—W M:YS 0R 15 NGT PVXMW Of A.C. 601.3. INSTALLATION 1- The bell should be mounted a minimum of 8 ft. from the Poor or as dose to the celling as possible. 2. Remove the gong, 3. Connect wiring (see Fig. 3). 4. Mount bell mechanism to backbox (bell mechanism must be mounted with the striker " down). 5. Reinstall the gong (be sure that the gong positioning pin, In the mechanism housing, IS the hole In the gong). 6. Test all bells for proper operation and observe that they can be heard where required (bells must be heard in all areasasdesignatedbytheauthorityhavingjurisdictionPAINTED IN USA ' •885000 MKT- 1- REV K PAGE 2 OF Y I MFG. 96400776 - 4OV4 i Universal Beam;.Xftmp i with Lockeut Mod•1' • Rod 8cd. Wt. Prl000 Prlowe 16 enlwnd .a. Cslenpe wn d•• t! ' wew 1re rrew b brimoreNo. size box Each Eaoh ' : 'Ea9b wtta6oMcn wet odoprobllgv eo.e of1 Plain &O. Mel.rbl7pe kalfwwa: Moieobletnw-Crude 36 1 w 100 99 Y2' . 377310e bw - Grod43-43.17. OwfUdeen"--b. lobweroiwLOWwdf-A 60 77 $ 1. 22 1 71.92 fiOorr Ope 3/4 ffod..e l 36 60 .40 '. $2.90 .. $4.04 ^'1kWe1 f1" 1719 wood M mdodrren 3%rKfw&m6*m e 36 3/ 4• 26 .77 i4.43 $7.06 S 4f f rf+ 1tl 1 N919: Vt litlwd d FM Approved. Approved for baA Top Ioorw and Iolbre powbionw. Fig. No'. 35, 36 I O Fig. No. 35, 36 r. DIMENSIONS IN INCHES Fig. Rod sls• A e C D B F O H Load w Ratin# 5 36 I1- 1• 4 4 1/2 1. V4 1 • 4 1 • 1 '0 1 y8 4 1. 1 3 Opp 135 y8 1. IM 1.V16 y4 1-W 1 1.1/18 1/2 Y2 Load 1 6mf 35 3r4 2.3 8 1.4/!0 y4 1-y4 1.1/9' l•6/16 v2 7/ld 1•U4 boor I Wide Mouth Beam Clamp with Locknut lot- 1 Model Rod 8td Wt. F74cve F11o•e 1A. edrwnd boor. C rlerrrj,e ore d«:pn. /..d, No. also Sox Each Each Eaob pro bwrww Bebra eose wbwngdy eo" 01 A P1aLo X0. bwkiafow ewi •dopwoiiYy. 9 37 60 .43 31.20 1.74 MwbrA13rodkoKwr.: Modeobte bow - Gredeje i 77510. M- OU boo - Gro& 4S 12. Iri..+.4: Ibdrr.• riMn' bborwbiw idod and v c 37 1/2' 60 .41 1.40 2.28 I bjL lh tw4rd 6f PT. 3/ 4 WW* 171E vend Alwwioowren Sbed'3od*3"rrrrpe in TNoww Vt li leddFMApprovedforboll Top/j, n posWmi"Vt Listed 6 FM Approved AarTop boom posilioa on17 Fig. No. 37 Fig. No. 37 Roo Su• BEAM C-CLAMPS ARE DESIGNED FOR DEEP FLANGE ROOF SUPPORTS SUCH AS Z-BAR, MACOMBER AND BUTLER SUPPORTS Rod Fir: 91ae A B C D 8 F O H Load W Rating Fig. No. 503 2 Pressed Steel " C" Clamp with Locknut . Rod 8td. wt. Price eb.i- WA iw.i 91se Boa BachSackpowwwaerr, fbdslc blod r I 60 1.00 weel'' Wwwrowe' taborow w Wood erd R •; 40 hoory Me4vol Approved. T _ yr 60 4a s1.ea b lbedwnd 3 JL- 4r8' 26 703Z$3 Fbeoea, can 6 AKwidnd VA WWA b pw v-w ' 26 E3 i8.? 2 bO1"'1"0 dw b vrbro4wti doom elernoYny IAe r ' o 20 1. 4 9.80 Model Nurwbw, Rod Slse. - A r: L 0 - A DIMENSIONS ININCHES 0 A 8 C D Load 44' 7B. 7- 4' Y- _ 1 8' 630 1200 Per=groove:, swivel- Ring- Hanger -- IVFpA = r PIP* . 71od 911& Blsi 8Lz* ... Box F.ownT ; r Wt. O 9-11 Pr1*. 1[rob Argil" In rod gigs Wr 14FPA AfVC3W ' 700 10 JJ 1'Iwodwd •- I hkl" N G-po 1.1/4' 3/8' 00 12 Sh*I 8 c 1 100 IJ 36 AMOVAM-A I-1/Z' 0 d 7 Und*rwrlwirloborvlwi*s SSW J 3- VI 3/8, and fodbry mvw 60 34 20 Je 91 colicn WW F1 171E (Type 6' 20 06 1.84 10) and MorvFodv*rt dr in, 20 70 1.ae • 3londordi:olion Soc•f SP-67 a Type 10). .. i'o enl Pending Q 00-0 1 M Fig. No. 1 ti.t.dby U&W App-milbyUnderwritwiloborororioi, Inc. Undwwriwe loborvloria Foctorp MoN J Itoswrd+Corp. 01 Condo DIMFNSInU-, IAI lmr-urc Tubing Fig. Nlo. 52 Ube Size I:R_ Vs l 3 3• VL I 0•r i / 7I m,v /' 0.0,10b1. 6, 3/8' rod, Copper Tubing Adjustable S.wive_l..Ring Hanger, R . Sid. wt.6.1 PYIo•:r Giww*1Pwp.. BoxF,roh- "Hach.' P*rT•1'IrY A 007trems1/T rv*r9'r I' n P« — 100 . 11 J .ed go Ilk t:orbcw -4..I.c" copp.r C I S 6 1 67 100 . 16 J '.7! rrd Mwwl.ew.n, s 1 ondwdwjaron60 Isocket. fly" >. w. p.nuo„- 60 -40 S3.2f 41 m- iir„bt.d «y rop,.r , 46I , or+ wl 3Pwdl 11wvwibw «rd rorrird M6ip rim DIMENSIONS IN INCHES D C 8 2 I.1 l8 A Lord' Rating- 2. 7 3•I/4 400 z 1- t a 7. 1. 7 8 I, 2(_ 8___ 16 1400. 10r9.r 1493 0r0101061. vpvn r.gv*61 e I a 0..PO.ff-..E-R SELLS PBA AC & PBD-. roger trecafc signal Company - potter electric signal 8 Mfg-. LTD2081CraigRd./P.O. Box 28480 St. Louis, MO 63146 - 19,671e311e Street 314)87843211(600) 3.25-3936 : Don Mills, Ontario, Canada M31321 416) 441-1833 UL LISTED, FM APPROVED 6" BELL SHOWN Sizes Available: 6'. 8'. and 10- Voltaps Available: 24VAC 120VAC 12VDC (102 to 15.6) Polarize 24VDC (20.4 to 312) Polarize Service Use: Fire Alarm General Signaling Burglar Alarm Envfronn ent, Indoor or Outdoor Use (See Note 1) 40" to 1501F (outdoor use require weatherproof backbox) Termkmtlon: 4 No. 1 %AWG stranded wires Finish: Red powder coating WW"N"; nlwer Ist1K-1 weauierproof bacwox These Vibrating type bells are designed for use as fire, burglar, or general signaling deylces They have low poweconsumptionandhighdecibelratings. The unit mounts on a standard 4• square electicalbox for indoor use, or on a modeB8K-1 weatherproof backbox for outdoor appilcat10113. ALL DC BELLS ARE POLARIZED AND HAVE BUILT-IN TRANSIENT PAoTFr_-nr *j- SIZE VOLTAGE MODEL NO, STOCK No. Cur AEM tµAM Ti MAL do MppMUM de 6 01t FT. 019 FT. 12VDC P00128 1706012 12A 85 e 12VDC P8012a tT06012 1ZA so 75 10 12VDC PBD1210 1710012 75 6 24VDC PBD248 1706024 12A 92 75 e 24VDC PW248 17ON24 06A 08A 87 75 10 24VDC PB62410 1710021 91 79 6 24VAC PBA248 1800024 e 24VAC PBA248 1808024 17A 17A 91 01 75 75 10 24VAC PBA2410 1610024 17A 94 75 6 12VVAC PSA1206 1806120 05A 92 82 8 120VAC PBA12pe 1808120 05A 08 82 10 120VAC PBA12p10 1E10120 05A rJ9 as Weatherproof backbox model BBK• 1 Sik. No. 1500001. NONE: 1. M'rwmxn 08 ratings are cakulaled from Integrated sound pressor+ Ineaattraettetlts ,ty M Undwwrk LaDoralaisa as apactped In UL Standard 164. ULtemperaturerangeis •30- to 150•F. 2. Typical 06 ratings ere cakutaled from measurements made with a oprtvarylp, aOVld ravel end are Indketiv0 Or outpu levels In an actuef k+Nallation PRINTED IN USA IODINE MKT.I8850001 REV K PAGE 1 OF 2 MFG. 05400776 - 4,V4 E),POTTER MODEL. PS40A HIGH/LOW PRESSOR E SWITCHES Potter Electric Signal Company Potter Electric2081CraigRoad • P.O. Box 28480 1967 Leslie Street 8 Mig. LTD St- Louis, 32 63146-4161 Don Mllls, Ontario, Canada M362*3314) 878-4321 • (800) 3253936 416) 441-1833 UL ad CSFM LISTED, FM and LPC APPROVED, NVMEA ACCEPTEDMODELPS40APRESSURESWITCHFORMONarfORING H1GH ANDIOR LOW PRESSURE VARIATIONS Dlmonsiprss 4 3/4'W x 2 1/4'D x 4 3frH Enclosure Cover - Die-cast with WNW red powdercoat idsb Bass - Plated Steel PS40-1A lie Switch- Stk. $1340401 2A Double Switch - Sik. iY13404 Pr NW— Corrrrectlon: ire NPT Male Factory A*nlme t PS40-1A: Operates on decrease at 30 PSI PS40.2A: Operates on b cF9030 d 50PSk and ondscrease at30 PSI Pressure Ranee: 10 -175 PSI 141"If um WllerwMlak Approx. 2 to. O 20 PSI S be. O 175 PSI MaxMrwra System Pnesunc 250 PSI Switch Contacts: S.PA.T. (Form C) 10.0A O 125J250VAC. 2.5A O 0 - 30V DC One set In PS40-1A. Two sob in PS40-2A Envtronnw a SpecMcavons: kwoor or outdoor Use NEMA 4 Ratod Enclosure Temp.: -40" F to 140-F/ -401C to WC Not for use In hazardous locations) Seri" Use Automatic Spriww NFPA-13 One or Two Family DweFarp NFPA-13D Hestderrtial Occupancy up to 4 Stories NFPA-13R National Fire Alarm Code NFPA-72 Tarrwer: Cover inOM Metes tamper resistant lasleners that require a spacial key for re wrA One key is supplied with each device. For oP W" oavar tamper switch Wt, order Stock SOM134. The Porter PS40A Series are pressure actuated switches de- Dry System: Connect PS40A in air supply line on the system sidesigr>adprmar9yiodelscta10PSlinCmaseand/adecrease from of any shuloB or check valve. normal system pres4we in MAornatic two spri -ild" systems. Provision for testing the unitcan be accomplished with the TYPiCalappacatiorwareairpressuresupervisionindrypipeinstallationofaPorterBleederValve (Model BVL) in the fine to the syilemsand pressure superrisionofprassureftnks,air supply or: PS40A. wafer supply. INSTALLATION AND TEST PROCEDURES MourNi V Device should be mounted in uprigM position (thread- ed connection down). Requires NEMA type 4 conduit hub for outdoor installations. Testing: The operation of the pressure supervisory switch should be tested upon completion of installation and periodically lhere- alter in accordance with the applicable NFPA codes and stan- dards and/ or the authority having jurisdiction (manufacturer rec- ommends quarterly or more frequently). CALMON9 Testing The PS40A may activate other system con- nected devices. PRINTED IN USA MKT, 0"10002 - REV G PAGE 1 OF 2 MFr.#5400924- MS E),POTTER MODE. Psl of PR Potter Electric Signal Company Potter E ESSURE .SWITCH 2081 Crab Road a P.O. Box 28480 186710 5 16 Mfg. LTD St. Lail*, MO 63IZ161 314) 878-4321 • (800) 325-3936 Don MAIs, Ontario, Canada 1613M 416) 441-1833 PS101 S1n icA - SUS. No 1340101 i 0-2A OowNe Switch StL N0.1340 INSTALLATION AND TEST The Potter PSI OA Santee Preaaure Actuated Switch" are dealgned for the detection of a wawrAow cwxllOon In aul nwft pre a'P*hidar widerta Of particular do Ww ouch as wet oystWM with alarm dwelt VAN" or dry PipeaSWMTheymayalsobeteedbProvidealowpasewerAorys+Whd. TheymaybeadkJOWIooperateonpromxo *Wls" 4and20PST. MOUMMIG: Device should be rnounled in upright position (Threaded connectiondown). Requires NEMA Type 4 conduit hub for outdoor k atepaoona. TESTM: The operation of the presstxs alarm switch should be lest" talon completion of W*ufta"m and Perbdlca11Y Mherealter In accordance Ate 1110 applicable NFPA codes and standards and/or the arChpfyhavkp 1"ac1ion (manufscU0( recorwands quarterly or Inge hrgWer*y WET SYSTEI,t: METHOD 1: When ushg PS 1 OA and control unit with retard - conned PS10A hto alarm pod p"M on VW hptn side Of retard dumber and eWbtaly cOnnect PS10A to control unit that provides a retard 10 compeneare br surges. moor o fas t no shut off valves are pretend belwsao fhewarmcheckvalveandPSIQkMETHOD 2` When using free PS l OA for Iocal bet application or wib a ULand CFSM USTEOr FM and LPCAPPROVEo, HYMEA ACCEMDlmenelone: 4 3/4"N x 2 IM D x 4 3/8'H Encfoewe: Cover - Die-cast wrote textured red powderwat riniah 86110 - plowSteel Preesve COnneellm W NPT We F6" wy AdiueUrmsE Operates on Preeatrre kxxease al 6 tt PSI Operal" on Pr w" decrees at 5 t 1 PSI Miltlawm DVIonwAlak 1 PSI MaklWim Sydmn Pressure: 250 PSI Switch Contsds: SPOT (Form C) 15- 0 AnVe st 12WSovAc. 2.5 Amps al 0 - 30VOC One set in PS10-IAA Two sate In 1`810-2A Environmental t'apecMc&tfonet Indoor or outdoor use NEMA 4 Rated Enclosare NOf oral toad) -401C to 60'C Service UW Aulomstl0 Sp*Wn NFPA-13 Or* or two tarrilly dwe" NFPA-13D Re slOreMlal e rOWUPW r UPI* IM stories NFPA-13R P Alarm Coft NFPA-72 Tamper: Cover hccrporateo tamper mGbtW MSteners fhal require a apeclef key for r WftL On* kOy is AVPped wish each device. For Optbnal cover tamper awgdh Idt. odor Sbdt No. CM134: control Ihat d0M not provide a retard Ieakire-IMPS 10A must be IrwwW On" alarm Outlet abe of the rewd chamber of tie sprMer system. TESTING: AcoompbMd by. opw*V She Inspectors K"-&* I" valve. Allow *to to &aVwn ate for system or control retard. CAUTM WOW 213 not applicable for rornots station service use. WET Syzi I WITH EXCESS PRESSURE: Corhnect PSI A Wo alarm Pod Aft exten&V from alarm check valve. R09ar4 PRArIllom are not regtrked k"s that no shut 911 valves are Meant bPW~ the alarm dw* vales and ft PS10A. USTN& Accorr~ by r F r & g 0» water VMWNt; tat valve or the hapeclor* Id-of 1M Iasi vaM. When uskp endue ** teal, agow time I" eltCM Pfesalr* to bleed oil M SYSTEM: Correct PS10A Info alarm port KOW9 That extends Prom to Interrrxhdata dhamber of the alarm check vaW. khotal on the outlet aide of the h *w duct valve of to alarm port plpin% krona #* no *a off valves are peeent bob"M the alarm valve and to PS 10A. TEST- A000Mplial d by r" fho water by-pass test valve. CAUTION: TM above testa may Ww wWate any other clrcult loser or water " WW gongs Thal are presem on the eyetern PR* nW W USA MKT. ea*10001- REV 1 PAGE 1 OF 2 MF( L 06400M - 3AW P),WPOTTER mm D. .NSIONS To . sE&VO m wu » USE of ftn 011d • As ICPAT M MID um or suave_ r:j i1M Dlrc. feu-r &. a.Tw TYPICAL SPRINKLER APPLICATIONS MODEL PSI 0A PRESSURE SWITCH 8 TEAAitNI1L; MAWIM 4 * j, 4 Z: wa fog" CAunoN: M unkwAabd Moon of a skvb cwX% ator aft not be bopsd wvx d bhe burial and own "Aav eeparaw corwacdo w, The wtn b; a oaecn r dIdOcked *M under bhe bomlrralL KT SYAEM - VON on wm6a EXCESS Na=W off sTsra WpmM:M • ~ fir• so" 10-41 OGy a" in cc~ Flww.A am l OVa M i••O M9= raK Ofal IIpM Ia -' r< w w IOfK •1/M ta( KK 01,OK 1:0 OR7 M • 7 OMfWm N manvwc OOK CAUTION: CLOsm OF ANY SHUTOFF VALVES r.a I TBETWEENTHEADJIfiMCHECKVALVEANDTHEPS10AWILLRENDERTHE PS10AIP40PERATFVETOCOMPLYWITHNFPA-72 ANY SUCH VALVE SHALL BE ELECTRICALLY SUPERVISED. TYPICAL ELECTRICAL CONNECTIONS PRESSURE SWITCH aronoro w iorr r•wor a"c e ICU= N WAWMam WW irlrs o (ial6e q 7vOrYiL>a www TEFWJMTION Ir FORDERING INFORMATION oo Ira kr- Description Stock t+b. _ Pressure switch with one set SPDT cordaOs 1340101 `D', ' PS 10-?J1 Pressure switch witll two sets SPpT 625006 2HexKey Cover Tamper Switch Kit 00®0134 oor Ko Ilc ter, rev-• swla wix lcs ENGINEER/ARCHITECT SPECIFICATIONS Pfes"*"wsbrtbw mkt" a Model P810A as wwwAscpind by Potler Eleclrlc be Co. of St t.orrls, Mo. and shall trwtaaed on theW syetarrr as shown on V* drawings wWft spsclllsd Ilerelrt SwAcbes Null be prwWd wren a Vr NPT male preswr• cw wctbn b be conroK d bb vo abrm clwdc vanes of a'weC wkjurhGsnrledlatecllarnberofa'dry' P M and sAa1 be achrand by wW 11ow of wale b or h axom of IM sy°1an ooddledwrpehamoresplrllderhoead Swkt** OW h" a Pwkmxa esrvlce pressure ra*q of 250 PSI and 4" be taclay adlmW 1b operate on prT krcreare tl 0 tt PSI. ThereW" be one (1) OF bwo R) SPOT m*wb tared ab 15.0 Amps at 12&ZWVAC and 2A Ampe a<Ww. ` The awfth houelrrp OW be wsWwr Proof and 04 reelaflant The oawr shall kcwPprsb tamper rOW"M saewa. 7 Nt sI aM be bled by Undwwrpea D kbwabriea. Inc. and aPDro'wd by Facbry MlAual. PRINTED W U8A UKL 0"10001- REV I PAQE t OF Z UFO.06400W - 3M Superviso Switches he 3SYSU is designed to monitor the open sition of an Outside Screw and Yoke valve. The itch comes with a factory installed adjustable acket, eliminating the need for "T hooks and an Ijustable trip rod simplifies the installation xess. A foam gasket die cast base offers NEW waterproof) rating. For convenient installation OSYSU sizes range from 2" - 12". The OSYSU nes with one or two sets of rugged Form C DT) snap action contacts. The PCVS is designed to monitor the open position of post indicator, butterfly and water control valves. It comes with one or two sets of rugged Form C SPDT) snap action contacts. In addition, the PCVS comes with two conduit knockouts, a removable nipple, a water tight neoprene gasket and an adjustable trip rod. The PCVS also offers a NEMA-bP (waterproof) rating. Model Stock No. OSYSU-1 Q 1010106 7OSYSU-2 E 100206 PCVS-1 E 1010107 PCVS-2 e)p-o--.1..TER VSR_F VANE TYPE WATERFLOV roger f:lome si rw _ ALARM $WITCH NVITti RETiA 2081 Craig Road • P.O. Box 28480 Potter Signal & mfg. LTCSt.Louls, MO 63140-4161 . 1967 WHO street 314) 878-432f (800) 325.3936 w= : Don AMU#, ont", Canada M382 M) 441-1833 4ULCWWc5FvU""E 'W83kFMand LPCAPPROVW t'_ • %' . Pnswws Up b 460 P9f Min MM Flaw Rate fa Alarm: l 0 C1PM J U.S. PAT. NO.3921g8g CANADIAN PAT. NO. IODMo OTHERS PATENTS PENDING POTTER ELECTRIC- Rd., loon CaywT an+Pw&A* m Stk Na 00o001s GENERAL INFORMATION TM Model VSR-F b a varte. type warerl ow awRdr for Uee On. wet ObTAt.LATKW See spdM*r systems. It b UL Lbted and FM Tttaie deNo» MY be ouod on a hodconW orrerOmJal pipe. p DtPe: sdtedules 10 thruu0l 40. aLm 2' pma V. Iorwa on atatf' ftodwfW Poe be Waged on the top sfda of he On tPC approved sues are 21 lhru a, p nm ifw 2pQrtun). be mM Thi.ttrtlts attouidnd bs frotaMed wittt- Wft.dtartpee the drocflort of the Ovate m or YAW The unit MY also be used as a secoor d wderllow detsdor 0n kW t4- of a Vain or drah systems. Coal t tl *Ydom and drtl a hots 1h the Pk* tmkp a *vAar saw h a The unit contaku two apple Bole, docYuble n0arrowPne* W%)W d101, ibtr and 21C2 &vkaa mgt*t a Aofewhh a dem- and an adJustable. Instant!Y rs dl rtrrlraalapado ntald. raft Vmk'M d f of 1 1/4' + VV' IRV• ANWw ekes mpW a tab wM aTho . darnet*rof 2' * 1/8•. switdtes are actuated when a flow d 10 gagwo per In VAO or tltotemmdawtutrsamOfti•devkv. The now coed t MW "M for am 1f» kWo pipe 0f al pvwlh a other niatsria fora dlstartoeaPedodoftimenecessarytoovercomethe *elected retard period.--. _.pWtl b the -Pipe dlarnetar on either OW the hole ENCLOSURE The " is ertdosed in a gsrwd PWPQM. do -cold IN the Vane so Ihat ftokp. The cover b herd h PhDs with two tamper raWatartf sor+awa F kteeded hto the ho* do not Mend or wtkh roWre a *pedal key for removal. A field kta -Pasi R k*M Vm V& the *mow on the sadde pornts h coo tsn Pwswa h is avaAeDls as an tlon ooV*r .d. ktistall to saddle wrap and PoNen unautltortzed removal of tits cover. ueijno we b klIN k). • Mmay to art •NsnWaf tin R bs. of torpue so Fig. 2). The suftoon kutnrcttons of 043 swath. 6400775 kt• vane groat rub the k*Mp of the pipe or Und In any way. 4mum Blrrpe: 18 FPS r _ •. Raungo: > B. OAr+q 122i/250VI CUAnVs atO,v= Rsalstivvs cortdtrlt 1FAUM k. T" btOclu is prwldad br VYcondurt E+ rvirertrtterttal8pedAcatbns; aothdocr uee with faClolyhaiaAsd peeks t ant NEMA4 Rated EncbK" • the wftlt approprW* oondut fting. fTroitoorroahre it 4WM2VF, 4.6` APT oryttetalfed headdle Cautlort: Thb *Vbo form hbnded forappOc4swo h 04*aw ertvkwirrtertts - 8k* s AY4ablae adteduba 10 Wu 4Q stza 2'thv 8• 1887pIDe ti0rrrn Wv 2o0mm ham t3erVloe Usac _ .. alb NFPA- 130 NatlortalftwAlumOode bloursiaMs NFPA72 NFPA•TZ PRINTED W USA . MKT. Ia*00001 s REV K: PAOE 1 OF 2 LIFO I940MI. 399 " - LISTED E> 9®688H APPROVEDED A.W.W.A Standard C509 H Std. Tap Size 2'/e"-4" 3/+": 6"-12" 2-1 /2" - 12" KENSEAL 11 R/Y VALVE - OS & Y - FLANGED EI GENERAL DIMENSION LAYOL KENNEDY VALVE 4068 15 lb. ANSI 1. drilling 16.1 VALVE SIZE 2-1/2 3 4 A 7-1/2 8 9 B 3-3/4 4 4-1/2 C 7 7-1/2 9 D 11/16 3/4 15/16 E 13-7/8 15-5/8 18-1/4 F G H Weight 16-3/8 4-5/8 18-7/8 4-5/8 22-3/4 8-5/8 7-1/4 10 10 55 70 100 6 8 10 10-1/2 11-1/2 13 14 5-1/4 5q413-112 66 79 11 1 1-1/8 1-3/16 1-1/4 23-3/4 29-1/4 35-3/8 40-5/8 30-1/8 8-3/4 12 150 37-3/4 8-3/4 45-3/4 12-7/8 14 250 18 400 53-1/8 12-7/8 18 580 4068A-Tapped 8 Plugged Upon Request (a-) Position "A" 9 r NIBCO INC. World Headquarters 1516 Middlebury St. Elkhart, IN 46516-4714 U.S.A. www.m 175 lb. wwp bronze gate valve Fire Protection Valve • ULA&C Listed • FM RC Approved • Approved by the New York City B.: 143-69-SA • Conforms to MSS SP-80 Block Pattern • Screw -over Bonnet • Outside Screw and Yoke • Solid Wedge 175 PSI Non -Shock Cold Water (400 PSI Non -Shock WOG General Service) MATERIAL LIST PAU tPECIFtel H N 1. Set Screw Steel ASTM A-307 2. Handwheel Malleable Iron 3. Yoke Bushing Bronze ASTM B-62 4. Gbnd Bolls Steel ASTM A-307 Zinc Plated 5. Packing Gland Bronze ASTM B-62 N 6. Packing Non Asbestos 7. Bonnet Bronze ASTM B-62 8. Stem Silicon Bronze ASTM B-371 Alloy C69400 9. Stem Collar Silicon Bronze ASTM B-371 Alloy C69400 10. Wedge Pin Bronze ASTM B-140 Alloy C31400 11. Wedge Bronze ASTM B-62 12. Body Bronze ASTM B-62 T 104-0 threaded T 104-0 NPT to NPT DIMENSIONS - WEIGHTS - QUANTITIES owmNsim Muter mmal Appu. Caton Na wwkel to, Sae A B 90 MN. puaUtr ptawetu Q-0114 21/.• 57A 2.3 20 3Y. 1 t4 27/u V/u 2.8 20 3% 1 1 27b 77/x 3.7 20 3Y• 1 1Y. 31S 8`Y,• 5.8 10 4 1 1Ya 3% 9% 6.8 10 4 1 2 31/• 11% 11.3 6 4% 1 4 C FM EoO V. _.._.. Cenral Sprinkler Company 451 North Cannon Avenue, Lansdale, Pennsylvania 19446 Product Description The Central Model F16 Bronze Angle Valves are designed for general service as shut-off, throttling, or drain valves. The Central Model F16 Bronze Angle Valves provide positive shut-off under normal operating conditions. They are recommended for water service only. The Central Model F16 Bronze Angle Valves are of cast bronze construction strictly in accordance with ASTM 8-62 specifications 85-5- 5-5 for superior corrosion resistance. 0 The hand wheel is manufactured from cast iron materials to meet or exceed the requirements of Underwriters Laboratories, Inc., Factory Mutual, The American Water Works Association C-509 and ASTM A-126, Class B Standards. The Central Model F16 Bronze Angle Valves are rated with cold water at 200 psi, non -shock for cold_ water service, and are tested twice, air under water for consistent quality. The Central Model F16 Bronze Angle Valves have a soft rubber seat for tight shut-off under all operating conditions. (Mfg. Source. Non - Domestic) Dimensions - Weights Size CA1' 1 %' 1!4. 2' 2.2D 1 3.68 C ; wt. closed) I (Ito 3.09 6 3.30 ( .94 3.80 i 1.76 4.40 2.50 4.65 1 3.26 5.90 i 5.32_ 1:a 27-2.c Central Sprinkler Company 451 North Cannon Avenue, Lansdale, Pennsylvania 19446 Product corrosion resistance. The hand Description wheel Is manufactured from cast iron materialstomeetorexceed" requirements of Underwriters The Central Model F17 3=Way Laboratories, Inc., Factory Mutual. Bronze Globe Valves are designed The American Water Works for general service as shut-off, Association C-509 and ASTM A-126, throttling, or drain valves. Class B Standards. The Central Model F17 3-Way The Central Model F17 3-WayBronzeGlobeValvesprovidepositiveBronzeGlobeValvesareratedwith shut-off under normal operating cold water at 200 psi, non -shock for conditions. They are recommended cold water service, and are tested for water service only. twice, air under water for consistent The Central Model F17 3-Way quality. Bronze Globe Valves are of cast The Central Model F17 3-Way bronze construction in strict Bronze Globe Valves have a soft accordance with ASTM B-62 rubber seat for tight shut-off udder all specifications 85-5-5-5 for superior operating conditions. ' (Mfg. Source: Non -Domestic) 2.45 I Bill of Materials Item I Description Material Specification 1- Body Bronze ASTM B-62 2 3 4 Hand Wheel Hand Wheel Nut Packing Cast Iron Steel Non -Asbestos ASTM A-126-B Commercial _ Commercial 5 Packing Gland Brass ASTM B-16 6 Packing Nut Brass ASTM B-16 7 Stem • Brass ASTM B• 16 7 Theiollowtng general purpose valves are for use in fire pmlectionservice system shut -Off or sectional controlis desired for closing a fire protection where it is necessary to prevent reverse flow, or wheresystemafteroperationortofacilitatetesting. ,also, there are valves forreducinghighpressuresforbothsprinklerpipingandhosestations. 0-ring sealed clapper, torsion spring loaded, butterfly type check valves Designed for use in fire protection systems and related piping Permits rapid closure and minimizes water hammer, which can be associated with reverse flow Available in 4' (1DO mm), 6' (150 mm), and 8' (200 mm) sizes Rated for use at a maximum service pressure of 250 psi (17.2 bar) Leak tight at back pressures at greater than 1.0 psi (0.07 bar) May be installed in either horizontal or vertical lines Listings and Approvals: ULI, ULC, and FM Technical Data $heel: TD300 Check Valve Grooved end connection swing check valve that has a rubber faced clapper design Provides a nominal pressure drop of only 1.4 psi (0.10 bar) at 600 GPM (2270 LPM) Leak light sealing of back pressure greater than 1.0 psi (0.07 bar) Rated for use in up to 250 psi (17.2 bar) service Furnished with IW NPT drain connection lap, which is ideal for use with fire department connections Listings and Approvals: ULI, ULC, and FM Technical Data Sheet: TD315 Check Valves Rubber faced swing check valves May be installed vertically or horizontally Can be used for gravity and pressure lank connections, connections from public water supplies to automatic sprinkler systems, fire pump discharge and by -pas! connections and in preaction systems having a nominal supervisory pressure of 1.5 psi (0.10 bar) or greater Listings andApprovalr ULI, ULC, and FM Technical Data $heel. TD318 and T0320 2W(65 mm) 4' (100 mm) 6' (150 mm) 8' (200 mm) available Wet pipe sprinkler systems are designed for use in applications where the temperature is maintained above freezing. In such systems eachfullypressurizedsothatwaterisdischargedfromasprinklerheadimmediatelyafteractuation. Alarm check valves or water flow detectors are used to actuate local and rerate alarms. Typical applications would include heated warehou factories, hospitals, stores, shopping centers and residential settings such as apartment or condominium complexes, and single family resid- Res!Aise& Pre -Assembled Sprinkler Riser Compact, pre -assembled, ready to install sprinkler riser Brass construction for use in potable water supply Available in V-2' (25-50 mm) sizes Integral test and drain assembly, flow switch with retard mechanism, 300 psi gauge, and check valve Compact size allows for easy installation between 2' x 4' studs in wall Molded mounting points allow for fast and easy left or right hand installation Available with or without pressure relief valve or Clow switch retard mechanism features Technical Data Sheet.' For details, contact your local GEM Sales Office Listings and Approvals. Components: UL and ULC Model F517 Ready -Riser® Riser Check Valve Available in 2' through 8' (65mm through 200 mm) sizes Designed for installation in wet pipe sprinkler systems When used in conjunction with a vane type water flow detector, it provides an economical means of activating electric alarms, upon the actuation of one or more sprinklers Trim consists of a drain, appropriately sized to comply with the requirements of NFPA 13 and 13R, along with gauges and connections to monitor supply and system pressures Use of 2Yr', 4', 6% or 8' (65mm,1OOmm, 150mm, or 200 mm) Model F52 grooved end check valve with the appropriate Ready -Riser" trim provides a riser check valve with a hand hole cover if required Listings and Approvals. ULI, ULC, and FM Technical Data Sheet: TDIWA and TD104B Models F20, F200, and F201 Alarm Valves with or withc Model F211 Retard Chamb, shown with F211) Models F2O (Groove x Groove), F20O (Flange x Flange), and F2D01 (Flange x Groove) Alarm Valve divided seat ring, rubber -faced clappt check type, water flow alarm valves For use in wet pipe' (automatic sprink fire protection system Automatically actuates electrically am hydraulically operated alarms when tl is a steady flow equivalent to the disc rate for one or more sprinklers The 2W (65 mm) Alarm Valves may I installed vertically The 4% 6% and 8' (100mm, 150mm, a 200mm) Alarm Valves may be installe vertically or horizontally Optional Model F211 Retard Chamber in installations subject to variable pre: as generally associated with public w supplies) in order to help prevent falsr alarms Listings and Approvals. ULI, ULC, FM, SSL, LPC, and VdS421 with DIN drilled flanges and special tri Technical Data Sheet TD1OO 2W (65 mm) and TD102 4% 6, and 8' (100mm,150mm, and 20 2Vi'(65 mm) 4'(100mm) 6'(150mm) 8' (200 mm) 40 DEC-06-00 :6:50 Frcn:SUNBEIT icta ulic M W9 9001 ce40et1 copputx. PRODUCT DESCRIPTION EWLC INS f: Fi[iOtl s r Eci i t; l iK N.RVTEGTIU`J PRODUCTS The VICW40 Series 756 Dr/ Valve 19 a low dlfferon- tfal, latched clapper valve that aaperates oyatem water supplies from 6y- pipe spridder systerns. The positive latching w—ech&- n: crn urns tho cvppry'c water pressure firer upguea= ( City vile) of die control valve W ho!d the dapPer shut. 7"Ae supply water pressure on the latch is controlled by a relatively lvvi system air plessu'%. When the system air pces- srre is released, such as an apes aptin3 ;er head. the decrea3irg au pressure activates the dry acmatcr of accelerator and releases the latch mecharism. which allows the clapper to ope.- L The low differenriai unique latch, and actuator design of the valve allows the valve to be self-ressumg: uhaze- fore It 1s not neceesary to open the valve in order to reset it. The lOw differential das: gn is not subjac: to water cdu-nna, and jr allows the valve to reset wirbout opaning tho valvo. The valve allows the w-etet w operaw a water rrtotcr alarm and/or electric pres- sure alarms, which von- ar1Ue UrAd The flow of Water ctopv. Nish the op--ional ac Maro- the valve can be config- red to respond -ester !or see in larger ayatenlo. or where faster response tirnes are tetfi:iied. The valve is rated Tor 300 ps; 2085 kPa) water wvr?crg pressure for sizes 114 - 6' Series 756 FireLOCkTM Dry Valve, 4roove4 X Grooved and Flanq.a x Groavod 48. 3 - 168.3 mina) and 225 Ps'. V SW We) waver work- ing proseurs for size 8' 219, 1 mmi..The valve ie factory tested hy'drostati- 7ailyto 600 psi (4135 Pal for sizes 1 % - 6' (48.3 - sa. 3 rain.) and 460 pci 3105 kPa) for size E ' i219. 1 mm). Air prarsv o tc water pressure ratio is approxirnatelyr 1 to Or. The Ser!es 756 is availatle grocved X gtcoved'.a_ szes) or flanged X gre ved 4 . e'1 1 a.3 - 219.1 _rrn). Standard grooved d_^.1sn- xoru cordann to ANS AU4l JA cso6, and standard Banged dimensions con- form W ANSI 1116 5. class 150. The Victauhc Series 7W Dry G.he_h VWve is made c: high- strength.1cw- —night ductile iron; and it cf£ero eas- j access to 0 izte:mal parts. All in-Arnal pare Ara replaceable. Maintenance and sen we can be per- fomud without removing the valve frow.. its ias-Aad position. The rubber dap- per seal is repriced easily without removing the dap- per four The valve. "'he valve is painted dWde and out to inczease ccr:csicn resistance. The body is tapped for main: drain: and all availo_.e trim configurations. Ttirn induces an alarm tact Valve. WKCh ellCWS te3:Ln(; of the alarm system nithou_ reds, jcingt'q sysrem's preE-- 51. 1re. The valve is available wit:: sep2rate T inn )ots. cr r: can be p1e-=irr:rned for installation. Vic>• at a t40AJ Neadotanus • P 0. d0y 31. Ezslon. PA 18W ry131 •4901 Ka&Wrsvltc Rd.. fasten. PA 19t)d0 • iiiW559.33D0 • Fllt: E10R50-0B 17 • WWW itt PAC CDm F" W-V11 2TMRs. D ZKO aj Woo jmw7 vdrcW1c '-VA %.~k DEC-06.00 71:_58 From:SWBELT DIMENSIONS E F MOOCH I I T4Z3 P.OZ/9T Job-313 n Apm Welod Each i Dlnlet/siotlo Lbalky Inchae7ernr wdbollt Trim im"n Trim Pell,. E to E l HNgM Clap7h a1m A' B C D E F G N t Flanged Gro"ad Flanged Groove OVEp X GROOVED 1t 5.0G 2!.GC 73.JG Is 13.0D 10.00 7.Q0 4.x a.00 16_' 3.) 5.3 ; 2:'9 a39 374 i 457 3::0 Sa !78 10'2 7.2 t 19.5 2 5.00 CD 13.00 10.00 TOO y i:3G a.00 C 43.0 3W In SJ3 77 b as; iw 254 173 1 ;9 112 1J : I 25 1250 21.00 14.00 auto 15.50 1 :.50 7.50 S rJ 500 4-.2 0.0 Jv S:3 330 sm L 4 19! 127 7 1251, 21! co 14.6i 20.CO ls.sJ ' 1 %50 ! 750 4mG 6.00 4. 2 Jls 533 Mc SL6 3°4 2w 1 "1 127 I _ 29.a im 2 ; KOD Saco D 11.5 1150 5.30 500 Q.1 r3r70306rxI1!1 144 l 1-7 H.t 20.5 IM 20-co y 'SOD 21.00 14.00 12.170 1 0.00 9.00 600 6.0 95.) 14.:• iat aC8 3C/E SKr 3-`6 11'4 + 2D3 - 22 i 13: 7.9 i 45.1 J r= 13.Q0 21.10 !F-00 22.00 14.03 12.00 B 5i/ 7= 7.00 73.0 115.0 14l. 3 Qc 53e 406 w sb6 30b 2K In 17a IFS l r Yfi tt. to { ILOO 22.C9 14.00 12.00 0.60 7 ,Qp i.00 73.0 a4b 536 Ci SS! 356 306 216 13 7d5- 19. 00 8 D 16.00 23.00 15,00 12.00 14.00 950 7.00 142 192 a2fa : z . S7.a QC4 muo act. a "::A 35z.t 1i>'.s 64.4 GROOVED X FLANGED q lo.co 0.00 15.00 21.30 12.00 13.00 9.00 Co 660 1t 6.G 4ce sm 13u 633 7Sn h b YCG 9 is 5 13 17.00 2.G 1.6.0C 22.60 14100 72.00 aa0 7.0) 7.1 gac- IC al S36 4w 5A 35C 1,:5 ili 77A I I 7T.6 38•7 li 750 21.10 16•00 220G 1400 I 02.00 B'0 7.M) 70 BI.G 125.0 l05. 1 q"» 1 aacS_3 am 556 1.56 vl lf rli 5 7/.o SF.i 6I 19 CJ :8-03 1600 23 0t 1600 12.07, 14.OG 9. 7.00 r 'b5 t5. 1 T.7-J ( _S..J 0.. xa0 7i< 10a,i 375.E I 31_3 177,11 0.3 10. 35 - 2 1 DEy-06-00 6`.58 From:SUNBELT 404606005/ T-6Z3 P.03/7T Job-323 PERFORMANCE 0A . HYDRAULIC FAICTM LOSS u A-0W OF W I" 9 8 7S1/7-54ere1. AT N7f hN'C1TIgCppP1ilOKyllsKyE 10 4 ix r ou os CC 94 1 T J0 I0 001(q i0 *0 in H0 10lJp i.MO lwa :,oa tCJl00 gcoo Re 0D0 FLOW PATE —GPM FRICTIONAL RESISTANCE The char-. ac Tight expraises Ue fnctional reairrl.-Ice of `Acraubc f 1 NorninWhcnetl ° IirilC1tFLon01 P1p SIZE NQmtna! Lich.$ ERUMOo fi LonVh of Pip. iy check valve Fs. t 1 1!'- ectti2V]ISiti eQC O! 9 H i tei: It pipe.S t+ 2Z 1 76. 1 fr-t, 8 fd. l nx:l 22 3 17 8 El raaro Li .wvaWw Ianlrl of Poe cz .20. 1D35- 3 CEC-'v-00 15:5f=ror.:$1i3E_T 4046060054 TRIM PACKAGES 71dro pecko"m aval"me: Vero" trim for tha Serea o ptiona meeeeaories: 7% dry chock verve irtmW O Setdea 763/76_A Dq wricaly gcp7at+w/AIItf TIOOd Dfvko - A3owz domasing7y . packaged include: 1= 3 re*uned yiga aorr ail pressure to rokase the GLAJ crab ftiwwing he clapper to op- Requenen 32. RD ¢t3ard TQ3f3 Sor subpp:ltd.• O Slriea 754ft4-A Aocsler. 3. All ieq-jked ga p93. atvr/Asj* jjftd Dowic& _ Required f4m the Series 756 dry Chedt v*m i3 irs..altd !:% lame iyttemc tA*wo Woo time o11 the cy.-tw.. MATERIAL SPECIFICATIONS i 0.35-10 neodo to be impraved. L chides AcceidrawtlanU. W device and :cq 6dvirtTtequJ&% 1 0 ror zub- mittal. O 9priva 700 W)"or Motor. IJar= - : be Sed ei 7556 dry dredt'ralvo is iesiGnrd to activam a me&-Amical ,rate: r akum wrAn a 1s3 - tunW Vcw a we;sr ;ouch ae MLIA apt cpap sprinildar head) causes the clapper to lut later 0 NZ? p.01/BT Job-323 s:.s acai 7 Al"w4 preamte swltch- Thc sari- 7% dy oievh r+)ve )s (1wio red to a%w rF a m«1W QUvate eleorL, alarrne omd coruol pame,,. WbAn a aosteiued jaw of rater (carp as Nath an 62on carmicer had) cages rko clapr'V MD lift (.'Oa: i4' S3aC. O MYmilat000ma 7yira Ubiy - 3" "a 5. cr At CCm746730Ca ari ccm—_ scree. mnuci .•icuuti0. AodY. D-.+Cdk',ea. AS-Ta4 A-53S G_ )o 6545-'2 Clapper. Ah=.znum Ljv=a, UNS•(95m or LNs-C3ff w aWs 431 Stzwjm ."-- Seat Sea>: EFUL AS7M'J--)003 Clapper: Mut e Seat 0-rt»pa: Ttaudemsteii WO Seder) OPEC46-00 *F.-Se Frow;SWELT 4046160054 TRIM 304019 7" Dry Syo#o," ValvoiPnssaroSwltc'4 Accelerator and Air UAW..a., Groover x cmevod OPTIONAL) L w ichtaxAlarm To {Naar opliwml series 740 Dry AwarWor 1 4* To Dmin Nu_ -" hoNwv cow Closed To Draki Yarma C To CRA T3 Drai FlM%6d X Qr*OV*d 10.35-6 QMOV*d X Grovvgd mpical) - 00 opdc4w Air DEC-06-00 '7:00 Froo:iWELT 404690054 0 T-R3 P. OT/ar job-?, g OPERATION Thb Series 766 Dry Check Valve contains a dapper. which has a replatgab)e Uber seal The clapper maps contact Witt. the vtalva's seat nag, w!licl-. has access holes leading into art'MUM e"te chamber in the valve. Tha piston con- Taca the :otaa. and the atch Molds the clapper clocad. ir the classd position. tte valve F]swn is ra=twned in the extended position by the ware supply piesst:re btm upstraarn of the watej aupr-iy ccraol valve. T:7a r-JV6 Fistcr. =ads the clap- pw in ehe c:cwed :;.3.:ou. Tr.e aeries 753-ice Dry Ac ator/f nti-Food Do -vice ma;ntains the water. =nd the ayetern t z:r pressure conuols the d:y actuator. n.e almo-water raro is apprardmatey i t:) 8.:. Once the y3te!r,•s a!: F:es sL e redrew to :t a itio point• the dry ac—maW opera and alloys ta_ water su*. Y pressure in t::3 pis - on to rdease .je. an c1cEr_ sprinkler -Mad). This elease anuses the pis:cr: od to Tetrect. ar:d it per - its clapper _=Yrva freely, tier_ allordng watt:." z-.w the sy=eza. Na:Hr Sr.Trr3- 9lr - ]3n1LcI ]I till :Fl:r; through t-'."e av)e,- in - a sect rins. 17 2'tietsr r°c:.•„ aom tine inte:rne!:iS-;2 c:.3mbel to the slac.:; hriz v:iich activates the s•rs• terns alarms. '_re ZQ17 C-2nk;Q :O so=l:O 1 `_ 9r;w of :rate: s =s When 2he floty rl' wo:=: stcPs, tne vdive_ e:apFer `_SEU:ns t0 :c cloea-' "? '-'Cn. Tha acts as so aWm chsc valve until the aysEe:n ;— back in xrv:cF :,; e - s :;• pre; er procacaie iG35- au 27 . a01 : tbPr'1 FIRE . PkC}T. SF'EC. 7 I Nc-ern Air Compressors asaoras a..i I.a aaaa a4,la 4r tture Benefits cast iron compressors with durable 1• typt main bearings. ad unloading feature reduces rting' load on motor. xt lead time•;. usually less than a rk from the factory. same day on dels' shlpped from one of our . ehouses ive totally assembled. no added site labor. •)ust add oil and connect Po" r. hrough 3 HP'single phase motors thermally protected. Magnetic ter staWard•on 5. HP single and re phase models. AE or ASMB-NB'tank available if uired. ' lcial models V e.. high pressure losion proof. vertical tank.•etc) . Ilabic. Our salestenginee(ing lartment is`available for mmendation and design of'special pressor units for your application. controls are •UL listed. year pump warranty. t _ Mo lei KISS•30S. Emglo compressors for ry sprinkler systems are designed, for igh volume (CFM) at the pressure rev jired for the system. Mounted and wir d controls are standard on all tank mounted units. Base Mounted Specifications SYSTEM' I CONTROL S MODELS* 10.40psi APPx I DiMEKSIOVS SIZE G OVP CFM CFM SHIP ICAL:.ON51 HP MODEL SET 30.40 P51 PA T r RPM D!SP DEED WT L W F! 220 YS 17135.BS ACGF _ _ 670 3.) 2.9 90 22 17 14 290 15 F)2S•BS ACCf Oi0 1200 4. 7 7.8 6. 0 4.4 90 7; 71 11 14 i 2 I1 14_, 750F34$a5 A_CG_F__ 425 K71SBS ACGK S70 6.0C 0I1027Iz 15 J 480 I IK FISaS ACGF _ 1130 7.1 6.0 100 2 17 !« 600 s45 KIS( IS K15" S ACCK ACGK 700 $. 9 ! 7.4 i I5 22 12 i 16 1140 11.0 IC 120 22 `? E -16 IK25_ 8S 025• AS ACGK ACGIl 1280 14 $ 12.4 140 22 t 1 i 10 630 17.I I S. I i Ids 74 16 is 1? i 5 1775 G)S.BS ns.GD 9S0 25.6 -)1.8 193 7a 1 1a '!6 I 1950 5 GCSS BS _ ISs- Bs ACCI ACG 1030 79.1 a 3 0 -3 QV 74.7 26. 0 20 z70 28 ! 16 Ib 5 7 1 27 j115- Tank Mount isd -Specifications 70 Yi FI_)S•)O$ 1 STANDARD I i 670 33.7_ 7.9 Poo 78 16 31 i 1290KF125.7(1s 951 04.7 _ 7.8 60 38 6 31 350 42$ F34S- 10S 1200 1120 4A 165 38 16 31 K71530$ 6. 0 6. 0 S.) Id0 I 38 It. 73 480 6W r 835 1 IK r15. 705 t430 790 7. 1 t.. 9 6. 0 7. 4 170 1! M_ 76 78 16 16 71 71 KIS•305 KIiS70S 1140 1280 13. 0 1 Id., 10. 9 17. 4 200 710 33 16_ 38 16 77 31 91-5 - 1215 K75- 70S G2S• 30S 630 17.2 1S.1 7)3 38 I6_ 35 1775 7 07S705 9i0 7i.G 21.8 337 38 16 75 1 J. QSj2_T 53D'S' 1070 9.1 24.2 I5 i 3F 6 •`5 470 30.e26.y u10 45 17 + 17 ; Maximum gallon; in system oo be pumped up to 40 PSI 'n 30 minuses. Model F12S•BS. Base mounted units consist of a pump and motor mounted on a heavy welded steel base. Controls are available and arrive mounted and wired if ordered. All units include a totally enclosed steel belt guard. Model G3S•30S. The pump we use is ours! We design it. machine it. assemble it. run it. test it. then test it again You can be sure it wi!I run properly when K arrives. 6 Aa' BADGER jL ig Badger Fire Protection Water 1 T)r1.1 03=55 Pr1 S01/T11ER14 F7REe. gr4FETY, 3z0 6; TECHNICAL )ATA Multi - PurpoSe & Regular Stored Pressure Extingujshers NDWNX (W) CAYAOTY (MOMWSI 1-4 FIRE RATFIG AGENTTYPE 1TEk1 PART RUA03ER VE VA7ERIAi 5{41 MA?MLO L SNIm4G W) WWF (r.LOGMMS) CFERVvr. PRESS1.i2E TEMPERATURE FEAWE (ry 23 5 S 101.17 227 227 4.54 W108C 3")aC 2XV91C 4A-aOB) ABC ABC ABC ABC 2243Q 22435 22499 22603 ALJ Uik#V ALUtA M A_ WiUi4 A;.W"N Wft STEEL srat STEEL 35 10 1.53 4,5 a.5 7.71 195M 195PS1 195FSI Oil TO 120' 40' TO 1 .10' 4W 70120' 4. r :O :20• 20 5.5 10 9.07 Z49 454 m'208_ 4w: 608.c ABC EC Bc 22Et2 22478 22576 ALI,?JhV,,! KUMOi N AL1.1d.FFAJ STEEL STEEL STEEL 33 a 85P1 195PS 195P51 40' TO 720' 40' T6120' 4Q' TO :_0' O`SC-vARGE11A4EjSECONOS) 95 14 1c 27 a R'.:E [FEET) TO is 12':0le 12TC 13RA!6?O2J 16T: CE R.1<TERS) 3.14TO4.g 3.?TO5.S :.- 16 2-) 12.0'4 16Tor, TO6.1 4006.-1 37T-5.5 4.9TO6.1U!1THEIGHT ;1FiC`1ES- 14.87 1525 iCJITp1 TERS) NIS 1-' 75.34 i1.1$ ?525 1f.A38.7 .C8.1 _3.67 39.7 46.1UMIw'OT)i WCiCv; ' - : 2? 725 CENTW-TERS) 13.97 18.41 7.t., 7.75 325 7.!51F.41 ISM 23.19 18.47 WfpaI SNE11 (IFrCNES) 3 425 4.25DMETER (CFATWERS) 7.82 :C B 5.25 725 425 5.250.9 13.33 12.41 leg 13.33V= WROVAL YES _ 1F$ YES YES YES' 1T:S U$CG BRACKET AM= tB-5 M64lOFTvote OPTI We h%Z uB t0MJCLUDEQO?iK N,y. OPT1 A1 OPTIRVIL nib v* Svin 1. s -- OPT?Oli>J_ OPT04AL OPT.GWI 1• arr+afixs or nrlwnN.:snr fc ir.w, m:x r+N "-wy c?a; t-a M.» r s: /x:na+, ..c. a: t Vwr a or eanc.x1:1 I.nflum, m-" Fse Mr Distributed b -.,.>~~r,n .,-. ....k:..,.: Y 10 Sowhern Fire & Sft 1w. 0166m6ddoll Rwd Cb41mk& AL 36521 ead"r Fire Preto cGom tMDoiq 4251 Semrole Tlat CIVEW av, 410. VA 2iB11 T00)444r3.9 7or(8m)9'34wv Fa- tw")24aL erAcr 4b03)9':3-mg W1twwti.badc9rtr&-or vV -.a. r il u3"~ Frl SGUTHEP.H FTREc, SAFETY, 334 67S 0064 P- 0-- TECH vawrTAL CAPACRY 25CAI.LONS pLBs 9.46LTTERS 4.K400 XL FIRE RATTTO 2A WA AGENT TYPE VWTEP, ACETATE REMP.ARTI'AMMER 15M C4r92 YFLVEMATERIAL BRASS k0A SHELL MATERIAL STNNLESS STEEL V.7! saPPm (LOS) a KE GHf (KA('<ifV4dS) 3.6 n 4.9 OPERATNT. PRESSURE 100 PS WA TEMPEPATVREPAW E(F) 3 •b 1)'b roc• DLSCW rA TW..E iSECOmDS: SS K'A D: SC ,RGE (FEET) 1S WA WGE :BEM 9.1.1s.7 VVIT H-JGHT (NC1fS) ia.75 K:a rCENTWETERS) 62a7 UNIT WIDTH ;R Gl¢$) 9 CENTKETERS; ZZ46 A tvVCHES) 7 Na ISHEILDWdETERIrENTM1ETERSj17.7a VEHICLE BRACKET V&i0 a• rrm VA r - 9 N ror'sCC. 1' V:o0.rvx. rl--clura ar/ fa1: b. Y: jcx 1fh• ncr, cmn Ir/ r• y rnaa cr !Ns y. tarp rna0c w; ay tiktr cr+c., 9acbtG Nr: Mvrmn).1 %F yaa kco a l K Mr µvsrr.rc•''Oreason .{ re +•bcnr.Q n cty.4". 0 ;y.in.tYaatn Distributed by: ftMad a cry lac. us. Cbvwlwls AL 3MI 821dger Fire Proleclion OYLo* fiER 4251 Semi kw Tray Chafttw0o. YA 22911 800) u 6-3851 or (Wil) s7 3 4 3o' 1 Fa[ ( 60D)Z48-r609or IMM)973-1589 hdµcvn REED FIRE PROTECTION 5168 MOBILE SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX HYD LIC CALCULATIONS I FOR1101 LOWES OF Sanford FL Office Area FILE NUMBER: OFFICE0826.sdf DATE: AUG 26, 2002 2/ U RECI44VVSEP20 DESIGN DATA- s ,ja) OCCUPANCY CLASSIFICATION: MERCHANTILE DENSITY: 0.20 gpm/sq. ft'. t AREA OF APPLICATION: 1500 sa. ft.TZ" COVERAGE PER SPRINKLER: 94 sq. ft. NUMBER OF SPRINKLERS CALCULATED: 20 sprinklers TOTAL SPRINKLER WATER FLOW REQUIRED: 536.3 gpm TOTAL WATER REQUIRED (including hose): 636.3 gpm FLOW AND PRESSURE (@ BOR): 636.3 gpm @ 76.91 psi SPRINKLER ORIFICE SIZE: 1/2 inch NAME OF CONTRACTOR: DESIGN/LAYOUT BY: MEH AUTHORITY HAVING JURISDICTION: LOWE'S CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION NUMBER: Florida Permit No. 466077000199 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ) HRS SYSTEMS, INC. ATLANTA, GA SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 DATE: 8/26/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\OFFICE0826.SDF JOB TITLE: Sanford Lowes Office J 4 4 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 3 DATE: 8/26/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\OFFICE0826.SDF JOB TITLE:'Sanford Lowes Office WATER SUPPLY DATA SOURCE STATIC RESID. FLOW AVAIL. TOTAL REQ'D NODE PRESS. PRESS. @ PRESS. @ DEMAND PRESS. TAG PSI) PSI) (GPM) PSI) GPM) PSI) PUMP 170.0 116.0 1875.0 162.7 636.3 76.9 AGGREGATE FLOW ANALYSIS: TOTAL FLOW AT SOURCE 636.3 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 536.3 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) S1 13.0 K= 5.60 22.0 26.3 S2 13.0 K= 5.60 22.1 26.3 S3 13.0 K= 5.60 22.4 26.5 S4 13.0 K= 5.60 23.3 27.0 S5 13.0 K= 5.60 24.3 27.6 S6 13.0 K= 5.60 25.7 28.4 S7 13.0 K= 5.60 22.0 26.3 S8 13.0 K= 5.60 22.2 26.4 S9 13.0 K= 5.60 22.3 26.4 S10 13.0 K= 5.60 22.7 26.7 S11 13.0 K= 5.60 24.0 27.4 S12 13.0 K= 5.60 25.5 28.3 S13 13.0 K= 5.60 21.6 26.0 S14 13.0 K= 5.60 21.6 26.0 S15 13.0 K= 5.60 21.6 26.0 S16 13.0 K= 5.60 21.7 26.1 S17 13.0 K= 5.60 21.9 26.2 S18 13.0 K= 5.60 22.2 26.4 S19 13.0 K= 5.60 23.3 27.0 S20 13.0 K= 5.60 26.7 28.9 Al 13.0 22.0 A2 13.0 22.0 A3 13.0 21.9 B1 13.0 63.6 B2 13.0 65.3 B3 13.0 64.9 B4 13.0 63.7 J1 13.0 22.1 J2 13.0 22.2 J3 13.0 22.4 J4 13.0 23.4 J5 13.0 24.4 J6 13.0 25.8 J7 13.0 22.1 Y SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 DATE: 8/26/2002 C:\HASSCA-V1\2505 LOWES SANFORD FL\OFFICE0826.SDF JOB TITLE: Sanford Lowes Office NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) (PSI) (GPM) J8 13.0 22.3 J9 13.0 22.4 J10 13.0 22.8 J11 13.0 24.1 J12 13.0 25.6 J13 13.0 21.7 J14 13.0 21.6 J15 13.0 21.7 J16 13.0 21.8 J17 13.0 22.0 J18 13.0 22.3 J19 13.0 23.4 J20 13.0 26.8 TOR 13.0 70.0 BOR 2.0 HOSE STREAM 75.6 PUMP 0.0 SOURCE 76.9 100.0 636.3 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 5 DATE: 8/26/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\OFFICE0826.SDF JOB TITLE: Sanford Lowes Office PIPE DATA PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 1 15.0 2.157 PL 11.00 PF 0.1 Al 13.0 0.0 22.0 0.0 1.3 120 FTG T PE 0.0 J1 13.0 0.0 22.1 0.0 0.002 TL 23.00 PV Pipe: 2 41.3 2.157 PL 8.00 PF 0.1 J1 13.0 0.0 22.1 0.0 3.6 120 FTG PE 0.0 J2 13.0 0.0 22.2 0.0 0.015 TL 8.00 PV Pipe: 3 67.6 2.157 PL 7.00 PF 0.3 J2 13.0 0.0 22.2 0.0 5.9 120 FTG PE 0.0 J3 13.0 0.0 22.4 0.0 0.037 TL 7.00 PV Pipe: 4 94.1 2.157 PL 13.75 PF 0.9 J3 13.0 0.0 22.4 0.0 8.3 120 FTG PE 0.0 J4 13.0 0.0 23.4 0.0 0.068 TL 13.75 PV Pipe: 5 121.1 2.157 PL 9.00 PF 1.0 J4 13.0 0.0 23.4 0.0 10.6 120 FTG PE 0.0 J5 13.0 0.0 24.4 0.0 0.109 TL 9.00 PV Pipe: 6 148.7 2.157 PL 9.00 PF 1.4 J5 13.0 0.0 24.4 0.0 13.1 120 FTG PE 0.0 J6 13.0 0.0 25.8 0.0 0.159 TL 9.00 PV Pipe: 7 177.1 2.157 PL 160.00 PF 37.8 J6 13.0 0.0 25.8 0.0 15.5 120 FTG T PE 0.0 B1 13.0 0.0 63.6 0.0 0.220 TL 172.00 PV Pipe: 8 21.4 2.157 PL 11.00 PF 0.1 A2 13.0 0.0 22.0 0.0 1.9 120 FTG T PE 0.0 J7 13.0 0.0 22.1 0.0 0.004 TL 23.00 PV Pipe: 9 47.6 2.157 PL 10.00 PF 0.2 J7 13.0 0.0 22.1 0.0 4.2 120 FTG PE 0.0 J8 13.0 0.0 22.3 0.0 0.019 TL 10.00 PV Pipe: 10 74.0 2.157 PL 2.00 PF 0.1 J8 13.0 0.0 22.3 0.0 6.5 120 FTG PE 0.0 J9 13.0 0.0 22.4 0.0 0.044 TL 2.00 PV Pipe: 11 100.5 2.157 PL 6.00 PF 0.5 J9 13.0 0.0 22.4 0.0 8.8 120 FTG PE 0.0 J10 13.0 0.0 22.8 0.0 0.077 TL 6.00 PV Pipe: 12 127.1 2.157 PL 10.50 PF 1.2 J10 13.0 0.0 22.8 0.0 11.2 120 FTG PE 0.0 ill 13.0 0.0 24.1 0.0 0.119 TL 10.50 PV SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 6 ' DATE: 8/26/2002 C:\HASSCA--1\2505 LOWES SANFORD FL\OFFICE0826.SDF -, JOB TITLE: Sanford Lowes Office PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 13 154.6 2.157 PL 9.00 PF 1.5 J11 13.0 0.0 24.1 0.0 13.6 120 FTG PE 0.0 J12 13.0 0.0 25.6 0.0 0.171 TL 9.00 PV Pipe: 14 182.9 2.157 PL 170.00 PF 39.6 J12 13.0 0.0 25.6 0.0 16.1 120 FTG PE 0.0 B2 13.0 0.0 65.3 0.0 0.233 TL 170.00 PV Pipe: 15 36.4 2.157 PL 11.00 PF 0.3 A3 13.0 0.0 21.9 0.0 3.2 120 FTG T PE 0.0 J13 13.0 0.0 21.7 0.0 0.012 TL 23.00 PV Pipe: 16 10.4 2.157 PL 12.00 PF 0.0 J13 13.0 0.0 21.7 0.0 0.9 120 FTG PE 0.0 J14 13.0 0.0 21.6 0.0 0.001 TL 12.00 PV Pipe: 17 15.6 2.157 PL 14.00 PF 0.0 J14 13.0 0.0 21.6 0.0 1.4 120 FTG PE 0.0 J15 13.0 0.0 21.7 0.0 0.002 TL 14.00 PV Pipe: 18 41.7 2.157 PL 9.00 PF 0.1 J15 13.0 0.0 21.7 0.0 3.7 120 FTG PE 0.0 J16 13.0 0.0 21.8 0.0 0.015 TL 9.00 PV Pipe: 19 67.7 2.157 PL 4.66 PF 0.2 J16 13.0 0.0 21.8 0.0 5.9 120 FTG PE 0.0 J17 13.0 0.0 22.0 0.0 0.037 TL 4.66 PV Pipe: 20 93.9 2.157 PL 5.00 PF 0.3 J17 13.0 0.0 22.0 0.0 8.2 120 FTG PE 0.0 J18 13.0 0.0 22.3 0.0 0.068 TL 5.00 PV Pipe: 21 120.3 2.157 PL 10.00 PF 1.1 J18 13.0 0.0 22.3 0.0 10.6 120 FTG PE 0.0 J19 13.0 0.0 23.4 0.0 0.108 TL 10.00 PV Pipe: 22 147.4 2.157 PL 16.00 PF 3.4 J19 13.0 0.0 23.4 0.0 12.9 120 FTG E PE 0.0 J20 13.0 0.0 26.8 0.0 0.156 TL 22.00 PV Pipe: 23 176.3 2.157 PL 139.00 PF 36.8 J20 13.0 0.0 26.8 0.0 15.5 120 FTG 3ET PE 0.0 B4 13.0 0.0 63.7 0.0 0.218 TL 169.00 PV Pipe: 24 26.3 2.157 PL 1.00 PF 0.1 S1 13.0 5.6 22.0 26.3 2.3 120 FTG T PE 0.0 J1 13.0 0.0 22.1 0.0 0.006 TL 13.00 PV Pipe: 25 26.3 2.157 PL 1.00 PF 0.1 S2 13.0 5.6 22.1 26.3 2.3 120 FTG T PE 0.0 J2 13.0 0.0 22.2 0.0 0.006 TL 13.00 PV SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 7 DATE: 8/26/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\OFFICE0826.SDF JOB TITLE: Sanford Lowes Office PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 26 26.5 2.157 PL 1.00 PF 0.1 S3 13.0 5.6 22.4 26.5 2.3 120 FTG T PE 0.0 J3 13.0 0.0 22.4 0.0 0.007 TL 13.00 PV Pipe: 27 27.0 2.157 PL 1.00 PF 0.1 S4 13.0 5.6 23.3 27.0 2.4 120 FTG T PE 0.0 J4 13.0 0.0 23.4 0.0 0.007 TL 13.00 PV Pipe: 28 27.6 2.157 PL 1.00 PF 0.1 S5 13.0 5.6 24.3 27.6 2.4 120 FTG T PE 0.0 J5 13.0 0.0 24.4 0.0 0.007 TL 13.00 PV Pipe: 29 28.4 2.157 PL 1.00 PF 0.1 S6 13.0 5.6 25.7 28.4 2.5 120 FTG T PE 0.0 J6 13.0 0.0 25.8 0.0 0.007 TL 13.00 PV Pipe: 30 26.3 2.157 PL 1.20 PF 0.1 S7 13.0 5.6 22.0 26.3 2.3 120 FTG T PE 0.0 J7 13.0 0.0 22.1 0.0 0.006 TL 13.20 PV Pipe: 31 26.4 2.157 PL 1.50 PF 0.1 S8 13.0 5.6 22.2 26.4 2.3 120 FTG T PE 0.0 J8 13.0 0.0 22.3 0.0 0.006 TL 13.50 PV Pipe: 32 26.4 2.157 PL 1.50 PF 0.1 S9 13.0 5.6 22.3 26.4 2.3 120 FTG T PE 0.0 J9 13.0 0.0 22.4 0.0 0.007 TL 13.50 PV Pipe: 34 26.7 2.157 PL 4.50 PF 0.1 S10 13.0 5.6 22.7 26.7 2.3 120 FTG ET PE 0.0 J10 13.0 0.0 22.8 0.0 0.007 TL 22.50 PV Pipe: 35 27.4 2.157 PL 0.50 PF 0.1 S11 13.0 5.6 24.0 27.4 2.4 120 FTG T PE 0.0 J11 13.0 0.0 24.1 0.0 0.007 TL 12.50 PV Pipe: 36 28.3 2.157 PL 0.50 PF 0.1 S12 13.0 5.6 25.5 28.3 2.5 120 FTG T PE 0.0 J12 13.0 0.0 25.6 0.0 0.007 TL 12.50 PV Pipe: 37 26.0 2.157 PL 3.00 PF 0.1 S13 13.0 5.6 21.6 26.0 2.3 120 FTG T PE 0.0 J13 13.0 0.0 21.7 0.0 0.006 TL 15.00 PV Pipe: 38 26.0 2.157 PL 1.00 PF 0.1 S14 13.0 5.6 21.6 26.0 2.3 120 FTG T PE 0.0 J14 13.0 0.0 21.6 0.0 0.006 TL 13.00 PV Pipe: 39 26.0 2.157 PL 1.00 PF 0.1 S15 13.0 5.6 21.6 26.0 2.3 120 FTG T PE 0.0 J15 13.0 0.0 21.7 0.0 0.006 TL 13.00 PV SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page & DATE: 8/26/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\OFFICE0826.SDF -, JOB TITLE: Sanford Lowes Office PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 40 26.1 2.157 PL 3.00 PF 0.1 S16 13.0 5.6 21.7 26.1 2.3 120 FTG T PE 0.0 J16 13.0 0.0 21.8 0.0 0.006 TL 15.00 PV Pipe: 41 26.2 2.157 PL 3.00 PF 0.1 S17 13.0 5.6 21.9 26.2 2.3 120 FTG T PE 0.0 J17 13.0 0.0 22.0 0.0 0.006 TL 15.00 PV Pipe: 42 26.4 2.157 PL 2.60 PF 0.1 S18 13.0 5.6 22.2 26.4 2.3 120 FTG T PE 0.0 J18 13.0 0.0 22.3 0.0 0.006 TL 14.60 PV Pipe: 43 27.0 2.157 PL 2.60 PF 0.1 S19 13.0 5.6 23.3 27.0 2.4 120 FTG T PE 0.0 J19 13.0 0.0 23.4 0.0 0.007 TL 14.60 PV Pipe: 44 28.9 2.157 PL 3.50 PF 0.1 S20 13.0 5.6 26.7 28.9 2.5 120 FTG T PE 0.0 J20 13.0 0.0 26.8 0.0 0.008 TL 15.50 PV Pipe: 45 15.0 2.157 PL 7.66 PF 0.0 Al 13.0 0.0 22.0 0*.0 1.3 120 FTG PE 0.0 A2 13.0 0.0 22.0 0.0 0.002 TL 7.66 PV Pipe: 46 36.4 2.157 PL 6.50 PF 0.1 A2 13.0 0.0 22.0 0.0 3.2 120 FTG PE 0.0 A3 13.0 0.0 21.9 0.0 0.012 TL 6.50 PV Pipe: 47 177.1 2.157 PL 7.66 PF 1.7 B1 13.0 0.0 63.6 0.0 15.5 120 FTG PE 0.0 B2 13.0 0.0 65.3 0.0 0.220 TL 7.66 PV Pipe: 48 176.3 2.157 PL 1.66 PF 0.4 B2 13.0 0.0 65.3 0.0 15.5 120 FTG PE 0.0 B3 13.0 0.0 64.9 0.0 0.218 TL 1.66 PV Pipe: 49 176.3 2.157 PL 5.66 PF 1.2 B3 13.0 0.0 64.9 0.0 15.5 120 FTG PE 0.0 B4 13.0 0.0 63.7 0.0 0.218 TL 5.66 PV Pipe: 50 536.3 4.260 PL 25.00 PF 4.8 B2 13.0 0.0 65.3 0.0 12.1 120 FTG 2ET PE 0.0 TOR 13.0 0.0 70.0 0.0 0.062 TL 77.00 PV Pipe: 51 536.3 6.357 PL 11.00 PF 0.8 TOR 13.0 0.0 70.0 0.0 5.4 120 FTG TCG PE 4.8 BOR 2.0 H.S. 75.6 100.0 0.009 TL 93.00 PV Pipe: 52 636.3 8.249 PL 20.00 PF 0.4 BOR 2.0 H.S. 75.6 100.0 3.8 120 FTG 2ECG PE 0.9 PUMP 0.0 SRCE 76.9 N/A) 0.003 TL 120.00 PV SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 9 DA.TE:8/26/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\OFFICE0826.SDF JOB TITLE: Sanford Lowes Office NOTES: 1) Calculations were performed by the HASS 7.4 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 LaVista Road Tucker, GA 30084 2) The system has been calculated to provide an average imbalance at each node of 0.002 gpm and a maximum imbalance at any node of 0.099 gpm. 3) Total pressure at each node is used in balancing the system. Maximum water velocity is 16.1 ft/sec at pipe 14. 4) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP PAGE: B MATERIAL: THNWL HWC: 120 Diameter Equivalent Fitting Lengths in Feet in) E T L C B G A D N Ell Tee LngEll ChkVly BfyVly GatVly AlmChk DPVly NPTee 2.157 6.00 12.00 3.00 14.00 8.00 1.00 12.00 12.00 12.00 4.260 13.00 26.00 8.00 29.00 16.00 3.00 26.00 26.00 26.00 6.357 18.00 38.00 11.00 40.00 13.00 4.00 35.00 35.00 38.00 8.249 21.00 41.00 15.00 53.00 14.00 5.00 37.00 37.00 41.00 5168 MOBILE SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX e / HYDRAULIC CALCULATIONS V FOR LOWES OF Sanford FL IN RACKS FILE NUMBER: In,racks.idf DATE: JUL 25, 2002 DESIGN DATA - OCCUPANCY CLASSIFICATION: DENSITY: AREA OF APPLICATION: COVERAGE PER SPRINKLER: NUMBER OF SPRINKLERS CALCULATED: TOTAL SPRINKLER WATER FLOW REQUIRED: TOTAL WATER REQUIRED (including hose): FLOW AND PRESSURE (@ BOR): SPRINKLER ORIFICE SIZE: NAME OF CONTRACTOR: MERCHANTILE 25 PSI PER HEAD 12 HEADS BALANCED W/OVERHEAD SYST 99 sq. ft. 24 sprinklers 1871.5 gpm 1971.5 gpm 1971.5 gpm @ 84.86 psi 0.64 inch DESIGN/LAYOUT BY: MEH AUTHORITY HAVING JURISDICTION: LOWERS CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION NUMBER: Florida Permit No. 466077000199 RECEIV DPsE?0 io SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page"1 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack WATER SUPPLY DATA SOURCE STATIC RESID. FLOW AVAIL. TOTAL REQ'D NODE PRESS. PRESS. @ PRESS. @ DEMAND PRESS. TAG PSI) PSI) (GPM) PSI) GPM) PSI) PUMP 170.0 116.0 1875.0 110.7 1971.5 84.9 AGGREGATE FLOW ANALYSIS: TOTAL FLOW AT SOURCE 1971.5 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 1871.5 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) Rl 8.0 K=11.20 26.3 57.5 R2 8.0 K=11.20 25.7 56.8 R3 8.0 K=11.20 25.6 56.6 R4 8.0 K=11.20 25.6 56.7 R5 8.0 K=11.20 25.6 56.6 R6 8.0 K=11.20 25.6 56.7 CT1 23.0 36.5 CB1 8.0 39.2 R7 8.0 K=11.20 26.8 57.9 R8 8.0 K=11.20 26.1 57.3 R9 8.0 K=11.20 26.0 57.1 R10 8.0 K=11.20 26.0 57.1 Rll 8.0 K=11.20 26.5 57.6 R12 8.0 K=11.20 27.2 58.5 DB1 8.0 38.1 DT1 23.0 34.9 CT2 23.0 38.0 CB2 8.0 44.2 DB2 8.0 42.1 DT2 23.0 35.3 CT3 23.0 38.7 CB3 8.0 44.8 DB3 8.0 42.4 DT3 23.0 35.5 CT4 23.0 42.1 CB4 8.0 48.0 DB4 8*0 42.7 DT4 23.0 35.6 ABY 23.0 65.5 TOIR 23.0 70.9 PUMP 0.0 SOURCE 84.9 1971.5 A01 23.0 55.4 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 DATE! 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack NODE ANALYSIS DATA (cont.) NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) AT1 25.0 50.8 S1 25.0 K=25.20 15.7 99.7 S2 25.0 K=25.20 15.0 97.6 S3 25.0 K=25.20 15.0 97.6 S4 25.0 K=25.20 15.6 99.7 BT1 25.0 42.1 BB1 23.0 46.7 AB2 23.0 55.4 AT2 25.0 50.8 S5 25.0 K=25.20 15.7 99.8 S6 25.0 K=25.20. 15.0 97.6 S7 25.0 K=25.20 15.0 97.6 S8 25.0 K=25.20 15.7 99.7 BT2 25.0 42.2 BB2 23.0 46.8 AB3 23.0 55.5 AT3 25.0 50.8 S9 25.0 K=25.20 15.7 100.0 S10 25.0 K=25.20 15.1 97.9 Sil 25.0 K=25.20 15.1 97.9 S12 25.0 K=25.20 15.7 100.0 BT3 25.0 42.5 BB3 23.0 47.1 AB4 23.0 55.6 AT4 25.0 54.4 BT4 25.0 47.4 BB4 23.0 47.9 AB5 23.0 55.7 AT5 25.0 54.5 BT5 25.0 48.0 BB5 23.0 48.5 AB6 23.0 55.9 AT6 25.0 54.7 BT6 25.0 48.5 BB6 23.0 49.0 AB7 23.0 56.0 AT7 25.0 54.9 BT7 25.0 48.9 BB7 23.0 49.4 AB8 23.0 56.2 AT8 25.0 55.1 BT8 25.0 49.2 BB8 23.0 49.8 AB9 23.0 56.5 AT9 25.0 55.3 BT9 25.0 49.5 BB9 23.0 50.0 AB10 23.0 56.7 AT10 25.0 55.5 BT10 25.0 49.6 BB10 23.0 50.2 AB11 23.0 57.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 3 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.gDF JOB TITLE: Lowe's Sanford,Florida Esfr system 1 w/inrack NODE ANALYSIS DATA (cont.) NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) (GPM) AT11 25.0 55.8 - - - BT11 25.0 49.8 - - - BB11 23.0 50.3 - - - AB12 23.0 57.3 - - - AT12 25.0 56.1 - - - BT12 25.0 49.9 - - - BB12 23.0 50.4 - - - AB13 23.0 57.6 - - - AT13 25.0 56.4 - - - BT13 25.0 49.9 - - - BB13 23.0 50.4 - - - AB14 23.0 57.7 - - - AT14 25.0 56.4 - - - BB14 23.0 50.4 - - - BT14 25.0 49.9 - - - ABx 23.0 57.7 - - - TOR 23.0 68.4 - - - BOR 2.0 HOSE STREAM 81.4 100.0 J. SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack PIPE DATA PIPE TAG Q(GPM) • DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 1 57.5 2.157 PL 3.00 PF 0.4 R1 8.0 11.2 26.3 57.5 5.0 120 FTG T PE 0.0 R7 8.0 11.2 26.8 57.9 0.027 TL 15.00 Pv 0.2 Pipe: 2 56.8 2.157 PL 3.00 PF 0.4 R2 8.0 11.2 25.7 56.8 5.0 120 FTG T PE 0.0 R8 8.0 11.2 26.1 57.3 0.027 TL 15.00 Pv 0.2 Pipe: 3 56.6 2.157 PL 3.00 PF 0.4 R3 8.0 11.2 25.6 56.6 5.0 120 FTG T PE 0.0 R9 8.0 11.2 26.0 57.1 0.027 TL 15.00 Pv 0.2 Pipe: 4 56.7 2.157 PL 3.00 PF 0.4 R4 8.0 11.2 25.6 56.7 5.0 120 FTG T PE 0.0 R10 8.0 11.2 26.0 57.1 0.027 TL 15.00 Pv 0.2 Pipe: 5 56.6 2.157 PL 3.00 PF 0.4 R5 8.0 11.2 25.6 56.6 5.0 120 FTG T PE 0.0 R9 8.0 11.2 26.0 57.1 0.027 TL 15.00 Pv 0.2 Pipe: 6 56.7 2.157 PL 3.00 PF 0.4 R6 8.0 11.2 25.6 56.7 5.0 120 FTG T PE 0.0 R10 8.0 11.2 26.0 57.1 0.027 TL 15.00 Pv 0.2 Pipe: 8 355.7 2.635 PL 33.43 PF 12.5 CBI 8.0 0.0 39.2 0.0 20.9 120 FTG E PE 0.0 R7 8.0 11.2 26.8 57.9 0.301 TL 41.43 Pv 2.9 Pipe: 9 240.3 2.635 PL 4.16 PF 0.6 R7 8.0 11.2 26.8 57.9 14.1 120 FTG PE 0.0 R8 8.0 11.2 26.1 57.3 0.146 TL 4.16 Pv 1.3 Pipe: 10 126.2 2.635 PL 4.16 PF 0.2 R8 8.0 11.2 26.1 57.3 7.4 120 FTG PE 0.0 R9 8.0 11.2 26.0 57.1 0.044 TL 4.16 Pv 0.4 Pipe: 11 44.1 2.635 PL 4.16 PF 0.0 R9 8.0 11.2 26.0 57.1 2.6 120 FTG PE 0.0 R10 8.0 11.2 26.0 57.1 0.006 TL 4.16 Pv 0.0 Pipe: 12 214.6 2.635 PL 4.16 PF 0.5 R10 8.0 11.2 26.0 57.1 12.6 120 FTG PE 0.0 Rll 8.0 11.2 26.5 57.6 0.118 TL 4.16 Pv 1.1 Pipe: 13 272.2 2.635 PL 4.16 PF 0.8 Rll 8.0 11.2 26.5 57.6 16.0 120 FTG PE 0.0 R12 8.0 11.2 27.2 58.5 0.184 TL 4.16 Pv 1.7 Pipe: 14 330.7 2.635 PL 33.43 PF 10.9 R12 8.0 11.2 27.2 58.5 19.5 120 FTG E PE 0.0 DB1 8.0 0.0 38.1 0.0 0.263 TL 41.43 Pv 2.5 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Pjage 5 . DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 15 94.2 2.635 PL 64.75 PF 2.1 CB2 8.0 0.0 44.2 0.0 5.5 120 FTG 2E PE 0.0 DB2 8.0 0.0 42.1 0.0 0.026 TL 80.75 PV 0.2 Pipe: 16 102.9 2.635 PL 64.75 PF 2.5 CB3 8.0 0.0 44.8 0.0 6.1 120 FTG 2E PE 0.0 DB3 8.0 0.0 42.4 0.0 0.030 TL 80.75 PV 0.2 Pipe: 17 133.6 2.635 PL 91.00 PF 5.3 CB4 8.0 0.0 48.0 0.0 7.9 120 FTG 2E PE 0.0 DB4 8.0 0.0 42.7 0.0 0.049 TL 107.00 Pv 0.4 Pipe: 18 355.7 3.260 PL 15.00 PF 3.7 CB1 8.0 0.0 39.2 0.0 13.7 120 FTG T PE 6.5 CT1 23.0 0.0 36.5 0.0 0.107 TL 35.00 Pv 1.3 Pipe: 19 94.2 3.260 PL 15.00 PF 0.3 CB2 8.0 0.0 44.2 0.0 3.6 120 FTG T PE 6.5 CT2 23.0 0.0 38.0 0.0 0.009 TL 35.00 Pv 0.1 Pipe: 20 102.9 3.260 PL 15.00 PF 0.4 CB3 8.0 0.0 44.8 0.0 4.0 120 FTG T PE 6.5 CT3 23.0 0.0 38.7 0.0 0.011 TL 35.00 Pv 0.1 Pipe: 21 133.6 3.260 PL 15.00 PF 0.6 CB4 8.0 0.0 48.0 0.0 5.1 120 FTG T PE 6.5 CT4 23.0 0.0 42.1 0.0 0.017 TL 35.00 Pv 0.2 Pipe: 22 330.7 3.260 PL 15.00 PF 3.3 DB1 8.0 0.0 38.1 0.0 12.7 120 FTG T PE 6.5 DT1 23.0 0.0 34.9 0.0 0.093 TL 35.00 Pv 1.1 Pipe: 23 94.2 3.260 PL 15.00 PF 0.3 DB2 8.0 0.0 42.1 0.0 3.6 120 FTG T PE 6.5 DT2 23.0 0.0 35.3 0.0 0.009 TL 35.00 Pv 0.1 Pipe: 24 102.9 3.260 PL 15.00 PF 0.4 DB3 8.0 0.0 42.4 0.0 4.0 120 FTG T PE 6.5 DT3 23.0 0.0 35.5 0.0 0.011 TL 35.00 Pv 0.1 Pipe: 25 133.6 3.260 PL 15.00 PF 0.6 DB4 8.0 0.0 42.7 0.0 5.1 120 FTG T PE 6.5 DT4 23.0 0.0 35.6 0.0 0.017 TL 35.00 Pv 0.2 Pipe: 26 330.7 4.260 PL 15.50 PF 0.4 DT1 23.0 0.0 34.9 0.0 7.4 120 FTG PE 0.0 DT2 23.0 0.0 35.3 0.0 0.025 TL 15.50 Pv 0.4 Pipe: 27 236.5 4.260 PL 15.50 PF 0.2 DT2 23.0 0.0 35.3 0.0 5.3 120 FTG PE 0.0 DT3 23.0 0.0 35.5 0.0 0.014 TL 15.50 Pv 0.2 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 6 DACE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF 308 TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 28 133.6 4.260 PL 13.00 PF 0.1 DT3 23.0 0.0 35.5 0.0 3.0 120 FTG PE 0.0 DT4 23.0 0.0 35.6 0.0 0.005 TL 13.00 Pv 0.1 Pipe: 29 355.7 4.260 PL 40.50 PF 1.6 CT1 23.0 0.0 36.5 0.0 8.0 120 FTG E PE 0.0 CT2 23.0 0.0 38.0 0.0 0.029 TL 53.50 Pv 0.4 Pipe: 30 449.9 4.260 PL 15.50 PF 0.7 CT2 23.0 0.0 38.0 0.0 10.1 120 FTG PE 0.0 CT3 23.0 0.0 38.7 0.0 0.045 TL 15.50 Pv 0.7 Pipe: 31 552.8 4.260 PL 38.00 PF 3.3 CT3 23.0 0.0 38.7 0.0 12.4 120 FTG E PE 0.0 CT4 23.0 0.0 42.1 0.0 0.066 TL 51.00 Pv 1.0 Pipe: 31A 686.4 4.260 PL 213.00 PF 23.4 CT4 23.0 0.0 42.1 0.0 15.5 120 FTG 2E PE 0.0 ABY 23.0 0.0 65.5 0.0 0.098 TL 239.00 Pv 1.6 Pipe: 32 686.4 4.260 PL 16.00 PF 5.4 ABY 23.0 0.0 65.5 0.0 15.5 120 FTG 3E PE 0.0 TOIR 23.0 0.0 70.9 0.0 0.098 TL 55.00 Pv 1.6 Pipe: 33 686.4 6.357 PL 21.00 PF 1.4 TOIR 23.0 0.0 70.9 0.0 6.9 120 FTG TCG PE 9.1 BOR 2.0 H.S. 81.4 100.0 0.014 TL 103.00 Pv 0.3 Pipe: 34 198.0 2.157 PL 2.00 PF 3.8 AB1 23.0 0.0 55.4 0.0 17.4 120 FTG T PE 0.9 AT1 25.0 0.0 50.8 0.0 0.270 TL 14.00 Pv 2.0 Pipe: 35 198.0 2.157 PL 118.00 PF 35.1 AT1 25.0 0.0 50.8 0.0 17.4 120 FTG T PE 0.0 S1 25.0 25.2 15.7 99.7 0.270 TL 130.00 Pv 2.0 Pipe: 36 98.3 2.157 PL 9.00 PF 0.7 S1 25.0 25.2 15.7 99.7 8.6 120 FTG PE 0.0 S2 25.0 25.2 15.0 97.6 0.074 TL 9.00 Pv 0.5 Pipe: 37 0.7 2.157 PL 9.00 PF 0.0 S2 25.0 25.2 15.0 97.6 0.1 120 FTG PE 0.0 S3 25.0 25.2 15.0 97.6 0.000 TL 9.00 PV 0.0 Pipe: 38 96.9 2.157 PL 9.00 PF 0.6 S3 25.0 25.2 15.0 97.6 8.5 120 FTG PE 0.0 S4 25.0 25.2 15.6 99.7 0.072 TL 9.00 Pv 0.5 Pipe: 39 196.6 2.157 PL 87.25 PF 26.5 S4 25.0 25.2 15.6 99.7 17.3 120 FTG T PE 0.0 BT1 25.0 0.0 42.1 0.0 0.267 TL 99.25 Pv 2.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 7 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACk.tDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 40 -196.6 2.157 PL 2.00 PF 3.7 BT1 25.0 0.0 42.1 0.0 17.3 120 FTG T PE 0.9 BB1 23.0 0.0 46.7 0.0 0.267 TL 14.00 Pv 2.0 Pipe: 41 198.0 6.357 PL 10.17 PF 0.0 AB2 23.0 0.0 55.4 0.0 2.0 120 FTG ---- PE 0.0 AB1 23.0 0.0 55.4 0.0 0.001 TL 10.17 Pv 0.0 Pipe: 42 198.0 2.157 PL 2.00 PF 3.8 AB2 23.0 0.0 55.4 0.0 17.4 120 FTG T PE -0.9 AT2 25.0 0.0 50.8 0.0 0.270 TL 14.00 Pv 2.0 Pipe: 43 198.0 2.157 PL 118.00 PF 35.1 AT2 25.0 0.0 50.8 0.0 17.4 120 FTG T PE 0.0 S5 25.0 25.2 15.7 99.8 0.270 TL 130.00 Pv 2.0 Pipe: 44 98.2 2.157 PL 9.00 PF 0.7 S5 25.0 25.2 15.7 99.8 8.6 120 FTG ---- PE 0.0 S6 25.0 25.2 15.0 97.6 0.074 TL 9.00 Pv 0.5 Pipe: 45 0.6 2.157 PL 9.00 PF 0.0 S6 25.0 25.2 15.0 97.6 0.0 120 FTG ---- PE 0.0 S7 25.0 25.2 15.0 97.6 0.000 TL 9.00 Pv 0.0 Pipe: 46 -97.1 2.157 PL 9.00 PF 0.7 S7 25.0 25.2 15.0 97.6 8.5 120 FTG ---- PE 0.0 S8 25.0 25.2 15.7 99.7 0.072 TL 9.00 Pv 0.5 Pipe: 47 -196.8 2.157 PL 87.25 PF 26.5 S8 25.0 25.2 15.7 99.7 17.3 120 FTG T PE 0.0 BT2 25.0 0.0 42.2 0.0 0.267 TL 99.25 Pv 2.0 Pipe: 48 -196.8 2.157 PL 2.00 PF 3.7 BT2 25.0 0.0 42.2 0.0 17.3 120 FTG T PE 0.9 BB2 23.0 0.0 46.8 0.0 0.267 TL 14.00 Pv 2.0 Pipe: 49 196.6 4.260 PL 10.17 PF 0.1 BB2 23.0 0.0 46.8 0.0 4.4 140 FTG ---- PE 0.0 BB1 23.0 0.0 46.7 0.0 0.007 TL 10.17 Pv 0.1 Pipe: 50 396.0 6.357 PL 10.17 PF 0.1 AB3 23.0 0.0 55.5 0.0 4.0 120 FTG ---- PE 0.0 AB2 23.0 0.0 55.4 0.0 0.005 TL 10.17 Pv 0.1 Pipe: 51 197.9 2.157 PL 2.00 PF 3.8 AB3 23.0 0.0 55.5 0.0 17.4 120 FTG T PE -0.9 AT3 25.0 0.0 50.8 0.0 0.270 TL 14.00 Pv 2.0 Pipe: 52 197.9 2.157 PL 118.00 PF 35.1 AT3 25.0 0.0 50.8 0.0 17.4 120 FTG T PE 0.0 S9 25.0 25.2 15.7 100.0 0.270 TL 130.00 Pv 2.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 8 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 53 97.9 2.157 PL 9.00 PF 0.7 S9 25.0 25.2 15.7 100.0 8.6 120 FTG PE 0.0 S10 25.0 25.2 15.1 97.9 0.073 TL 9.00 PV 0.5 Pipe: 54 0.1 2.157 PL 9.00 PF 0.0 S10 25.0 25.2 15.1 97.9 0.0 120 FTG PE 0.0 S11 25.0 25.2 15.1 97.9 0.000 TL 9.00 PV 0.0 Pipe: 55 97.8 2.157 PL 9.00 PF 0.7 Sil 25.0 25.2 15.1 97.9 8.6 120 FTG PE 0.0 S12 25.0 25.2 15.7 100.0 0.073 TL 9.00 Pv 0.5 Pipe: 56 197.8 2.157 PL 87.25 PF 26.8 S12 25.0 25.2 15.7 100.0 17.4 120 FTG T PE 0.0 BT3 25.0 0.0 42.5 0.0 0.270 TL 99.25 Pv 2.0 Pipe: 57 197.8 2.157 PL 2.00 PF 3.8 BT3 25.0 0.0 42.5 0.0 17.4 120 FTG T PE 0.9 BB3 23.0 0.0 47.1 0.0 0.270 TL 14.00 PV 2.0 Pipe: 58 393.4 4.260 PL 10.17 PF 0.4 BB3 23.0 0.0 47.1 0.0 8.9 120 FTG PE 0.0 BB2 23.0 0.0 46.8 0.0 0.035 TL 10.17 Pv 0.5 Pipe: 59 593.9 6.357 PL 10.17 PF 0.1 AB4 23.0 0.0 55.6 0.0 6.0 120 FTG PE 0.0 AB3 23.0 0.0 55.5 0.0 0.011 TL 10.17 Pv 0.2 Pipe: 60 57.1 2.157 PL 2.00 PF 0.4 AB4 23.0 0.0 55.6 0.0 5.0 120 FTG T PE 0.9 AT4 25.0 0.0 54.4 0.0 0.027 TL 14.00 PV 0.2 Pipe: 61 57.1 2.157 PL 232.25 PF 6.9 AT4 25.0 0.0 54.4 0.0 5.0 120 FTG 2T PE 0.0 BT4 25.0 0.0 47.4 0.0 0.027 TL 256.25 Pv 0.2 Pipe: 62 57.1 2.157 PL 2.00 PF 0.4 BT4 25.0 0.0 47.4 0.0 5.0 120 FTG T PE 0.9 BB4 23.0 0.0 47.9 0.0 0.027 TL 14.00 PV 0.2 Pipe: 63 591.2 4.260 PL 10.17 PF 0.8 BB4 23.0 0.0 47.9 0.0 13.3 120 FTG PE 0.0 BB3 23.0 0.0 47.1 0.0 0.074 TL 10.17 Pv 1.2 Pipe: 64 651.0 6.357 PL 10.17 PF 0.1 AB5 23.0 0.0 55.7 0.0 6.6 120 FTG PE 0.0 AB4 23.0 0.0 55.6 0.0 0.013 TL 10.17 Pv 0.3 Pipe: 65 55.1 2.157 PL 2.00 PF 0.4 AB5 23.0 0.0 55.7 0.0 4.8 120 FTG T PE 0.9 AT5 25.0 0.0 54.5 0.0 0.025 TL 14.00 Pv 0.2 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 9 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACk.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES (FT) K) PSI) GPM) FL/FT PSI) Pipe: 66 55.1 2.157 PL 232.25 PF 6.5 AT5 25.0 0.0 54.5 0.0 4.8 120 FTG 2T PE 0.0 BT5 25.0 0.0 48.0 0.0 0.025 TL 256.25 Pv 0.2 Pipe: 67 55.1 2.157 PL 2.00 PF 0.4 BT5 25.0 0.0 48.0 0.0 4.8 120 FTG T PE 0.9 BB5 23.0 0.0 48.5 0.0 0.025 TL 14.00 PV 0.2 Pipe: 68 534.1 4.260 PL 10.17 PF 0.6 BB5 23.0 0.0 48.5 0.0 12.0 120 FTG ---- PE 0.0 BB4 23.0 0.0 47.9 0.0 0.062 TL 10.17 Pv 1.0 Pipe: 69 706.1 6.357 PL 10.17 PF 0.1 AB6 23.0 0.0 55.9 0.0 7.1 120 FTG ---- PE 0.0 AB5 23.0 0.0 55.7 0.0 0.015 TL 10.17 Pv 0.3 Pipe: 70 53.6 2.157 PL 2.00 PF 0.3 AB6 23.0 0.0 55.9 0.0 4.7 120 FTG T PE 0.9 AT6 25.0 0.0 54.7 0.0 0.024 TL 14.00 Pv 0.1 Pipe: 71 53.6 2.157 PL 232.25 PF 6.2 AT6 25.0 0.0 54.7 0.0 4.7 120 FTG 2T PE 0.0 BT6 25.0 0.0 48.5 0.0 0.024 TL 256.25 Pv 0.1 Pipe: 72 53.6 2.157 PL 2.00 PF 0.3 BT6 25.0 0.0 48.5 0.0 4.7 120 FTG T PE 0.9 BB6 23.0 0.0 49.0 0.0 0.024 TL 14.00 PV 0.1 Pipe: 73 479.0 4.260 PL 10.17 PF 0.5 BB6 23.0 0.0 49.0 0.0 10.8 120 FTG ---- PE 0.0 BB5 23.0 0.0 48.5 0.0 0.050 TL 10.17 Pv 0.8 Pipe: 74 759.7 6.357 PL 10.17 PF 0.2 AB7 23.0 0.0 56.0 0.0 7.7 120 FTG ---- PE 0.0 AB6 23.0 0.0 55.9 0.0 0.017 TL 10.17 Pv 0.4 Pipe: 75 52.6 2.157 PL 2.00 PF 0.3 AB7 23.0 0.0 56.0 0.0 4.6 120 FTG T PE 0.9 AT7 25.0 0.0 54.9 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 76 52.6 2.157 PL 232.25 PF 5.9 AT7 25.0 0.0 54.9 0.0 4.6 120 FTG 2T PE 0.0 BT7 25.0 0.0 48.9 0.0 0.023 TL 256.25 Pv 0.1 Pipe: 77 52.6 2.157 PL 2.00 PF 0.3 BT7 25.0 0.0 48.9 0.0 4.6 120 FTG T PE 0.9 BB7 23.0 0.0 49.4 0.0 0.023 TL 14.00 PV 0.1 Pipe: 78 425.4 4.260 PL 10.17 PF 0.4 BB7 23.0 0.0 49.4 0.0 9.6 120 FTG ---- PE 0.0 BB6 23.0 0.0 49.0 0.0 0.040 TL 10.17 Pv 0.6 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 10 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/inrack PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 79 812.3 6.357 PL 10.17 PF 0.2 AB8 23.0 0.0 56.2 0.0 8.2 120 FTG PE 0.0 AB7 23.0 0.0 56.0 0.0 0.019 TL 10.17 PV 0.5 Pipe: 80 52.0 2.157 PL 2.00 PF 0.3 AB8 23.0 0.0 56.2 0.0 4.6 120 FTG T PE 0.9 AT8 25.0 0.0 55.1 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 81 52.0 2.157 PL 232.25 PF 5.8 AT8 25.0 0.0 55.1 0.0 4.6 120 FTG 2T PE 0.0 BT8 25.0 0.0 49.2 0.0 0.023 TL 256.25 Pv 0.1 Pipe: 82 52.0 2.157 PL 2.00 PF 0.3 BT8 25.0 0.0 49.2 0.0 4.6 120 FTG T PE 0.9 BB8 23.0 0.0 49.8 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 83 372.9 4.260 PL 10.17 PF 0.3 BB8 23.0 0.0 49.8 0.0 8.4 120 FTG PE 0.0 BB7 23.0 0.0 49.4 0.0 0.032 TL 10.17 PV 0.5 Pipe: 84 864.3 6.357 PL 10.17 PF 0.2 AB9 23.0 0.0 56.5 0.0 8.7 120 FTG PE 0.0 AB8 23.0 0.0. 56.2 0.0 0.021 TL 10.17 Pv 0.5 Pipe: 85 51.9 2.157 PL 2.00 PF 0.3 AB9 23.0 0.0 56.5 0.0 4.6 120 FTG T PE 0.9 AT9 25.0 0.0 55.3 0.0 0.023 TL 14.00 PV 0.1 Pipe: 86 51.9 2.157 PL 232.25 PF 5.8 AT9 25.0 0.0 55.3 0.0 4.6 120 FTG 2T PE 0.0 BT9 25.0 0.0 49.5 0.0 0.023 TL 256.25 Pv 0.1 Pipe: 87 51.9 2.157 PL 2.00 PF 0.3 BT9 25.0 0.0 49.5 0.0 4.6 120 FTG T PE 0.9 BB9 23.0 0.0 50.0 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 88 320.9 4.260 PL 10.17 PF 0.2 BB9 23.0 0.0 50.0 0.0 7.2 120 FTG PE 0.0 BB8 23.0 0.0 49.8 0.0 0:024 TL 10.17 PV 0.4 Pipe: 89 916.1 6.357 PL 10.17 PF 0.2 AB10 23.0 0.0 56.7 0.0 9.3 120 FTG PE 0.0 AB9 23.0 0.0 56.5 0.0 0.024 TL 10.17 Pv 0.6 Pipe: 90 52.2 2.157 PL 2.00 PF 0.3 AB10 23.0 0.0 56.7 0.0 4.6 120 FTG T PE 0.9 AT10 25.0 0.0 55.5 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 91 52.2 2.157 PL 232.25 PF 5.9 AT10 25.0 0.0 55.5 0.0 4.6 120 FTG 2T PE 0.0 BT10 25.0 0.0 49.6 0.0 0.023 TL 256.25 Pv 0.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 11, DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 92 52.2 2.157 PL 2.00 PF 0.3 BT10 25.0 0.0 49.6 0.0 4.6 120 FTG T PE 0.9 BB10 23.0 0.0 50.2 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 93 269.0 4.260 PL 10.17 PF 0.2 BB10 23.0 0.0 50.2 0.0 6.1 120 FTG PE 0.0 BB9 23.0 0.0 50.0 0.0 0.017 TL 10.17 Pv 0.2 Pipe: 94 968.3 6.357 PL 10.17 PF 0.3 AB11 23.0 0.0 57.0 0.0 9.8 120 FTG PE 0.0 AB10 23.0 0.0 56.7 0.0 0.026 TL 10.17 Pv 0.6 Pipe: 95 52.8 2.157 PL 2.00 PF 0.3 A011 23.0 0.0 57.0 0.0 4.6 120 FTG T PE 0.9 AT11 25.0 0.0 55.8 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 96 52.8 2.157 PL 232.25 PF 6.0 AT11 25.0 0.0 55.8 0.0 4.6 120 FTG 2T PE 0.0 BT11 25.0 0.0 49.8 0.0 0.023 TL 256.25 Pv 0.1 Pipe: 97 52.8 2.157 PL 2.00 PF 0.3 BT11 25.0 0.0 49.8 0.0 4.6 120 FTG T PE 0.9 BB11 23.0 0.0 50.3 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 98 216.8 4.260 PL 10.17 PF 0.1 BB11 23.0 0.0 50.3 0.0 4.9 120 FTG PE 0.0 BB10 23.0 0.0 50.2 0.0 0.012 TL 10.17 Pv 0.2 Pipe: 99 1021.1 6.357 PL 10.17 PF 0.3 AB12 23.0 0.0 57.3 0.0 10.3 120 FTG PE 0.0 AB11 23.0 0.0 57.0 0.0 0.029 TL 10.17 Pv 0.7 Pipe: 100 53.8 2.157 PL 2.00 PF 0.3 AB12 23.0 0.0 57.3 0.0 4.7 120 FTG T PE 0.9 AT12 25.0 0.0 56.1 0.0 0.024 TL 14.00 PV 0.1 Pipe: 101 53.8 2.157 PL 232.25 PF 6.2 AT12 25.0 0.0 56.1 0.0 4.7 120 FTG 2T PE 0.0 BT12 25.0 0.0 49.9 0.0 0.024 TL 256.25 Pv 0.1 Pipe: 102 53.8 2.157 PL 2.00 PF 0.3 BT12 25.0 0.0 49.9 0.0 4.7 120 FTG T PE 0.9 BB12 23.0 0.0 50.4 0.0 0.024 TL 14.00 PV 0.1 Pipe: 103 164.0 4.260 PL 10.17 PF 0.1 BB12 23.0 0.0 50.4 0.0 3.7 120 FTG PE 0.0 BB11 23.0 0.0 50.3 0.0 0.007 TL 10.17 Pv 0.1 Pipe: 104 1074.9 6.357 PL 10.17 PF 0.3 AB13 23.0 0.0 57.6 0.0 10.9 120 FTG PE 0.0 AB12 23.0 0.0 57.3 0.0 0.032 TL 10.17 Pv 0.8 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 12 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/inrack PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 105 55.0 2.157 PL 2.00 PF 0.4 AB13 23.0 0.0 57.6 0.0 4.8 120 FTG T PE 0.9 AT13 25.0 0.0 56.4 0.0 0.025 TL 14.00 Pv 0.2 Pipe: 106 55.0 2.157 PL 232.25 PF 6.5 AT13 25.0 0.0 56.4 0.0 4.8 120 FTG 2T PE 0.0 BT13 25.0 0.0 49.9 0.0 0.025 TL 256.25 Pv 0.2 Pipe: 107 55.0 2.157 PL 2.00 PF 0.4 BT13 25.0 0.0 49.9 0.0 4.8 120 FTG T PE 0.9 BB13 23.0 0.0 50.4 0.0 0.025 TL 14.00 Pv 0.2 Pipe: 108 110.3 4.260 PL 10.17 PF 0.0 BB13 23.0 0.0 50.4 0.0 2.5 120 FTG PE 0.0 BB12 23.0 0.0 50.4 0.0 0.003 TL 10.17 Pv 0.0 Pipe: 109 55.3 6.357 PL 7.75 PF 0.0 AB14 23.0 0.0 57.7 0.0 0.6 120 FTG T PE 0.0 ABX 23.0 0.0 57.7 0.0 0.000 TL 45.75 Pv 0.0 Pipe: 110 1129.9 6.357 PL 2.42 PF 0.1 ABX 23.0 0.0 57.7 0.0 11.4 120 FTG PE 0.0 AB13 23.0 0.0 57.6 0.0 0.035 TL 2.42 Pv 0.9 Pipe: 111 55.3 2.157 PL 2.00 PF 0.4 AB14 23.0 0.0 57.7 0.0 4.9 120 FTG T PE 0.9 AT14 25.0 0.0 56.4 0.0 0.025 TL 14.00 PV 0.2 Pipe: 112 55.3 2.157 PL 232.25 PF 6.5 AT14. 25.0 0.0 56.4 0.0 4.9 120 FTG 2T PE 0.0 BT14 25.0 0.0 49.9 0.0 0.025 TL 256.25 PV 0.2 Pipe: 113 55.3 2.157 PL 2.00 PF 0.4 BT14 25.0 0.0 49.9 0.0 4.9 120 FTG T PE 0.9 BB14 23.0 0.0 50.4 0.0 0.025 TL 14.00 PV 0.2 Pipe: 114 55.3 4.260 PL 10.17 PF 0.0 BB14 23.0 0.0 50.4 0.0 1.2 120 FTG PE 0.0 BB13 23.0 0.0 50.4 0.0 0.001 TL 10.17 Pv 0.0 Pipe: 115 1185.1 6.357 PL 169.00 PF 10.7 ABX 23.0 0.0 57.7 0.0 12.0 120 FTG 4ET PE 0.0 TOR 23.0 0.0 68.4 0.0 0.038 TL 279.00 Pv 1.0 Pipe: 116 1185.1 6.357 PL 21.00 PF 3.9 TOR 23.0 0.0 68.4 0.0 12.0 120 FTG TCG PE 9.1 BOR 2.0 H.S. 81.4 100.0 0.038 TL 103.00 Pv 1.0 Pipe: 117 1971.5 8.249 PL 20.00 PF 2.6 BOR 2.0 H.S. 81.4 100.0 11.8 120 FTG ECG PE 0.9 PUMP 0.0 SRCE 84.9 N/A) 0.028 TL 94.00 PV 0.9 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 13 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACk.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack NOTES: 1) Calculations were performed by the HASS 7.3 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 Lavista Road Tucker, GA 30084 2) The system has been calculated to provide an average imbalance at each node of 0.001 gpm and a maximum imbalance at any node of 0.113 gpm. 3) velocity pressures are printed for information only and are not used in balancing the system. Maximum water velocity is 20.9 ft/sec at pipe 8. 4) a. System remote area HAS been proven or 'peaked'. b. Minimum pressure at any sprinkler: 14.999 psi c. Minimum pressure with remote area shifted one sprinkler space toward left cross main: 15.026 psi d. Minimum pressure with remote area shifted one sprinkler space toward right cross main: 15.014 psi 5) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP PAGE: B MATERIAL: THNWL Diameter Equivalent in) Ell Tee LngEll 2.157 6.00 12.00 4.00 2.635 8.00 17.00 6.00 3.260 9.00 20.00 7.00 4.260 13.00 26.00 8.00 6.357 18.00 38.00 11.00 8.249 20.00 39.00 15.00 HWC: 120 Fitting Lengths in Feet C B G A D N Chkvly BfyVly Gately A1mChk DPvly NPTee 14.00 7.00 1.00 12.00 12.00 12.00 19.00 10.00 1.00 14.00 14.00 17.00 22.00 13.00 1.00 18.00 13.00 20.00 29.00 16.00 3.00 26.00 13.00 26.00 40.00 13.00 4.00 35.00 24.00 38.00 50.00 13.00 4.00 39.00 30.00 39.00 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 14 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr system 1 w/inrack WATER SUPPLY ANALYSIS 180.0 150.0 G A U G120.0 E P R E S 90.0 S U R E p s i 1 1 30.0 M Static: 170.00 psi Resid: 116.00 psi Flow: 1875.0 gpm 2 2 40(600 800 1000 1200 1400 1600 1800 2000 FLOW (GPM) LEGEND Available pressure 110.75 psi @ 1971.5 Required pressure 84.86 psi @ 1971.5.c SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 15 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACk.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/Inrack SPRINKLER SYSTEM DIAGRAM WITH FLOWPLOT PORT SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 16 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\INRACK.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 1 w/inrack REED FIRE PROTECTION 5168 MOBILE,SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX HYDRAULIC CALCULATIONS FOR LOWES of Sanford FLorida Sales Area zone #4 FILE NUMBER: ESFR4-A.SDF DATE: AUG 1, 2002 DESIGN DATA - OCCUPANCY CLASSIFICATION: MERCANTILE DENSITY: AREA OF APPLICATION: COVERAGE PER SPRINKLER: NUMBER OF SPRINKLERS CALCULATED: TOTAL SPRINKLER WATER FLOW REQUIRED: 15 PSI PER HEAD 3 BRANCHLINES WITH 4 HEADS EACH 95 sq. ft. 12 sprinklers 1202.7 gpm TOTAL WATER REQUIRED (including hose): 1302.7 gpm FLOW AND PRESSURE (@ BOR): SPRINKLER ORIFICE SIZE: NAME OF CONTRACTOR: DESIGN/LAYOUT BY: MEH 1302.7 gpm @ 75.54 psi ESFR-25 AUTHORITY HAVING JURISDICTION: LOWERS CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION NUMBER: Florida Permit No. 466077000199 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ) CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ) RE IV SEP 2 0 Y0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page-1 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF 300 TITLE: Lowe's Sanford,Florida Esfr System 4 WATER SUPPLY DATA SOURCE STATIC RESID. FLOW NODE PRESS. PRESS. @ TAG PSI) PSI) (GPM) PUMP 170.0 116.0 1875.0 AGGREGATE FLOW ANALYSIS: AVAIL. TOTAL REQ'D PRESS. @ DEMAND PRESS. PSI) GPM) PSI) 142.5 1302.7 75.5 TOTAL FLOW AT SOURCE 1302.7 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 1202.7 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) Si 25.0 K=25.20 16.3 101.9 S2 25.0 K=25.20 15.8 100.1 S3 25.0 K=25.20 15.8 100.1 S4 25.0 K=25.20 16.6 102.7 S5 25.0 K=25.20 15.6 99.6 S6 25.0 K=25.20 15.0 97.6 S7 25.0 K=25.20 15.0 97.6 S8 25.0 K=25.20 15.7 99.8 S9 25.0 K=25.20 16.4 102.0 S10 25.0 K=25.20 15.7 99.7 S11 25.0 K=25.20 15.7 99.7 512 25.0 K=25.20 16.3 101.8 AT1 25.0 40.5 AT2 25.0 40.5 AT3 25.0 40.1 AT4 25.0 43.9 AT5 25.0 44.0 AT6 25.0 44.2 AT7 25.0 44.4 AT8 25.0 44.6 AT9 25.0 44.8 AT10 25.0 45.0 AT11 25.0 45.3 AT12 25.0 45.6 AT13 25.0 45.9 AT14 25.0 46.2 AT15 25.0 46.5 AB1 23.0 45.0 A02 23.0 45.0 AB3 23.0 45.0 AB4 23.0 45.1 AB5 23.0 45.2 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 DATE' 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 NODE ANALYSIS DATA (font.) NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) AB6 23.0 45.4 AB7 23.0 45.6 AB8 23.0 45.7 AB9 23.0 46.0 AB10 23.0 46.2 AB11 23.0 46.4 AB12 23.0 46.7 AB13 23.0 47.0 AB14 23.0 47.4 AB15 23.0 47.7 BT1 25.0 36.7 BT2 25.0 33.6 BT3 25.0 34.0 BT4 25.0 38.8 BT5 25.0 39.4 BT6 25.0 39.9 BT7 25.0 40.4 BT8 25.0 40.7 BT9 25.0 41.0 BT10 25.0 41.2 BT11 25.0 41.4 BT12 25.0 41.5 BT13 25.0 41.6 BT14 25.0 41.7 BT15 25.0 41.7 BB1 23.0 38.2 BB2 23.0 38.3 BB3 23.0 38.6 BB4 23.0 39.3 BB5 23.0 39.9 BB6 23.0 40.5 BB7 23.0 41.0 BB8 23.0 41.3 B69 23.0 41.6 BB10 23.0 41.8 BB11 23.0 42.0 BB12 23.0 42.1 BB13 23.0 42.2 BB14 23.0 42.2 BB15 23.0 42.2 TOR 23.0 60.4 BOR 2.0 HOSE STREAM 73.6 100.0 PUMP 0.0 SOURCE 75.5 1302.7 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 3 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF. JOB TITLE: Lowers Sanford,Florida Esfr System 4 PIPE DATA PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 1 191.9 2.157 PL 2.00 PF 3.6 AB1 23.0 0.0 45.0 0.0 16.9 120 FTG T PE -0.9 AT1 25.0 0.0 40.5 0.0 0.255 TL 14.00 Pv 1.9 Pipe: 2 191.9 2.157 PL 82.83 PF 24.2 ATI 25.0 0.0 40.5 0.0 16.9 120 FTG T PE 0.0 S1- 25.0 25.2 16.3 101.9 0.255 TL 94.83 Pv 1.9 Pipe: 3 90.1 2.157 PL 9.00 PF 0.6 S1 25.0 25.2 16.3 101.9 7.9 120 FTG ---- PE 0.0 S2 25.0 25.2 15.8 100.1 0.063 TL 9.00 Pv 0.4 Pipe: 4 -10.1 2.157 PL 9.00 PF 0.0 S2 25.0 25.2 15.8 100.1 0.9 120 FTG ---- PE 0.0 S3 25.0 25.2 15.8 100.1 0.001 TL 9.00 PV 0.0 Pipe: 5 -110.2 2.157 PL 9.00 PF 0.8 S3 25.0 25.2 15.8 100.1 9.7 120 FTG ---- PE 0.0 S4 25.0 25.2 16.6 102.7 0.091 TL 9.00 Pv 0.6 Pipe: 6 -212.9 2.157 PL 53.00 PF 20.1 S4 25.0 25.2 16.6 102.7 18.7 120 FTG T PE 0.0 BT1 25.0 0.0 36.7 0.0 0.309 TL 65.00 Pv 2.4 Pipe: 7 -212.9 2.157 PL 2.00 PF 0.6 BT1 25.0 0.0 36.7 0.0 18.7 120 FTG ---- PE 0.9 BB1 23.0 0.0 38.2 0.0 0.309 TL 2.00 Pv 2.4 Pipe: 8 194.7 2.157 PL 2.00 PF 3.7 AB2 23.0 0.0 45.0 0.0 17.1 120 FTG T PE -0.9 AT2 25.0 0.0 40.5 0.0 0.262 TL 14.00 Pv 2.0 Pipe: 9 194.7 2.157 PL 82.83 PF 24.8 AT2 25.0 0.0 40.5 0.0 17.1 120 FTG T PE 0.0 S5 25.0 25.2 15.6 99.6 0.262 TL 94.83 Pv 2.0 Pipe: 10 95.1 2.157 PL 9.00 PF 0.6 S5 25.0 25.2 15.6 99.6 8.3 120 FTG ---- PE 0.0 56 25.0 25.2 15.0 97.6 0.070 TL 9.00 Pv 0.5 Pipe: 11 -2.5 2.157 PL 9.00 PF 0.0 S6 25.0 25.2 15.0 97.6 0.2 120 FTG ---- PE 0.0 S7 25.0 25.2 15.0 97.6 0.000 TL 9.00 Pv 0.0 Pipe: 12 -100.1 2.157 PL 9.00 PF 0.7 S7 25.0 25.2 15.0 97.6 8.8 120 FTG ---- PE 0.0 S8 25.0 25.2 15.7 99.8 0.077 TL 9.00 Pv 0.5 Pipe: 13 -199.9 2.157 PL 53.00 PF 17.9 S8 25.0 25.2 15.7 99.8 17.6 120 FTG T PE 0.0 BT2 25.0 0.0 33.6 0.0 0.275 TL 65.00 Pv 2.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 14 -199.9 2.157 PL 2.00 PF 3.9 BT2 25.0 0.0 33.6 0.0 17.6 120 FTG T PE 0.9 BB2 23.0 0.0 38.3 0.0 0.275 TL 14.00 Pv 2.1 Pipe: 15 204.6 2.157 PL 2.00 PF 4.0 AB3 23.0 0.0 45.0 0.0 18.0 120 FTG 'T PE -0.9 AT3 25.0 0.0 40.1 0.0 0.287 TL 14.00 PV 2.2 Pipe: 16 204.6 2.157 PL 82.83 PF 23.8 AT3 25.0 0.0 40.1 0.0 18.0 120 FTG ---- PE 0.0 S9 25.0 25.2 16.4 102.0 0.287 TL 82.83 Pv 2.2 Pipe: 17 102.6 2.157 PL 9.00 PF 0.7 S9 25.0 25.2 16.4 102.0 9.0 120 FTG ---- PE 0.0 S10 25.0 25.2 15.7 99.7 0.080 TL 9.00 Pv 0.5 Pipe: 18 2.9 2.157 PL 9.00 PF 0.0 S10 25.0 25.2 15.7 99.7 0.3 120 FTG ---- PE 0.0 S11 25.0 25.2 15.7 99.7 0.000 TL 9.00 PV 0.0 Pipe: 19 -96.8 2.157 PL 9.00 PF 0.6 Sil 25.0 25.2 15.7 99.7 8.5 120 FTG ---- PE 0.0 S12 25.0 25.2 16.3 101.8 0.072 TL 9.00 Pv 0.5 Pipe: 20 -198.6 2.157 PL 53.00 PF 17.7 S12 25.0 25.2 16.3 101.8 17.4 120 FTG T PE 0.0 BT3 25.0 0.0 34.0 0.0 0.272 TL 65.00 Pv 2.0 Pipe: 21 -198.6 2.157 PL 2.00 PF 3.8 BT3 25.0 0.0 34.0 0.0 17.4 120 FTG T PE 0.9 BB3 23.0 0.0 38.6 0.0 0.272 TL 14.00 Pv 2.0 Pipe: 22 56.1 2.157 PL 2.00 PF 0.4 AB4 23.0 0.0 45.1 0.0 4.9 120 FTG T PE -0.9 AT4 25.0 0.0 43.9 0.0 0.026 TL 14.00 Pv 0.2 Pipe: 23 56.1 2.157 PL 169.00 PF 5.0 AT4 25.0 0.0 43.9 0.0 4.9 120 FTG 2T PE 0.0 BT4 25.0 0.0 38.8 0.0 0.026 TL 193.00 Pv 0.2 Pipe: 24 56.1 2.157 PL 2.00 PF 0.4 BT4 25.0 0.0 38.8 0.0 4.9 120 FTG T PE 0.9 BB4 23.0 0.0 39.3 0.0 0.026 TL 14.00 Pv 0.2 Pipe: 25 53.5 2.157 PL 2.00 PF 0.3 AB5 23.0 0.0 45.2 0.0 4.7 120 FTG T PE -0.9 AT5 25.0 0.0 44.0 0.0 0.024 TL 14.00 PV 0.1 Pipe: 26 53.5 2.157 PL 169.00 PF 4.6 AT5 25.0 0.0 44.0 0.0 4.7 120 FTG 2T PE 0.0 BT5 25.0 0.0 39.4 0.0 0.024 TL 193.00 Pv 0.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 5 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4=A.SDF JOB TITLE: Lowers Sanford,Florida Esfr system 4 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 27 53.5 2.157 PL 2.00 PF 0.3 BT5 25.0 0.0 39.4 0.0 4.7 120 FTG T PE 0.9 BB5 23.0 0.0 39.9 0.0 0.024 TL 14.00 Pv 0.1 Pipe: 28 51.2 2.157 PL 2.00 PF 0.3 AB6 23.0 0.0 45.4 0.0 4.5 120 FTG T PE 0.9 AT6 25.0 0.0 44.2 0.0 0.022 TL 14.00 Pv 0.1 Pipe: 29 51.2 2.157 PL 169.00 PF 4.3 AT6 25.0 0.0 44.2 0.0 4.5 120 FTG 2T PE 0.0 BT6 25.0 0.0 39.9 0.0 0.022 TL 193.00 Pv 0.1 Pipe: 30 51.2 2.157 PL 2.00 PF 0.3 BT6 25.0 0.0 39.9 0.0 4.5 120 FTG T PE 0.9 BB6 23.0 0.0 40.5 0.0 0.022 TL 14.00 Pv 0.1 Pipe: 31 49.5 2.157 PL 2.00 PF 0.3 AB7 23.0 0.0 45.6 0.0 4.3 120 FTG T PE 0.9 AT7 25.0 0.0 44.4 0.0 0.021 TL 14.00 Pv 0.1 Pipe: 32 49.5 2.157 PL 169.00 PF 4.0 AT7 25.0 0.0 44.4 0.0 4.3 120 FTG 2T PE 0.0 BT7 25.0 0.0 40.4 0.0 0.021 TL 193.00 Pv 0.1 Pipe: 33 49.5 2.157 PL 2.00 PF 0.3 BT7 25.0 0.0 40.4 0.0 4.3 120 FTG T PE 0.9 BB7 23.0 0.0 41.0 0.0 0.021 TL 14.00 Pv 0.1 Pipe: 34 48.5 2.157 PL 2.00 PF 0.3 AB8 23.0 0.0 45.7 0.0 4.3 120 FTG T PE 0.9 AT8 25.0 0.0 44.6 0.0 0.020 TL 14.00 Pv 0.1 Pipe: 35 48.5 2.157 PL 169.00 PF 3.9 AT8 25.0 0.0 44.6 0.0 4.3 120 FTG 2T PE 0.0 BT8 25.0 0.0 40.7 0.0 0.020 TL 193.00 Pv 0.1 Pipe: 36 48.5 2.157 PL 2.00 PF 0.3 BT8 25.0 0.0 40.7 0.0 4.3 120 FTG T PE 0.9 BB8 23.0 0.0 41.3 0.0 0.020 TL 14.00 Pv 0.1 Pipe: 37 48.0 2.157 PL 2.00 PF 0.3 AB9 23.0 0.0 46.0 0.0 4.2 120 FTG T PE 0.9 AT9 25.0 0.0 44.8 0.0 0.020 TL 14.00 Pv 0.1 Pipe: 38 48.0 2.157 PL 169.00 PF 3.8 AT9 25.0 0.0 44.8 0.0 4.2 120 FTG 2T PE 0.0 BT9 25.0 0.0 41.0 0.0 0.020 TL 193.00 Pv 0.1 Pipe: 39 48.0 2.157 PL 2.00 PF 0.3 BT9 25.0 0.0 41.0 0.0 4.2 120 FTG T PE 0.9 BB9 23.0 0.0 41.6 0.0 0.020 TL 14.00 Pv 0.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 6 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF JOB TITLE: Lowers Sanford,Florida Esfr System 4 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 40 48.1 2.157 PL 2.00 PF 0.3 AB10 23.0 0.0 46.2 0.0 4.2 120 FTG T PE 0.9 AT10 25.0 0.0 45.0 0.0 0.020 TL 14.00 Pv 0.1 Pipe: 41 48.1 2.157 PL 169.00 PF 3.8 AT10 25.0 0.0 45.0 0.0 4.2 120 FTG 2T PE 0.0 BT10 25.0 0.0 41.2 0.0 0.020 TL 193.00 Pv 0.1 Pipe: 42 48.1 2.157 PL 2.00 PF 0.3 BT10 25.0 0.0 41.2 0.0 4.2 120 FTG T PE 0.9 BB10 23.0 0.0 41.8 0.0 0.020 TL 14.00 PV 0.1 Pipe: 43 48.6 2.157 PL 2.00 PF 0.3 AB11 23.0 0.0 46.4 0.0 4.3 120 FTG T PE 0.9 AT11 25.0 0.0 45.3 0.0 0.020 TL 14.00 Pv 0.1 Pipe: 44 48.6 2.157 PL 169.00 PF 3.9 AT11 25.0 0.0 45.3 0.0 4.3 120 FTG 2T PE 0.0 BT11 25.0 0.0 41.4 0.0 0.020 TL 193.00 Pv 0.1 Pipe: 45 48.6 2.157 PL 2.00 PF 0.3 BT11 25.0 0.0 41.4 0.0 4.3 120 FTG T PE 0.9 BB11 23.0 0.0 42.0 0.0 0.020 TL 14.00 PV 0.1 Pipe: 46 49.6 2.157 PL 2.00 PF 0.3 AB12 23.0 0.0 46.7 0.0 4.4 120 FTG T PE 0.9 AT12 25.0 0.0 45.6 0.0 0.021 TL 14.00 PV 0.1 Pipe: 47 49.6 2.157 PL 169.00 PF 4.0 AT12 25.0 0.0 45.6 0.0 4.4 120 FTG 2T PE 0.0 BT12 25.0 0.0 41.5 0.0 0.021 TL 193.00 Pv 0.1 Pipe: 48 49.6 2.157 PL 2.00 PF 0.3 BT12 25.0 0.0 41.5 0.0 4.4 120 FTG T PE 0.9 BB12 23.0 0.0 42.1 0.0 0.021 TL 14.00 PV 0.1 Pipe: 49 51.0 2.157 PL 2.00 PF 0.3 AB13 23.0 0.0 47.0 0.0 4.5 120 FTG T PE 0.9 AT13 25.0 0.0 45.9 0.0 0.022 TL 14.00 Pv 0.1 Pipe: 50 51.0 2.157 PL 169.00 PF 4.2 AT13 25.0 0.0 45.9 0.0 4.5 120 FTG 2T PE 0.0 BT13 25.0 0.0 41.6 0.0 0.022 TL 193.00 Pv 0.1 Pipe: 51 51.0 2.157 PL 2.00 PF 0.3 BT13 25.0 0.0 41.6 0.0 4.5 120 FTG T PE 0.9 BB13 23.0 0.0 42.2 0.0 0.022 TL 14.00 Pv 0.1 Pipe: 52 52.7 2.157 PL 2.00 PF 0.3 AB14 23.0 0.0 47.4 0.0 4.6 120 FTG T PE 0.9 AT14 25.0 0.0 46.2 0.0 0.023 TL 14.00 PV 0.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 7 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF JOB TITLE: Lowers Sanford,Florida Esfr System 4 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 53 52.7 2.157 PL 169.00 PF 4.5 AT14 25.0 0.0 46.2 0.0 4.6 120 FTG 2T PE 0.0 BT14 25.0 0.0 41.7 0.0 0.023 TL 193.00 Pv 0.1 Pipe: 54 52.7 2.157 PL 2.00 PF 0.3 BT14 25.0 0.0 41.7 0.0 4.6 120 FTG T PE 0.9 BB14 23.0 0.0 42.2 0.0 0.023 TL 14.00 PV 0.1 Pipe: 55 54.7 2.157 PL 2.00 PF 0.3 AB15 23.0 0.0 47.7 0.0 4.8 120 FTG T PE 0.9 AT15 25.0 0.0 46.5 0.0 0.025 TL 14.00 Pv 0.2 Pipe: 56 54.7 2.157 PL 169.00 PF 4.8 AT15 25.0 0.0 46.5 0.0 4.8 120 FTG 2T PE 0.0 BT15 25.0 0.0 41.7 0.0 0.025 TL 193.00 Pv 0.2 Pipe: 57 54.7 2.157 PL 2.00 PF 0.3 BT15 25.0 0.0 41.7 0.0 4.8 120 FTG T PE 0.9 BB15 23.0 0.0 42.2 0.0 0.025 TL 14.00 Pv 0.2 Pipe: 58 191.9 6.357 PL 9.00 PF 0.0 AB1 23.0 0.0 45.0 0.0 1.9 120 FTG PE 0.0 AB2 23.0 0.0 45.0 0.0 0.001 TL 9.00 PV 0.0 Pipe: 59 386.6 6.357 PL 9.00 PF 0.0 AB2 23.0 0.0 45.0 0.0 3.9 120 FTG PE 0.0 AB3 23.0 0.0 45.0 0.0 0.005 TL 9.00 PV 0.1 Pipe: 60 591.2 6.357 PL 9.00 PF 0.1 AB3 23.0 0.0 45.0 0.0 6.0 120 FTG PE 0.0 AB4 23.0 0.0 45.1 0.0 0.011 TL 9.00 Pv 0.2 Pipe: 61 647.3 6.357 PL 9.00 PF 0.1 AB4 23.0 0.0 45.1 0.0 6.5 120 FTG PE 0.0 AB5 23.0 0.0 45.2 0.0 0.013 TL 9.00 Pv 0.3 Pipe: 62 700.7 6.357 PL 10.17 PF 0.1 AB5 23.0 0.0 45.2 0.0 7.1 120 FTG PE 0.0 AB6 23.0 0.0 45.4 0.0 0.014 TL 10.17 Pv 0.3 Pipe: 63 751.9 6.357 PL 10.17 PF 0.2 AB6 23.0 0.0 45.4 0.0 7.6 120 FTG PE 0.0 AB7 23.0 0.0 45.6 0.0 0.017 TL 10.17 Pv 0.4 Pipe: 64 801.5 6.357 PL 10.17 PF 0.2 AB7 23.0 0.0 45.6 0.0 8.1 120 FTG PE 0.0 AB8 23.0 0.0 45.7 0.0 0.019 TL 10.17 Pv 0.4 Pipe: 65 849.9 6.357 PL 10.17 PF 0.2 AB8 23.0 0.0 45.7 0.0 8.6 120 FTG PE 0.0 AB9 23.0 0.0 46.0 0.0 0.021 TL 10.17 PV 0.5 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 8 DATE: 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 66 897.9 6.357 PL 10.17 PF 0.2 AB9 23.0 0.0 46.0 0.0 9.1 120 FTG PE 0.0 AB10 23.0 0.0 46.2 0.0 0.023 TL 10.17 Pv 0.6 Pipe: 67 946.0 6.357 PL 10.17 PF 0.3 AB10 23.0 0.0 46.2 0.0 9.6 120 FTG PE 0.0 AB11 23.0 0.0 46.4 0.0 0.025 TL 10.17 Pv 0.6 Pipe: 68 994.6 6.357 PL 10.17 PF 0.3 AB11 23.0 0.0 46.4 0.0 10.1 120 FTG PE 0.0 AB12 23.0 0.0 46.7 0.0 0.028 TL 10.17 Pv 0.7 Pipe: 69 1044.2 6.357 PL 10.17 PF 0.3 AB12 23.0 0.0 46.7 0.0 10.6 120 FTG PE 0.0 AB13 23.0 0.0 47.0 0.0 0.030 TL 10.17 Pv 0.7 Pipe: 70 1095.3 6.357 PL 10.17 PF 0.3 AB13 23.0 0.0 47.0 0.0 11.1 120 FTG PE 0.0 AB14 23.0 0.0 47.4 0.0 0.033 TL 10.17 PV 0.8 Pipe: 71 1148.0 6.357 PL 10.17 PF 0.4 AB14 23.0 0.0 47.4 0.0 11.6 120 FTG PE 0.0 AB15 23.0 0.0 47.7 0.0 0.036 TL 10.17 Pv 0.9 Pipe: 72 212.9 4.260 PL 9.00 PF 0.1 BB1 23.0 0.0 38.2 0.0 4.8 120 FTG PE 0.0 BB2 23.0 0.0 38.3 0.0 0.011 TL 9.00 Pv 0.2 Pipe: 73 412.9 4.260 PL 9.00 PF 0.3 BB2 23.0 0.0 38.3 0.0 9.3 120 FTG PE 0.0 BB3 23.0 0.0 38.6 0.0 0.038 TL 9.00 Pv 0.6 Pipe: 74 611.5 4.260 PL 9.00 PF 0.7 BB3 23.0 0.0 38.6 0.0 13.8 120 FTG PE 0.0 BB4 23.0 0.0 39.3 0.0 0.079 TL 9.00 Pv 1.3 Pipe: 75 555.4 4.260 PL 9.00 PF 0.6 BB4 23.0 0.0 39.3 0.0 12.5 120 FTG PE 0.0 BB5 23.0 0.0 39.9 0.0 0.066 TL 9.00 PV 1.1 Pipe: 76 501.9 4.260 PL 10.17 PF 0.6 BB5 23.0 0.0 39.9 0.0 11.3 120 FTG PE 0.0 BB6 23.0 0.0 40.5 0.0 0.055 TL 10.17 PV 0.9 Pipe: 77 450.8 4.260 PL 10.17 PF 0.5 BB6 23.0 0.0 40.5 0.0 10.1 120 FTG PE 0.0 BB7 23.0 0.0 41.0 0.0 0.045 TL 10.17 PV 0.7 Pipe: 78 401.2 4.260 PL 10.17 PF 0.4 BB7 23.0 0.0 41.0 0.0 9.0 120 FTG PE 0.0 BB8 23.0 0.0 41.3 0.0 0.036 TL 10.17 Pv 0.5 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 9 DATE: 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF..__ JOB TITLE: Lowers Sanford,Florida Esfr System 4 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 79 -352.8 4.260 PL 10.17 PF 0.3 BB8 23.0 0.0 41.3 0.0 7.9 120 FTG ---- PE 0.0 BB9 23.0 0.0 41.6 0.0 0.029 TL 10.17 PV 0.4 Pipe: 80 -304.8 4.260 PL 10.17 PF 0.2 BB9 23.0 0.0 41.6 0.0 6.9 120 FTG ---- PE 0.0 BB10 23.0 0.0 41.8 0.0 0.022 TL 10.17 PV 0.3 Pipe: 81 -256.7 4.260 PL 10.17 PF 0.2 BB10 23.0 0.0 41.8 0.0 5.8 120 FTG ---- PE 0.0 BB11 23.0 0.0 42.0 0.0 0.016 TL 10.17 PV 0.2 Pipe: 82 -208.1 4.260 PL 10.17 PF 0.1 BB11 23.0 0.0 42.0 0.0 4.7 120 FTG ---- PE 0.0 BB12 23.0 0.0 42.1 0.0 0.011 TL 10.17 PV 0.1 Pipe: 83 -158.4 4.260 PL 10.17 PF 0.1 BB12 23.0 0.0 42.1 0.0 3.6 120 FTG ---- PE 0.0 BB13 23.0 0.0 42.2 0.0 0.007 TL 10.17 PV 0.1 Pipe: 84 -107.4 4.260 PL 10.17 PF 0.0 BB13 23.0 0.0 42.2 0.0 2.4 120 FTG ---- PE 0.0 BB14 23.0 0.0 42.2 0.0 0.003 TL 10.17 Pv 0.0 Pipe: 85 -54.7 4.260 PL 10.17 PF 0.0 BB14 23.0 0.0 42.2 0.0 1.2 120 FTG ---- PE 0.0 BB15 23.0 0.0 42.2 0.0 0.001 TL 10.17 PV 0.0 Pipe: 86-1202.7 6.357 PL 215.00 PF 12.7 AB15 23.0 0.0 47.7 0.0 12.2 120 FTG 6E PE 0.0 TOR 23.0 0.0 60.4 0.0 0.039 TL 323.00 PV 1.0 Pipe: 87-1202.7 6.357 PL 21.00 PF 4.1 TOR 23.0 0.0 60.4 0.0 12.2 120 FTG TCG PE 9.1 BOR 2.0 H.S. 73.6 100.0 0.039 TL 103.00 PV 1.0 Pipe: 88-1302.7 8.249 PL 10.00 PF 1.1 BOR 2.0 H.S. 73.6 100.0 7.8 120 FTG ECG PE 0.9 PUMP 0.0 SRCE 75.5 (N/A) 0.013 TL 84.00 PV 0.4 NOTES: 1) Calculations were performed by the HASS 7.3 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 Lavista Road Tucker, GA 30084 2) The system has been calculated to provide an average imbalance at each node of 0.002 gpm and a maximum imbalance at any node of 0.178 gpm. SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 10 DATE`. 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 3) velocity pressures are printed for information only and are not used in balancing the system. Maximum water velocity is 18.7 ft/sec at pipe 7. 4) a. System remote area HAS been proven or 'peaked'. b. Minimum pressure at any sprinkler: 15.000 psi c. Minimum pressure with remote area shifted one sprinkler space toward left cross main: 15.019 psi d. Minimum pressure with remote area shifted one sprinkler space toward right cross main: 15.039 psi 5) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP PAGE: B MATERIAL: THNWL Diameter Equivalent in) E T L Ell Tee LngEll 2.157 6.00 12.00 4.00 4.260 13.00 26.00 8.00 6.357 18.00 38.00 11.00 8.249 20.00 39.00 15.00 HWC: 120 Fitting Lengths in Feet C B G A D N Chkvly Bfyvly Gately Almchk DPvly NPTee 14.00 7.00 1.00 12.00 12.00 12.00 29.00 16.00 3.00 26.00 13.00 26.00 40.00 13.00 4.00 35.00 24.00 38.00 50.00 13.00 4.00 39.00 30.00 39.00 SPRINKLER SYSTEM HYDRAULIC ANALYSIS I Page 11 DATE: 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4-A.SDF._,, JOB TITLE: Lowe's Sanford,Florida Esfr System 4 WATER SUPPLY ANALYSIS 180.0 150.0 G A U G120.0 E P R E S 90.0 S U R E P s i 1 1 30.0 10 static: 170.00 psi Resid: 116.00 psi Flow: 1875.0 gpm LEGEND 1 Available pressure 142.47 psi @ 1302.7 2q Required pressure 75.54 psi @ 1302.7 c 2 40(600 800 1000 1200 1400 1600 1800 2000 FLOW (GPM) t REED FIRE PROTECTION 5168 MOBILE SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX HYDRAULIC CALCULATIONS loP LOWES of Sanford Florida Sales Area zone #3 FILE NUMBER: ESFR3.SDF DATE: JUL 25, 2002 DESIGN DATA - OCCUPANCY CLASSIFICATION: DENSITY: AREA OF APPLICATION: COVERAGE PER SPRINKLER: NUMBER OF SPRINKLERS CALCULATED: TOTAL SPRINKLER WATER FLOW REQUIRED: TOTAL WATER REQUIRED (including hose): FLOW AND PRESSURE (@ BOR): SPRINKLER ORIFICE SIZE: NAME OF CONTRACTOR: M u MERCANTILE 15 PSI PER HEAD r 3 BRANCHLINES WITH 4 HEADS EACH 95 sq . ft . 12 sprinklers 1185.8 gpm 1285.7 gpm 1285.7 gpm @ 71.27 psi ESFR-25 DESIGN/LAYOUT BY: MEH AUTHORITY HAVING JURISDICTION: LOWERS CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION.NUMBER: Florida Permit No. 466077000199 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 AECEIyED SEP rjP,; SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 1 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDFi JOB TITLE: Lowe's Sanford,Florida Esfr System 3 . WATER SUPPLY DATA SOURCE STATIC RESID. FLOW NODE PRESS. PRESS. @ TAG PSI) PSI) (GPM) PUMP 170.0 116.0 1875.0 AGGREGATE FLOW ANALYSIS: AVAIL. TOTAL REQ'D PRESS. @ DEMAND PRESS. PSI) GPM) PSI) 143.1 1285.7 71.3 TOTAL FLOW AT SOURCE 1285.7 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 1185.7 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) Si 25.0 K=25.20 15.6 99.6 S2 25.0 K=25.20 15.0 97.6 S3 25.0 K=25.20 15.0 97.6 S4 25.0 K=25.20 15.7 99.9 S5 25.0 K=25.20 15.6 99.6 S6 25.0 K=25.20 15.0 97.7 S7 25.0 K=25.20 15.0 97.7 S8 25.0 K=25.20 15.7 100.0 S9 25.0 K=25.20 15.7 99.9 S10 25.0 K=25.20 15.1 98.0 Sil 25.0 K=25.20 15.1 98.0 S12 25.0 K=25.20 15.8 100.3 AT1 25.0 41.5 AT2 25.0 41.5 AT3 25.0 41.6 AT4 25.0 44.9 AT5 25.0 45.1 AT6 25.0 45.2 AT7 25.0 45.4 AT8 25.0 45.6 AT9 25.0 45.8 AT10 25.0 46.1 AT11 25.0 46.3 AT12 25.0 46.6 AT13 25.0 46.9 AT14 25.0 48.4 AB1 23.0 46.0 AB2 23.0 46.0 AB3 23.0 46.1 AB4 23.0 46.2 AB5 23.0 46.3 AB6 23.0 46.4 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 3 NODE ANALYSIS DATA (font.) NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) AB7 23.0 46.6 AB8 23.0 46.8 AB9 23.0 47.0 AB10 23.0 47.2 AB11 23.0 47.5 AB12 23.0 47.8 AB13 23.0 48.1 AB14 23.0 49.7 BT1 25.0 33.8 BT2 25.0 33.9 BT3 25.0 34.2 BT4 25.0 39.3 BT5 25.0 40.0 BT6 25.0 40.5 BT7 25.0 40.9 BT8 25.0 41.2 BT9 25.0 41.5 BT10 25.0 41.7 BT11 25.0 41.8 BT12 25.0 41.9 BT13 25.0 41.9 BT14 25.0 42.1 BB1 23.0 38.5 BB2 23.0 38.6 BB3 23.0 39.0 BB4 23.0 39.8 BB5 23.0 40.5 BB6 23.0 41.0 BB7 23.0 41.4 BB8 23.0 41.8 BB9 23.0 42.0 BB10 23.0 42.2 BB11 23.0 42.3 BB12 23.0 42.4 BB13 23.0 42.4 BB14 23.0 42.5 ABx 23.0 49.7 TOR 23.0 56.2 BOR 2.0 HOSE STREAM 69.2 100.0 PUMP 0.0 SOURCE 71.3 1285.7 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 3 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF- JOB TITLE: Lowe's Sanford,Florida Esfr system 3 PIPE DATA PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 1 193.5 2.157 PL 2.00 PF 3.6 AB1 23.0 0.0 46.0 0.0 17.0 120 FTG T PE 0.9 AT1 25.0 0.0 41.5 0.0 0.259 TL 14.00 PV 1.9 Pipe: 2 193.5 2.157 PL 88.00 PF 25.9 AT1 25.0 0.0 41.5 0.0 17.0 120 FTG T PE 0.0 S1 25.0 25.2 15.6 99.6 0.259 TL 100.00 PV 1.9 Pipe: 3 93.9 2.157 PL 9.00 PF 0.6 S1 25.0 25.2 15.6 99.6 8.2 120 FTG PE 0.0 S2 25.0 25.2 15.0 97.6 0.068 TL 9.00 Pv 0.5 Pipe: 4 3.7 2.157 PL 9.00 PF 0.0 S2 25.0 25.2 15.0 97.6 0.3 120 FTG PE 0.0 S3 25.0 25.2 15.0 97.6 0.000 TL 9.00 Pv 0.0 Pipe: 5 101.3 2.157 PL 9.00 PF 0.7 S3 25.0 25.2 15.0 97.6 8.9 120 FTG PE 0.0 S4 25.0 25.2 15.7 99.9 0.078 TL 9.00 Pv 0.5 Pipe: 6 201.1 2.157 PL 53.00 PF 18.1 S4 25.0 25.2 15.7 99.9 17.7 120 FTG T PE 0.0 BT1 25.0 0.0 33.8 0.0 0.278 TL 65.00 Pv 2.1 Pipe: 7 201.1 2.157 PL 2.00 PF 3.9 BT1 25.0 0.0 33.8 0.0 17.7 120 FTG T PE 0.9 BB1 23.0 0.0 38.5 0.0 0.278 TL 14.00 Pv 2.1 Pipe: 8 193.5 2.157 PL 2.00 PF 3.6 AB2 23.0 0.0 46.0 0.0 17.0 120 FTG T PE 0.9 AT2 25.0 0.0 41.5 0.0 0.259 TL 14.00 Pv 1.9 Pipe: 9 193.5 2.157 PL 88.00 PF 25.9 AT2 25.0 0.0 41.5 0.0 17.0 120 FTG T PE 0.0 S5 25.0 25.2 15.6 99.6 0.259 TL 100.00 PV 1.9 Pipe: 10 93.8 2.157 PL 9.00 PF 0.6 S5 25.0 25.2 15.6 99.6 8.2 120 FTG PE 0.0 S6 25.0 25.2 15.0 97.7 0.068 TL 9.00 Pv 0.5 Pipe: 11 3.8 2.157 PL 9.00 PF 0.0 S6 25.0 25.2 15.0 97.7 0.3 120 FTG PE 0.0 S7 25.0 25.2 15.0 97.7 0.000 TL 9.00 PV 0.0 Pipe: 12 101.5 2.157 PL 9.00 PF 0.7 S7 25.0 25.2 15.0 97.7 8.9 120 FTG PE 0.0 S8 25.0 25.2 15.7 100.0 0.079 TL 9.00 Pv 0.5 Pipe: 13 201.5 2.157 PL 53.00 PF 18.1 S8 25.0 25.2 15.7 100.0 17.7 120 FTG T PE 0.0 BT2 25.0 0.0 33.9 0.0 0.279 TL 65.00 Pv 2.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF 30B TITLE: Lowe's Sanford,Florida Esfr System 3 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 14 201.5 2.157 PL 2.00 PF 3.9 BT2 25.0 0.0 33.9 0.0 17.7 120 FTG T PE 0.9 BB2 23.0 0.0 38.6 0.0 0.279 TL 14.00 Pv 2.1 Pipe: 15 193.4 2.157 PL 2.00 PF 3.6 AB3 23.0 0.0 46.1 0.0 17.0 120 FTG T PE 0.9 AT3 25.0 0.0 41.6 0.0 0.259 TL 14.00 Pv 1.9 Pipe: 16 193.4 2.157 PL 88.00 PF 25.9 AT3 25.0 0.0 41.6 0.0 17.0 120 FTG. T PE 0.0 S9 25.0 25.2 15.7 99.9 0.259 TL 100.00 PV 1.9 Pipe: 17 93.4 2.157 PL 9.00 PF 0.6 S9 25.0 25.2 15.7 99.9 8.2 120 FTG PE 0.0 S10 25.0 25.2 15.1 98.0 0.067 TL 9.00 Pv 0.5 Pipe: 18 4.5 2.157 PL 9.00 PF 0.0 S10 25.0 25.2 15.1 98.0 0.4 120 FTG PE 0.0 S11 25.0 25.2 15.1 98.0 0.000 TL 9.00 PV 0.0 Pipe: 19 102.5 2.157 PL 9.00 PF 0.7 Sil 25.0 25.2 15.1 98.0 9.0 120 FTG PE 0.0 S12 25.0 25.2 15.8 100.3 0.080 TL 9.00 Pv 0.5 Pipe: 20 202.8 2.157 PL 53.00 PF 18.4 S12 25.0 25.2 15.8 100.3 17.8 120 FTG T PE 0.0 BT3 25.0 0.0 34.2 0.0 0.282 TL 65.00 Pv 2.1 Pipe: 21 202.8 2.157 PL 2.00 PF 4.0 BT3 25.0 0.0 34.2 0.0 17.8 120 FTG T PE 0.9 BB3 23.0 0.0 39.0 0.0 0.282 TL 14.00 Pv 2.1 Pipe: 22 59.2 2.157 PL 2.00 PF 0.4 AB4 23.0 0.0 46.2 0.0 5.2 120 FTG T PE 0.9 AT4 25.0 0.0 44.9 0.0 0.029 TL 14.00 PV 0.2 Pipe: 23 59.2 2.157 PL 168.00 PF 5.6 AT4 25.0 0.0 44.9 0.0 5.2 120 FTG 2T PE 0.0 BT4 25.0 0.0 39.3 0.0 0.029 TL 192.00 Pv 0.2 Pipe: 24 59.2 2.157 PL 2.00 PF 0.4 BT4 25.0 0.0 39.3 0.0 5.2 120 FTG T PE 0.9 BB4 23.0 0.0 39.8 0.0 0.029 TL 14.00 Pv 0.2 Pipe: 25 56.5 2.157 PL 2.00 PF 0.4 A05 23.0 0.0 46.3 0.0 5.0 120 FTG T PE 0.9 AT5 25.0 0.0 45.1 0.0 0.027 TL 14.00 Pv 0.2 Pipe: 26 56.5 2.157 PL 168.00 PF 5.1 AT5 25.0 0.0 45.1 0.0 5.0 120 FTG 2T PE 0.0 BT5 25.0 0.0 40.0 0.0 0.027 TL 192.00 Pv 0.2 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 5 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF. JOB TITLE: Lowe's Sanford,Florida Esfr System 3 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 27 56.5 2.157 PL 2.00 PF 0.4 BT5 25.0 0.0 40.0 0.0 5.0 120 FTG T PE 0.9 BB5 23.0 0.0 40.5 0.0 0.027 TL 14.00 PV 0.2 Pipe: 28 54.4 2.157 PL 2.00 PF 0.3 AB6 23.0 0.0 46.4 0.0 4.8 120 FTG T PE 0.9 AT6 25.0 0.0 45.2 0.0 0.025 TL 14.00 Pv 0.2 Pipe: 29 54.4 2.157 PL 168.00 PF 4.8 AT6 25.0 0.0 45.2 0.0 4.8 120 FTG 2T PE 0.0 BT6 25.0 0.0 40.5 0.0 0.025 TL 192.00 Pv 0.2 Pipe: 30 54.4 2.157 PL 2.00 PF 0.3 BT6 25.0 0.0 40.5 0.0 4.8 120 FTG T PE 0.9 BB6 23.0 0.0 41.0 0.0 0.025 TL 14.00 PV 0.2 Pipe: 31 53.0 2.157 PL 2.00 PF 0.3 AB7 23.0 0.0 46.6 0.0 4.7 120 FTG T PE 0.9 AT7 25.0 0.0 45.4 0.0 0.024 TL 14.00 PV 0.1 Pipe: 32 53.0 2.157 PL 168.00 PF 4.5 AT7 25.0 0.0 45.4 0.0 4.7 120 FTG 2T PE 0.0 BT7 25.0 0.0 40.9 0.0 0.024 TL 192.00 Pv 0.1 Pipe: 33 53.0 2.157 PL 2.00 PF 0.3 BT7 25.0 0.0 40.9 0.0 4.7 120 FTG T PE 0.9 BB7 23.0 0.0 41.4 0.0 0.024 TL 14.00 PV 0.1 Pipe: 34 52.2 2.157 PL 2.00 PF 0.3 AB8 23.0 0.0 46.8 0.0 4.6 120 FTG T PE 0.9 AT8 25.0 0.0 45.6 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 35 52.2 2.157 PL 168.00 PF 4.4 AT8 25.0 0.0 45.6 0.0 4.6 120 FTG 2T PE 0.0 BT8 25.0 0.0 41.2 0.0 0.023 TL 192.00 Pv 0.1 Pipe: 36 52.2 2.157 PL 2.00 PF 0.3 BT8 25.0 0.0 41.2 0.0 4.6 120 FTG T PE 0.9 BB8 23.0 0.0 41.8 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 37 51.9 2.157 PL 2.00 PF 0.3 AB9 23.0 0.0 47.0 0.0 4.6 120 FTG T PE 0.9 AT9 25:0 0.0 45.8 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 38 51.9 2.157 PL 168.00 PF 4.4 AT9 25.0 0.0 45.8 0.0 4.6 120 FTG 2T PE 0.0 BT9 25.0 0.0 41.5 0.0 0.023 TL 192.00 Pv 0.1 Pipe: 39 51.9 2.157 PL 2.00 PF 0.3 BT9 25.0 0.0 41.5 0.0 4.6 120 FTG T PE 0.9 BB9 23.0 0.0 42.0 0.0 0.023 TL 14.00 Pv 0.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 6 i"DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF jOB TITLE: Lowe's Sanford,Florida Esfr System 3 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 40 52.2 2.157 PL 2.00 PF 0.3 AB10 23.0 0.0 47.2 0.0 4.6 120 FTG T PE 0.9 AT10 25.0 0.0 46.1 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 41 52.2 2.157 PL 168.00 PF 4.4 AT10 25.0 0.0 46.1 0.0 4.6 120 FTG 2T PE 0.0 BT10 25.0 0.0 41.7 0.0 0.023 TL 192.00 Pv 0.1 Pipe: 42 52.2 2.157 PL 2.00 PF 0.3 BT10 25.0 0.0 41.7 0.0 4.6 120 FTG T PE 0.9 BB10 23.0 0.0 42.2 0.0 0.023 TL 14.00 Pv 0.1 Pipe: 43 52.9 2.157 PL 2.00 PF 0.3 AB11 23.0 0.0 47.5 0.0 4.6 120 FTG T PE 0.9 AT11 25.0 0.0 46.3 0.0 0.024 TL 14.00 PV 0.1 Pipe: 44 52.9 2.157 PL 168.00 PF 4.5 AT11 25.0 0.0 46.3 0.0 4.6 120 FTG 2T PE 0.0 BT11 25.0 0.0 41.8 0.0 0.024 TL 192.00 Pv 0.1 Pipe: 45 52.9 2.157 PL 2.00 PF 0.3 BT11 25.0 0.0 41.8 0.0 4.6 120 FTG T PE 0.9 BB11 23.0 0.0 42.3 0.0 0.024 TL 14.00 PV 0.1 Pipe: 46 54.1 2.157 PL 2.00 PF 0.3 AB12 23.0 0.0 47.8 0.0 4.8 120 FTG T PE 0.9 AT12 25.0 0.0 46.6 0.0 0.025 TL 14.00 Pv 0.2 Pipe: 47 54.1 2.157 PL 168.00 PF 4.7 AT12 25.0 0.0 46.6 0.0 4.8 120 FTG 2T PE 0.0 BT12 25.0 0.0 41.9 0.0 0.025 TL 192.00 Pv 0.2 Pipe: 48 54.1 2.157 PL 2.00 PF 0.3 BT12 25.0 0.0 41.9 0.0 4.8 120 FTG T PE 0.9 BB12 23.0 0.0 42.4 0.0 0.025 TL 14.00 PV 0.2 Pipe: 49 55.6 2.157 PL 2.00 PF 0.4 AB13 23.0 0.0 48.1 0.0 4.9 120 FTG T PE 0.9 AT13 25.0 0.0 46.9 0.0 0.026 TL 14.00 Pv 0.2 Pipe: 50 55.6 2.157 PL 168.00 PF 5.0 AT13 25.0 0.0 46.9 0.0 4.9 120 FTG 2T PE 0.0 BT13 25.0 0.0 41.9 0.0 0.026 TL 192.00 Pv 0.2 Pipe: 51 55.6 2.157 PL 2.00 PF 0.4 BT13 25.0 0.0 41.9 0.0 4.9 120 FTG T PE 0.9 BB13 23.0 0.0 42.4 0.0 0.026 TL 14.00 Pv 0.2 Pipe: 52 63.5 2.157 PL 2.00 PF 0.5 AB14 23.0 0.0 49.7 0.0 5.6 120 FTG T PE 0.9 AT14 25.0 0.0 48.4 0.0 0.033 TL 14.00 PV 0.2 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 7 DATE: 7/25/2002 C:\HASSCAA\2505 LOWES SANFORD FL\ESFR3.SDF JOB TITLE: Lowers Sanford,Florida Esfr System 3 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 53 63.5 2.157 PL 168.00 PF 6.3 AT14 25.0 0.0 48.4 0.0 5.6 120 FTG 2T PE 0.0 BT14 25.0 0.0 42.1 0.0 0.033 TL 192.00 Pv 0.2 Pipe: 54 63.5 2.157 PL 2.00 PF 0.5 BT14 25.0 0.0 42.1 0.0 5.6 120 FTG T PE 0.9 BB14 23.0 0.0 42.5 0.0 0.033 TL 14.00 PV 0.2 Pipe: 55 193.5 6.357 PL 10.17 PF 0.0 AB1 23.0 0.0 46.0 0.0 2.0 120 FTG PE 0.0 AB2 23.0 0.0 46.0 0.0 0.001 TL 10.17 Pv 0.0 Pipe: 56 387.0 6.357 PL 10.17 PF 0.0 AB2 23.0 0.0 46.0 0.0 3.9 120 FTG PE 0.0 AB3 23.0 0.0 46.1 0.0 0.005 TL 10.17 Pv 0.1 Pipe: 57 580.4 6.357 PL 10.17 PF 0.1 AB3 23.0 0.0 46.1 0.0 5.9 120 FTG PE 0.0 AB4 23.0 0.0 46.2 0.0 0.010 TL 10.17 Pv 0.2 Pipe: 58 639.5 6.357 PL 10.17 PF 0.1 AB4 23.0 0.0 46.2 0.0 6.5 120 FTG PE 0.0 AB5 23.0 0.0 46.3 0.0 0.012 TL 10.17 Pv 0.3 Pipe: 59 696.0 6.357 PL 10.17 PF 0.1 AB5 23.0 0.0 46.3 0.0 7.0 120 FTG PE 0.0 AB6 23.0 0.0 46.4 0.0 0.014 TL 10.17 Pv 0.3 Pipe: 60 750.4 6.357 PL 10.17 PF 0.2 AB6 23.0 0.0 46.4 0.0 7.6 120 FTG PE 0.0 AB7 23.0 0.0 46.6 0.0 0.016 TL 10.17 Pv 0.4 Pipe: 61 803.4 6.357 PL 10.17 PF 0.2 AB7 23.0 0.0 46.6 0.0 8.1 120 FTG PE 0.0 AB8 23.0 0.0 46.8 0.0 0.019 TL 10.17 Pv 0.4 Pipe: 62 855.5 6.357 PL 10.17 PF 0.2 AB8 23.0 0.0 46.8 0.0 8.6 120 FTG PE 0.0 AB9 23.0 0.0 47.0 0.0 0.021 TL 10.17 Pv 0.5 Pipe: 63 907.4 6.357 PL 10.17 PF 0.2 AB9 23.0 0.0 47.0 0.0 9.2 120 FTG PE 0.0 AB10 23.0 0.0 47.2 0.0 0.023 TL 10.17 Pv 0.6 Pipe: 64 959.6 6.357 PL 10.17 PF 0.3 AB10 23.0 0.0 47.2 0.0 9.7 120 FTG PE 0.0 AB11 23.0 0.0 47.5 0.0 0.026 TL 10.17 Pv 0.6 Pipe: 65 1012.6 6.357 PL 10.17 PF 0.3 AB11 23.0 0.0 47.5 0.0 10.2 120 FTG PE 0.0 AB12 23.0 0.0 47.8 0.0 0.029 TL 10.17 Pv 0.7 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 8 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 3 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 66 1066.7 6.357 PL 10.17 PF 0.3 AB12 23.0 0.0 47.8 0.0 10.8 120 FTG PE 0.0 AB13 23.0 0.0 48.1 0.0 0.032 TL 10.17 Pv 0.8 Pipe: 67 1122.3 6.357 PL 7.75 PF 1.6 AB13 23.0 0.0 48.1 0.0 11.3 120 FTG T PE 0.0 ABx 23.0 0.0 49.7 0.0 0.035 TL 45.75 Pv 0.9 Pipe: 68 63.5 6.357 PL 2.42 PF 0.0 ABx 23.0 0.0 49.7 0.0 0.6 120 FTG PE 0.0 AB14 23.0 0.0 49.7 0.0 0.000 TL 2.42 PV 0.0 Pipe: 69 201.1 4.260 PL 10.17 PF 0.1 BB1 23.0 0.0 38.5 0.0 4.5 120 FTG PE 0.0 BB2 23.0 0.0 38.6 0.0 0.010 TL 10.17 Pv 0.1 Pipe: 70 402.6 4.260 PL 10.17 PF 0.4 BB2 23.0 0.0 38.6 0.0 9.1 120 FTG PE 0.0 BB3 23.0 0.0 39.0 0.0 0.037 TL 10.17 Pv 0.6 Pipe: 71 605.4 4.260 PL 10.17 PF 0.8 B03 23.0 0.0 39.0 0.0 13.6 120 FTG PE 0.0 BB4 23.0 0.0 39.8 0.0 0.078 TL 10.17 Pv 1.2 Pipe: 72 546.2 4.260 PL 10.17 PF 0.7 BB4 23.0 0.0 39.8 0.0 12.3 120 FTG PE 0.0 BB5 23.0 0.0 40.5 0.0 0.064 TL 10.17 Pv 1.0 Pipe: 73 489.8 4.260 PL 10.17 PF 0.5 BB5 23.0 0.0 40.5 0.0 11.0 120 FTG PE 0.0 BB6 23.0 0.0 41.0 0.0 0.052 TL 10.17 Pv 0.8 Pipe: 74 435.4 4.260 PL 10.17 PF 0.4 BB6 23.0 0.0 41.0 0.0 9.8 120 FTG PE 0.0 BB7 23.0 0.0 41.4 0.0 0.042 TL 10.17 Pv 0.6 Pipe: 75 382.4 4.260 PL 10.17 PF 0.3 BB7 23.0 0.0 41.4 0.0 8.6 120 FTG PE 0.0 BB8 23.0 0.0 41.8 0.0 0.033 TL 10.17 Pv 0.5 Pipe: 76 330.2 4.260 PL 10.17 PF 0.3 BBB 23.0 0.0 41.8 0.0 7.4 120 FTG PE 0.0 BB9 23.0 0.0 42.0 0.0 0.025 TL 10.17 Pv 0.4 Pipe: 77 278.3 4.260 PL 10.17 PF 0.2 BB9 23.0 0.0 42.0 0.0 6.3 120 FTG PE 0.0 BB10 23.0 0.0 42.2 0.0 0.018 TL 10.17 Pv 0.3 Pipe: 78 226.1 4.260 PL 10.17 PF 0.1 BB10 23.0 0.0 42.2 0.0 5.1 120 FTG PE 0.0 BB11 23.0 0.0 42.3 0.0 0.013 TL 10.17 Pv 0.2 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Rage 9 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 3 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 79 173.2 4.260 PL 10.17 PF 0.1 BB11 23.0 0.0 42.3 0.0 3.9 120 FTG PE 0.0 BB12 23.0 0.0 42.4 0.0 0.008 TL 10.17 Pv 0.1 Pipe: 80 119.1 4.260 PL 10.17 PF 0.0 BB12 23.0 0.0 42.4 0.0 2.7 120 FTG PE 0.0 BB13 23.0 0.0 42.4 0.0 0.004 TL 10.17 Pv 0.0 Pipe: 81 63.5 4.260 PL 10.17 PF 0.0 BB13 23.0 0.0 42.4 0.0 1.4 120 FTG PE 0.0 BB14 23.0 0.0 42.5 0.0 0.001 TL 10.17 Pv 0.0 Pipe: 82 1185.8 6.357 PL 77.00 PF 6.5 ABx 23.0 0.0 49.7 0.0 12.0 120 FTG 3ET PE 0.0 TOR 23.0 0.0 56.2 0.0 0.038 TL 169.00 PV 1.0 Pipe: 83 1185.8 6.357 PL 21.00 PF 3.9 TOR 23.0 0.0 56.2 0.0 12.0 120 FTG TCG PE 9.1 BOR 2.0 H.S. 69.2 100.0 0.038 TL 103.00 PV 1.0 Pipe: 84 1285.7 8.249 PL 20.00 PF 1.2 BOR 2.0 H.S. 69.2 100.0 7.7 120 FTG ECG PE 0.9 PUMP 0.0 SRCE 71.3 N/A) 0.013 TL 94.00 Pv 0.4 NOTES: 1) Calculations were performed by the HASS 7.3 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 Lavista Road Tucker, GA 30084 2) The system has been calculated to provide an average imbalance at each node of 0.002 gpm and a maximum imbalance at any node of 0.140 gpm. 3) velocity pressures are printed for information only and are not used in balancing the system. Maximum water velocity is 17.8 ft/sec at pipe 21. 4) a. system remote area HAS been proven or 'peaked'. b. Minimum pressure at any sprinkler: 15.000 psi c. Minimum pressure with remote area shifted one sprinkler space toward left cross main: 15.062 psi d. Minimum pressure with remote area shifted one sprinkler space toward right cross main: 15.004 psi SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 10 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF JOB TITLE: Lowe's Sanford,Florida Esfr system 3 5) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP PAGE: B MATERIAL: THNWL HWC: 120 Diameter Equivalent Fitting Lengths in Feet in) E T L C B G A Ell Tee LngEll ChkvlV BfyVly GatVly A1mChk 2.157 6.00 12.00 4.00 14.00 7.00 1.00 12.00 4.260 13.00 26.00 8.00 29.00 16.00 3.00 26.00 6.357 18.00 38.00 11.00 40.00 13.00 4.00 35.00 8.249 20.00 39.00 15.00 50.00 13.00 4.00 39.00 D N DPVIV NPTee 12.00 12.00 13.00 26.00 24.00 38.00 30.00 39.00 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 11 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR3.SDF'•• JOB TITLE: Lowe's Sanford,Florida Esfr system 3 & . . WATER SUPPLY ANALYSIS 180.0 150.0 G U G120.0 E P R E S 90.0 S U R E Am,; p s i 30.0 OX01 Static: 170.00 psi Resid: 116.00 psi Flow: 1875.0 gpm LEGEND 1 Available pressure 143.13 psi @ 1285.7 2 Required pressure 71.27 psi @ 1285.7 c 40(600 800 1000 1200 1400 1600 1800 2000 FLOW (GPM) REED FIRE PROTECTION 5168 MOBILE SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX HYDRAULIC CALCULATIONS FOR LOWES of Sanford FLorida Sales Area zone #2 FILE NUMBER: ESFR2.SDF DATE: JUL 25, 2002 DESIGN DATA - OCCUPANCY CLASSIFICATION: DENSITY: AREA OF APPLICATION: COVERAGE PER SPRINKLER: NUMBER OF SPRINKLERS CALCULATED: TOTAL SPRINKLER WATER FLOW REQUIRED: TOTAL WATER REQUIRED (including hose): FLOW AND PRESSURE (@ BOR): SPRINKLER ORIFICE SIZE: NAME OF CONTRACTOR: 09 jv MERCANTILE 15+-PSI PER HEAD 3 BRANCHLINES WITH 4 HEADS EACH 95 sq. ft. 12 sprinklers 1185.4 gpm 1285.4 gpm 1285.4 gpm @ 92.02 psi ESFR-25 DESIGN/LAYOUT BY: MEH AUTHORITY HAVING JURISDICTION: LOWE'S CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION NUMBER: Florida Permit No. 466077000199 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ) CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ) RECE VE SEP 2 0 1002 SPRINKLER SYSTEM HYDRAULIC ANALYSIS .Page 1 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SISF JOB TITLE: Lowe's Sanford,Flordia Esfr System 2 WATER SUPPLY DATA SOURCE STATIC RESID. FLOW AVAIL. TOTAL REQ'D NODE PRESS. PRESS. @ PRESS. @ DEMAND PRESS. TAG PSI) PSI) (GPM) PSI) GPM) PSI) PUMP 170.0 116.0 1875.0 143.1 1285.4 92.0 AGGREGATE FLOW ANALYSIS: TOTAL FLOW AT SOURCE 1285.4 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 1185.4 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) Si 25.0 K=25.20 15.7 99.7 S2 25.0 K=25.20 15.0 97.6 S3 25.0 K=25.20 15.0 97.6 S4 25.0 K=25.20 15.7 99.7 S5 25.0 K=25.20 15.7 99.8 S6 25.0 K=25.20 15.0 97.7 S7 25.0 K=25.20 15.0 97.7 S8 25.0 K=25.20 15.7 99.8 S9 25.0 K=25.20 15.7 100.0 S10 25.0 K=25.20 15.1 97.9 S11 25.0 K=25.20 15.1 97.9 S12 25.0 K=25.20 15.8 100.1 AT1 25.0 53.4 AT2 25.0 53.4 AT3 25.0 53.5 AT4 25.0 56.7 AT5 25.0 56.9 AT6 25.0 57.0 AT7 25.0 57.2 AT8 25.0 57.5 AT9 25.0 57.7 AT10 25.0 58.0 AT11 25.0 58.3 AB1 23.0 58.0 AB2 23.0 58.1 AB3 23.0 58.1 AB4 23.0 58.2 AB5 23.0 58.3 AB6 23`0:. 58.5 AB7 23.0 58.7 AB8 23.0 58.9 A69 23.0 59.2 I. SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SDF JOB TITLE: Lowers Sanford,Flordia Esfr System 2 NODE ANALYSIS DATA (cont.) NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) AB10 23.0 59.5 AB11 23.0 59.8 BT1 25.0 39.3 BT2 25.0 39.4 BT3 25.0 39.7 BT4 25.0 45.0 BT5 25.0 45.5 BT6 25.0 46.0 BT7 25.0 46.3 BT8 25.0 46.5 BT9 25.0 46.6 BT10 25.0 46.7 BT11 25.0 46.7 BB1 23.0 44.0 BB2 23.0 44.1 BB3 23.0 44.4 BB4 23.0 45.2 BB5 23.0 45.8 BB6 23.0 46.2 BB7 23.0 46.5 BB8 23.0 46.7 BB9 23.0 46.9 BB10 23.0 46.9 BB11 23.0 46.9 TOR 23.0 76.9 BOR 2.0 HOSE STREAM 90.0 100.0 PUMP 0.0 SOURCE 92.0 1285.4 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 3 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SCIF, JOB TITLE: Lowe's Sanford,Flordia Esfr System 2 PIPE DATA PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 1 197.1 2.157 PL 2.00 PF 3.7 AB1 23.0 0.0 58.0 0.0 17.3 120 FTG T PE 0.9 AT1 25.0 0.0 53.4 0.0 0.268 TL 14.00 Pv 2.0 Pipe: 2 197.1 2.157 PL 129.00 PF 37.8 AT1 25.0 0.0 53.4 0.0 17.3 120 FTG T PE 0.0 S1 25.0 25.2 15.7 99.7 0.268 TL 141.00 Pv 2.0 Pipe: 3 97.4 2.157 PL 9.00 PF 0.7 S1 25.0 25.2 15.7 99.7 8.6 120 FTG PE 0.0 S2 25.0 25.2 15.0 97.6 0.073 TL 9.00 Pv 0.5 Pipe: 4 0.2 2.157 PL 9.00 PF 0.0 S2 25.0 25.2 15.0 97.6 0.0 120 FTG PE 0.0 S3 25.0 25.2 15.0 97.6 0.000 TL 9.00 Pv 0.0 Pipe: 5 97.8 2.157 PL 9.00 PF 0.7 S3 25.0 25.2 15.0 97.6 8.6 120 FTG PE 0.0 S4 25.0 25.2 15.7 99.7 0.073 TL 9.00 Pv 0.5 Pipe: 6 197.5 2.157 PL 76.00 PF 23.7 S4 25.0 25.2 15.7 99.7 17.3 120 FTG T PE 0.0 BT1 25.0 0.0 39.3 0.0 0.269 TL 88.00 PV 2.0 Pipe: 7 197.5 2.157 PL 2.00 PF 3.8 BT1 25.0 0.0 39.3 0.0 17.3 120 FTG T PE 0.9 BB1 23.0 0.0 44.0 0.0 0.269 TL 14.00 Pv 2.0 Pipe: 8 197.1 2.157 PL 2.00 PF 3.7 AB2 23.0 0.0 58.1 0.0 17.3 120 FTG T PE 0.9 AT2 25.0 0.0 53.4 0.0 0.268 TL 14.00 Pv 2.0 Pipe: 9 197.1 2.157 PL 129.00 PF 37.8 AT2 25.0 0.0 53.4 0.0 17.3 120 FTG T PE 0.0 S5 25.0 25.2 15.7 99.8 0.268 TL 141.00 Pv 2.0 Pipe: 10 97.3 2.157 PL 9.00 PF 0.7 S5 25.0 25.2 15.7 99.8 8.5 120 FTG PE 0.0 S6 25.0 25.2 15.0 97.7 0.073 TL 9.00 Pv 0.5 Pipe: 11 0.4 2.157 PL 9.00 PF 0.0 S6 25.0 25.2 15.0 97.7 0.0 120 FTG PE 0.0 S7 25.0 25.2 15.0 97.7 0.000 TL 9.00 Pv 0.0 Pipe: 12 98.0 2.157 PL 9.00 PF 0.7 S7 25.0 25.2 15.0 97.7 8.6 120 FTG PE 0.0 58 25.0 25.2 15.7 99.8 0.074 TL 9.00 Pv 0.5 Pipe: 13 197.8 2.157 PL 76.00 PF 23.7 S8 25.0 25.2 15.7 99.8 17.4 120 FTG T PE 0.0 BT2 25.0 0.0 39.4 0.0 0.270 TL 88.00 Pv 2.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SDF JOB TITLE: Lowers Sanford,Flordia Esfr System 2 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 14 197.8 2.157 PL 2.00 PF 3.8 BT2 25.0 0.0 39.4 0.0 17.4 120 FTG T PE 0.9 BB2 23.0 0.0 44.1 0.0 0.270 TL 14.00 Pv 2.0 Pipe: 15 197.0 2.157 PL 2.00 PF 3.7 AB3 23.0 0.0 58.1 0.0 17.3 120 FTG T PE 0.9 AT3 25.0 0.0 53.5 0.0 0.268 TL 14.00 Pv 2.0 Pipe: 16 197.0 2.157 PL 129.00 PF 37.7 AT3 25.0 0.0 53.5 0.0 17.3 120 FTG T PE 0.0 S9 25.0 25.2 15.7 100.0 0.268 TL 141.00 Pv 2.0 Pipe: 17 97.0 2.157 PL 9.00 PF 0.6 S9 25.0 25.2 15.7 100.0 8.5 120 FTG PE 0.0 S10 25.0 25.2 15.1 97.9 0.072 TL 9.00 Pv 0.5 Pipe: 18 0.9 2.157 PL 9.00 PF 0.0 S10 25.0 25.2 15.1 97.9 0.1 120 FTG PE 0.0 Sil 25.0 25.2 15.1 97.9 0.000 TL 9.00 PV 0.0 Pipe: 19 98.8 2.157 PL 9.00 PF 0.7 Sil 25.0 25.2 15.1 97.9 8.7 120 FTG PE 0.0 S12 25.0 25.2 15.8 100.1 0.075 TL 9.00 Pv 0.5 Pipe: 20 198.9 2.157 PL 76.00 PF 24.0 S12 25.0 25.2 15.8 100.1 17.5 120 FTG T PE 0.0 BT3 25.0 0.0 39.7 0.0 0.272 TL 88.00 Pv 2.1 Pipe: 21 198.9 2.157 PL 2.00 PF 3.8 BT3 25.0 0.0 39.7 0.0 17.5 120 FTG T PE 0.9 BB3 23.0 0.0 44.4 0.0 0.272 TL 14.00 Pv 2.1 Pipe: 22 76.0 2.157 PL 2.00 PF 0.6 AB4 23.0 0.0 58.2 0.0 6.7 120 FTG T PE 0.9 AT4 25.0 0.0 56.7 0.0 0.046 TL 14.00 Pv 0.3 Pipe: 23 76.0 2.157 PL 232.00 PF 11.7 AT4 25.0 0.0 56.7 0.0 6.7 120 FTG 2T PE 0.0 BT4 25.0 0.0 45.0 0.0 0.046 TL 256.00 Pv 0.3 Pipe: 24 76.0 2.157 PL 2.00 PF 0.6 BT4 25.0 0.0 45.0 0.0 6.7 120 FTG T PE 0.9 BB4 23.0 0.0 45.2 0.0 0.046 TL 14.00 Pv 0.3 Pipe: 25 74.5 2.157 PL 2.00 PF 0.6 A135 23.0 0.0 58.3 0.0 6.5 120 FTG T PE 0.9 AT5 25.0 0.0 56.9 0.0 0.044 TL 14.00 Pv 0.3 Pipe: 26 74.5 2.157 PL 232.00 PF 11.3 AT5 25.0 0.0 56.9 0.0 6.5 120 FTG 2T PE 0.0 BT5 25.0 0.0 45.5 0.0 0.044 TL 256.00 Pv 0.3 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 5 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SDF, JOB TITLE: Lowe's Sanford,Flordia Esfr System 2 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 27 74.5 2.157 PL 2.00 PF 0.6 BT5 25.0 0.0 45.5 0.0 6.5 120 FTG T PE 0.9 BB5 23.0 0.0 45.8 0.0 0.044 TL 14.00 Pv 0.3 Pipe: 28 73.6 2.157 PL 2.00 PF 0.6 AB6 23.0 0.0 58.5 0.0 6.5 120 FTG T PE 0.9 AT6 25.0 0.0 57.0 0.0 0.043 TL 14.00 PV 0.3 Pipe: 29 73.6 2.157 PL 232.00 PF 11.1 AT6 25.0 0.0 57.0 0.0 6.5 120 FTG 2T PE 0.0 BT6 25.0 0.0 46.0 0.0 0.043 TL 256.00 Pv 0.3 Pipe: 30 73.6 2.157 PL 2.00 PF 0.6 BT6 25.0 0.0 46.0 0.0 6.5 120 FTG T PE 0.9 BB6 23.0 0.0 46.2 0.0 0.043 TL 14.00 PV 0.3 Pipe: 31 73.2 2.157 PL 2.00 PF 0.6 AB7 23.0 0.0 58.7 0.0 6.4 120 FTG T PE 0.9 AT7 25.0 0.0 57.2 0.0 0.043 TL 14.00 Pv 0.3 Pipe: 32 73.2 2.157 PL 232.00 PF 11.0 AT7 25.0 0.0 57.2 0.0 6.4 120 FTG 2T PE 0.0 BT7 25.0 0.0 46.3 0.0 0.043 TL 256.00 Pv 0.3 Pipe: 33 73.2 2.157 PL 2.00 PF 0.6 BT7 25.0 0.0 46.3 0.0 6.4 120 FTG T PE 0.9 BB7 23.0 0.0 46.5 0.0 0.043 TL 14.00 Pv 0.3 Pipe: 34 73.3 2.157 PL 2.00 PF 0.6 AB8 23.0 0.0 58.9 0.0 6.4 120 FTG T PE 0.9 AT8 25.0 0.0 57.5 0.0 0.043 TL 14.00 Pv 0.3 Pipe: 35 73.3 2.157 PL 232.00 PF 11.0 AT8 25.0 0.0 57.5 0.0 6.4 120 FTG 2T PE 0.0 BT8 25.0 0.0 46.5 0.0 0.043 TL 256.00 Pv 0.3 Pipe: 36 73.3 2.157 PL 2.00 PF 0.6 BT8 25.0 0.0 46.5 0.0 6.4 120 FTG T PE 0.9 BB8 23.0 0.0 46.7 0.0 0.043 TL 14.00 Pv 0.3 Pipe: 37 73.7 2.157 PL 2.00 PF 0.6 AB9 23.0 0.0 59.2 0.0 6.5 120 FTG T PE 0.9 AT9 25.0 0.0 57.7 0.0 0.043 TL 14.00 Pv 0.3 Pipe: 38 73.7 2.157 PL 232.00 PF 11.1 AT9 25.0 0.0 57.7 0.0 6.5 120 FTG 2T PE 0.0 BT9 25.0 0.0 46.6 0.0 0.043 TL 256.00 Pv 0.3 Pipe: 39 73.7 2.157 PL 2.00 PF 0.6 BT9 25.0 0.0 46.6 0.0 6.5 120 FTG T PE 0.9 BB9 23.0 0.0 46.9 0.0 0.043 TL 14.00 Pv 0.3 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 6 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SDF JOB TITLE: Lowe's Sanford,Flordia Esfr System 2 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 40 74.5 2.157 PL 2.00 PF 0.6 AB10 23.0 0.0 59.5 0.0 6.5 120 FTG T PE 0.9 AT10 25.0 0.0 58.0 0.0 0.044 TL 14.00 Pv 0.3 Pipe: 41 74.5 2.157 PL 232.00 PF 11.3 AT10 25.0 0.0 58.0 0.0 6.5 120 FTG 2T PE 0.0 BT10 25.0 0.0 46.7 0.0 0.044 TL 256.00 Pv 0.3 Pipe: 42 74.5 2.157 PL 2.00 PF 0.6 BT10 25.0 0.0 46.7 0.0 6.5 120 FTG T PE 0.9 BB10 23.0 0.0 46.9 0.0 0.044 TL 14.00 Pv 0.3 Pipe: 43 75.5 2.157 PL 2.00 PF 0.6 AS11 23.0 0.0 59.8 0.0 6.6 120 FTG T PE 0.9 AT11 25.0 0.0 58.3 0.0 0.045 TL 14.00 Pv 0.3 Pipe: 44 75.5 2.157 PL 232.00 PF 11.6 A711 25.0 0.0 58.3 0.0 6.6 120 FTG 2T PE 0.0 BT11 25.0 0.0 46.7 0.0 0.045 TL 256.00 Pv 0.3 Pipe: 45 75.5 2.157 PL 2.00 PF 0.6 BT11 25.0 0.0 46.7 0.0 6.6 120 FTG T PE 0.9 BB11 23.0 0.0 46.9 0.0 0.045 TL 14.00 PV 0.3 Pipe: 46 197.1 6.357 PL 10.17 PF 0.0 AB1 23.0 0.0 58.0 0.0 2.0 120 FTG PE 0.0 AB2 23.0 0.0 58.1 0.0 0.001 TL 10.17 Pv 0.0 Pipe: 47 394.2 6.357 PL 10.17 PF 0.1 AB2 23.0 0.0 58.1 0.0 4.0 120 FTG PE 0.0 AB3 23.0 0.0 58.1 0.0 0.005 TL 10.17 Pv 0.1 Pipe: 48 591.2 6.357 PL 10.17 PF 0.1 AB3 23.0 0.0 58.1 0.0 6.0 120 FTG PE 0.0 AB4 23.0 0.0 58.2 0.0 0.011 TL 10.17 Pv 0.2 Pipe: 49 667.2 6.357 PL 10.17 PF 0.1 AB4 23.0 0.0 58.2 0.0 6.7 120 FTG PE 0.0 AB5 23.0 0.0 58.3 0.0 0.013 TL 10.17 Pv 0.3 Pipe: 50 741.7 6.357 PL 10.17 PF 0.2 AB5 23.0 0.0 58.3 0.0 7.5 120 FTG PE 0.0 AB6 23.0 0.0 58.5 0.0 0.016 TL 10.17 Pv 0.4 Pipe: 51 815.3 6.357 PL 10.17 PF 0.2 AB6 23.0 0.0 58.5 0.0 8.2 120 FTG PE 0.0 AB7 23.0 0.0 58.7 0.0 0.019 TL 10.17 Pv 0.5 Pipe: 52 888.5 6.357 PL 10.17 PF 0.2 AB7 23.0 0.0 58.7 0.0 9.0 120 FTG PE 0.0 AB8 23.0 0.0 58.9 0.0 0.022 TL 10.17 Pv 0.5 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 7 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SDF, JOB TITLE: Lowe's Sanford,Flordia Esfr System 2 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 53 961.7 6.357 PL 10.17 PF 0.3 AB8 23.0 0.0 58.9 0.0 9.7 120 FTG PE 0.0 AB9 23.0 0.0 59.2 0.0 0.026 TL 10.17 Pv 0.6 Pipe: 54 1035.4 6.357 PL 10.17 PF 0.3 AB9 23.0 0.0 59.2 0.0 10.5 120 FTG PE 0.0 AB10 23.0 0.0 59.5 0.0 0.030 TL 10.17 Pv 0.7 Pipe: 55 1109.9 6.357 PL 10.17 PF 0.3 AB10 23.0 0.0 59.5 0.0 11.2 120 FTG PE 0.0 AB11 23.0 0.0 59.8 0.0 0.034 TL 10.17 Pv 0.8 Pipe: 56 197.5 4.260 PL 10.17 PF 0.1 B01 23.0 0.0 44.0 0.0 4.4 120 FTG PE 0.0 BB2 23.0 0.0 44.1 0.0 0.010 TL 10.17 Pv 0.1 Pipe: 57 395.3 4.260 PL 10.17 PF 0.4 BB2 23.0 0.0 44.1 0.0 8.9 120 FTG PE 0.0 BB3 23.0 0.0 44.4 0.0 0.035 TL 10.17 Pv 0.5 Pipe: 58 594.2 4.260 PL 10.17 PF 0.8 BB3 23.0 0.0 44.4 0.0 13.4 120 FTG PE 0.0 BB4 23.0 0.0 45.2 0.0 0.075 TL 10.17 Pv 1.2 Pipe: 59 518.3 4.260 PL 10.17 PF 0.6 BB4 23.0 0.0 45.2 0.0 11.7 120 FTG PE 0.0 BB5 23.0 0.0 45.8 0.0 0.058 TL 10.17 Pv 0.9 Pipe: 60 443.8 4.260 PL 10.17 PF 0.4 BB5 23.0 0.0 45.8 0.0 10.0 120 FTG PE 0.0 BB6 23.0 0.0 46.2 0.0 0.044 TL 10.17 Pv 0.7 Pipe: 61 370.2 4.260 PL 10.17 PF 0.3 BB6 23.0 0.0 46.2 0.0 8.3 120 FTG PE 0.0 BB7 23.0 0.0 46.5 0.0 0.031 TL 10.17 Pv 0.5 Pipe: 62 297.0 4.260 PL 10.17 PF 0.2 BB7 23.0 0.0 46.5 0.0 6.7 120 FTG PE 0.0 888 23.0 0.0 46.7 0.0 0.021 TL 10.17 Pv 0.3 Pipe: 63 223.7 4.260 PL 10.17 PF 0.1 BB8 23.0 0.0 46.7 0.0 5.0 120 FTG PE 0.0 BB9 23.0 0.0 46.9 0.0 0.012 TL 10.17 Pv 0.2 Pipe: 64 150.0 4.260 PL 10.17 PF 0.1 BB9 23.0 0.0 46.9 0.0 3.4 120 FTG PE 0.0 BB10 23.0 0.0 46.9 0.0 0.006 TL 10.17 Pv 0.1 Pipe: 65 75.5 4.260 PL 10.17 PF 0.0 BB10 23.0 0.0 46.9 0.0 1.7 120 FTG PE 0.0 BB11 23.0 0.0 46.9 0.0 0.002 TL 10.17 Pv 0.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 8 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SDF JOB TITLE: Lowe's Sanford,Flordia Esfr System 2 PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 66 1185.4 6.357 PL 320.00 PF 17.1 AB11 23.0 0.0 59.8 0.0 12.0 120 FTG 7E PE 0.0 TOR 23.0 0.0 76.9 0.0 0.038 TL 446.00 PV 1.0 Pipe: 67 1185.4 6.357 PL 21.00 PF 3.9 TOR 23.0 0.0 76.9 0.0 12.0 120 FTG TCG PE 9.1 BOR 2.0 H.S. 90.0 100.0 0.038 TL 103.00 Pv 1.0 Pipe: 68 1285.4 8.249 PL 20.00 PF 1.2 BOR 2.0 H.S. 90.0 100.0 7.7 120 FTG ECG PE 0.9 PUMP 0.0 SRCE 92.0 N/A) 0.013 TL 94.00 PV 0.4 NOTES: 1) Calculations were performed by the HASS 7.3 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 Lavista Road Tucker, GA 30084 2) The system has been calculated to provide an average imbalance at each node of 0.001 gpm and a maximum imbalance at any node of 0.051 gpm. 3) velocity pressures are printed for information only and are not used in balancing the system. Maximum water velocity is 17.5 ft/sec at pipe 21. 4) a. System remote area HAS been proven or 'peaked'. b. Minimum pressure at any sprinkler: 15.000 psi c. Minimum pressure with remote area shifted one sprinkler space toward left cross main: 15.018 psi d. Minimum pressure with remote area shifted one sprinkler space toward right cross main: 15.017 psi 5) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 9 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SDF: JOB TITLE: Lowe's Sanford,Flordia Esfr System 2 PAGE: B MATERIAL: THNWL Diameter Equivalent in) E T L Ell Tee LngEll 2.157 6.00 12.00 4.00 4.260 13.00 26.00 8.00 6.357 18.00 38.00 11.00 8.249 20.00 39.00 15.00 HWC: 120 Fitting Lengths in Feet C B G A D N Chkvly Bfyvly Gately A1mChk DPvly NPTee 14.00 7.00 1.00 12.00 12.00 12-.00 29.00 16.00 3.00 26.00 13.00 26.00 40.00 13.00 4.00 35.00 24.00 38.00 50.00 13.00 4.00 39.00 30.00 39.00 1. SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 10 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR2.SDF JOB TITLE: Lowe's Sanford,Flordia Esfr System 2 WATER SUPPLY ANALYSIS 180.0 150.0 G U G120.0 E P R E S 90.0 S U R E P s i 1 1 30.0 M Static: 170.00 psi Resid: 116.00 psi Flow: 1875.0 gpm E 14.7 1 1 1 1 1 1 1 1 1 I LEGEND 1 1q Available pressure 143.14 psi @ 1285.4 2 Required pressure 92.02 psi @ 1285.4 c 40(600 800 1000 1200 1400 1600 1800 2000 FLOW (GPM) r. REED FIRE PROTECTION 5168 MOBILE SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX HYDRAULIC CALCULATIONS FOR LOWES of -Sanford FLori da shaded- structure FILE NUMBER: SHADE.SDF DATE: JUL 25, 2002 DESIGN DATA - OCCUPANCY CLASSIFICATION: DENSITY: AREA OF APPLICATION: COVERAGE PER SPRINKLER: NUMBER OF SPRINKLERS CALCULATED: TOTAL SPRINKLER WATER FLOW REQUIRED: TOTAL WATER REQUIRED (including hose): FLOW AND PRESSURE (@ BOR): SPRINKLER ORIFICE SIZE: NAME OF CONTRACTOR: MERCANTILE 0.20 gpm/sq. ft. 2535 sq. ft. 105 sq. ft. 25 sprinklers 676.2 gpm 776.2 gpm 776.2 gpm @ 98.25 psi 1/2 inch DESIGN/LAYOUT BY: MEH AUTHORITY HAVING JURISDICTION: LOWE'S CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION NUMBER: Florida Permit No. 466077000199 RECEED s4z0 2002 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page.-1 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\SHADE.SDF' JOB TITLE: Lowe's Sanford,Flordia Shade Structure WATER SUPPLY DATA SOURCE STATIC RESID. FLOW AVAIL. TOTAL REQ'D NODE PRESS. PRESS. @ PRESS. @ DEMAND PRESS. TAG PSI) PSI) (GPM) PSI) GPM) PSI) PUMP 170.0 116.0 1875.0 159.4 776.2 98.3 AGGREGATE FLOW ANALYSIS: TOTAL FLOW AT SOURCE 776.2 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 676.2 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) Si 16.0 K= 5.60 14.6 21.4 S2 16.0 K= 5.60 14.8 21.6 53 16.0 K= 5.60 15.8 22.2 S4 16.0 K= 5.60 17.8 23.6 S5 16.0 K= 5.60 21.3 25.9 S6 16.0 K= 5.60 27.1 29.1 S7 16.0 K= 5.60 35.8 33.5 S8 19.0 K= 5.60 14.1 21.0 S9 19.0 K= 5.60 14.3 21.2 S10 19.0 K= 5.60 15.2 21.8 S11 19.0 K= 5.60 17.2 23.2 S12 19.0 K= 5.60 20.6 25.4 S13 19.0 K= 5.60 26.1 28.6 S14 19.0 K= 5.60 34.6 32.9 S15 19.0 K= 5.60 14.6 21.4 516 19.0 K= 5.60 14.9 21.6 S17 19.0 K= 5.60 15.8 22.3 S18 19.0 K= 5.60 17.8 23.6 S19 19.0 K= 5.60 21.4 25.9 S20 19.0 K= 5.60 27.2 29.2 S21 19.0 K= 5.60 35.9 33.5 S22 16.0 K= 5.60 40.2 35.5 S23 16.0 K= 5.60 40.9 35.8 S24 16.0 K= 5.60 43.3 36.8 S25 16.0 K= 5.60 48.4 39.0 CT1 16.0 50.8 CT2 19.0 49.1 CT3 19.0 50.9 CT4 16.0 59.0 CB1 12.0 56.8 CB2 12.0 57.3 CB3 12.0 59.4 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 E: ,•'DAT7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\SHADE.SDF JOB TITLE: Lowe's Sanford,Flordia Shade Structure NODE ANALYSIS DATA (cont.) NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) CB4 12.0 - - - - 63.8 ABY 23.0 - - - - 83.3 ABX 23.0 - - - - 84.7 TOR 23.0 - - - - 86.5 BOR 2.0 HOSE STREAM 96.9 100.0 PUMP 0.0 SOURCE 98.3 776.2 SPRINKLER SYSTEM HYDRAULIC ANALYSIS .Page.,3 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\SHADE.SDF JOB TITLE: Lowe's Sanford,Flordia shade Structure PIPE DATA PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 1 -21.4 1.610 PL 10.00 PF 0.3 S1 16.0 5.6 14.6 21.4 3.4 100 FTG ---- PE 0.0 S2 16.0 5.6 14.8 21.6 0.026 TL 10.00 PV 0.1 Pipe: 2 -43.0 1.610 PL 10.00 PF 0.9 S2 16.0 5.6 14.8 21.6 6.8 100 FTG ---- PE 0.0 S3 -16.0 5.6 15.8 22.2 0.093 TL 10.00 PV 0.3 Pipe: 3 -65.2 1.610 PL 10.00 PF 2.0 S3 16.0 5.6 15.8 22.2 10.3 100 FTG ---- PE 0.0 S4 16.0 5.6 17.8 23.6 0.201 TL 10.00 PV 0.7 Pipe: 4 -88.8 1.610 PL 10.00 PF 3.6 S4 16.0 5.6 17.8 23.6 14.0 100 FTG ---- PE 0.0 S5 16.0 5.6 21.3 25.9 0.357 TL 10.00 PV 1.3 Pipe: 5 -114.7 1.610 PL 10.00 PF 5.7 S5 16.0 5.6 21.3 25.9 18.1 100 FTG ---- PE 0.0 S6 16.0 5.6 27.1 29.1 0.573 TL 10.00 PV 2.2 Pipe: 6 -143.8 1.610 PL 10.00 PF 8.7 S6 16.0 5.6 27.1 29.1 22.7 100 FTG ---- PE 0.0 S7 16.0 5.6 35.8 33.5 0.870 TL 10.00 PV 3.5 Pipe: 7 -177.3 1.610 PL 6.00 PF 15.0 S7 16.0 5.6 35.8 33.5 27.9 100 FTG T PE 0.0 CT1 16.0 0.0 50.8 0.0 1.282 TL 11.71 PV 5.3 Pipe: 8 -21.0 1.610 PL 10.00 PF 0.2 S8 19.0 5.6 14.1 21.0 3.3 100 FTG ---- PE 0.0 S9 19.0 5.6 14.3 21.2 0.025 TL 10.00 PV 0.1 Pipe: 9 -42.2 1.610 PL 10.00 PF 0.9 S9 19.0 5.6 14.3 21.2 6.6 100 FTG ---- PE 0.0 Slo 19.0 5.6 15.2 21.8 0.090 TL 10.00 PV 0.3 Pipe: 10 -64.0 1.610 PL 10.00 PF 1.9 S10 19.0 5.6 15.2 21.8 10.1 100 FTG ---- PE 0.0 S11 19.0 5.6 17.2 23.2 0.195 TL 10.00 PV 0.7 Pipe: 11 -87.2 1.610 PL 10.00 PF 3.5 S11 19.0 5.6 17.2 23.2 13.7 100 FTG ---- PE 0.0 S12 19.0 5.6 20.6 25.4 0.345 TL 10.00 PV 1.3 Pipe: 12 -112.6 1.610 PL 10.00 PF 5.5 S12 19.0 5.6 20.6 25.4 17.8 100 FTG ---- PE 0.0 S13 19.0 5.6 26.1 28.6 0.554 TL 10.00 PV 2.1 Pipe: 13 -141.3 1.610 PL 10.00 PF 8.4 S13 19.0 5.6 26.1 28.6 22.3 100 FTG ---- PE 0.0 S14 19.0 5.6 34.6 32.9 0.842 TL 10.00 PV 3.3 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 DATE! 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\SHADE.SDF JOB TITLE: Lowe's Sanford,Flordia Shade Structure PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 14 174.2 1.610 PL 6.00 PF 14.5 S14 19.0 5.6 34.6 32.9 27.5 100 FTG T PE 0.0 CT2 19.0 0.0 49.1 0.0 1.241 TL 11.71 Pv 5.1 Pipe: 15 21.4 1.610 PL 10.00 PF 0.3 S15 19.0 5.6 14.6 21.4 3.4 100 FTG PE 0.0 S16 19.0 5.6 14.9 21.6 0.026 TL 10.00 PV 0.1 Pipe: 16 43.0 1.610 PL 10.00 PF 0.9 S16 19.0 5.6 14.9 21.6 6.8 100 FTG PE 0.0 S17 19.0 5.6 15.8 22.3 0.093 TL 10.00 Pv 0.3 Pipe: 17 65.3 1.610 PL 10.00 PF 2.0 S17 19.0 5.6 15.8 22.3 10.3 100 FTG PE 0.0 S18 19.0 5.6 17.8 23.6 0.202 TL 10.00 PV 0.7 Pipe: 18 88.9 1.610 PL 10.00 PF 3.6 S18 19.0 5.6 17.8 23.6 14.0 100 FTG PE 0.0 S19 19.0 5.6 21.4 25.9 0.358 TL 10.00 Pv 1.3 Pipe: 19 114.8 1.610 PL 10.00 PF 5.7 S19 19.0 5.6 21.4 25.9 18.1 100 FTG PE 0.0 S20 19.0 5.6 27.2 29.2 0.574 TL 10.00 PV 2.2 Pipe: 20 144.0 1.610 PL 10.00 PF 8.7 S20 19.0 5.6 27.2 29.2 22.7 100 FTG PE 0.0 S21 19.0 5.6 35.9 33.5 0.873 TL 10.00 Pv 3.5 Pipe: 21 177.6 1.610 PL 6.00 PF 15.1 S21 19.0 5.6 35.9 33.5 28.0 100 FTG T PE 0.0 CT3 19.0 0.0 50.9 0.0 1.286 TL 11.71 Pv 5.3 Pipe: 22 35.5 1.610 PL 10.00 PF 0.7 S22 16.0 5.6 40.2 35.5 5.6 100 FTG PE 0.0 S23 16.0 5.6 40.9 35.8 0.065 TL 10.00 PV 0.2 Pipe: 23 71.3 1.610 PL 10.00 PF 2.4 S23 16.0 5.6 40.9 35.8 11.2 100 FTG PE 0.0 S24 16.0 5.6 43.3 36.8 0.238 TL 10.00 Pv 0.9 Pipe: 24 108.2 1.610 PL 10.00 PF 5.1 S24 16.0 5.6 43.3 36.8 17.0 100 FTG PE 0.0 S25 16.0 5.6 48.4 39.0 0.514 TL 10.00 Pv 2.0 Pipe: 25 147.1 1.610 PL 6.00 PF 10.6 S25 16.0 5.6 48.4 39.0 23.2 100 FTG T PE 0.0 CT4 16.0 0.0 59.0 0.0 0.908 TL 11.71 Pv 3.6 Pipe: 26 177.3 2.067 PL 4.00 PF 4.2 CT1 16.0 0.0 50.8 0.0 17.0 100 FTG T PE 1.7 CB1 12.0 0.0 56.8 0.0 0.380 TL 11.14 Pv 1.9 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 5 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\SHADE.S6F JOB TITLE: Lowers Sanford,Flordia Shade Structure PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 27 -174.2 2.067 PL 7.00 PF 5.2 CT2 19.0 0.0 49.1 0.0 16.7 100 FTG T PE 3.0 CB2 12.0 0.0 57.3 0.0 0.368 TL 14.14 Pv 1.9 Pipe: 28 -177.6 2.067 PL 7.00 PF 5.4 CT3 19.0 0.0 50.9 0.0 17.0 100 FTG T PE 3.0 CB3 12.0 0.0 59.4 0.0 0.381 TL 14.14 Pv 1.9 Pipe: 29 -147.1 2.067 PL 4.00 PF 3.0 CT4 16.0 0.0 59.0 0.0 14.1 100 FTG T PE 1.7 CB4 12.0 0.0 63.8 0.0 0.269 TL 11.14 Pv 1.3 Pipe: 30 -177.3 3.068 PL 10.50 PF 0.6 CB1 12.0 0.0 56.8 0.0 7.7 100 FTG ---- PE 0.0 CB2 12.0 0.0 57.3 0.0 0.055 TL 10.50 Pv 0.4 Pipe: 31 -351.5 3.068 PL 10.25 PF 2.0 CB2 12.0 0.0 57.3 0.0 15.3 100 FTG ---- PE 0.0 CB3 12.0 0.0 59.4 0.0 0.197 TL 10.25 Pv 1.6 Pipe: 32 -529.1 3.068 PL 10.50 PF 4.4 CB3 12.0 0.0 59.4 0.0 23.0 100 FTG ---- PE 0.0 CB4 12.0 0.0 63.8 0.0 0.419 TL 10.50 Pv 3.5 Pipe: 33 -676.2 4.026 PL 80.00 PF 24.4 CB4 12.0 0.0 63.8 0.0 17.0 100 FTG 4ETC PE -4.8 ABY 23.0 0.0 83.3 0.0 0.176 TL 138.52 Pv 2.0 Pipe: 34 -676.2 6.357 PL 58.00 PF 1.3 ABY 23.0 0.0 83.3 0.0 6.8 100 FTG E PE 0.0 ABx 23.0 0.0 84.7 0.0 0.019 TL 70.85 Pv 0.3 Pipe: 35 -676.2 6.357 PL 44.00 PF 1.8 ABx 23.0 0.0 84.7 0.0 6.8 100 FTG 2ET PE 0.0 TOR 23.0 0.0 86.5 0.0 0.019 TL 96.81 Pv 0.3 Pipe: 36 -676.2 6.357 PL 21.00 PF 1.3 TOR 23.0 0.0 86.5 0.0 6.8 100 FTG TGD PE 9.1 BOR 2.0 H.S. 96.9 100.0 0.019 TL 68.10 Pv 0.3 Pipe: 37 -776.2 8.249 PL 20.00 PF 0.5 BOR 2.0 H.S. 96.9 100.0 4.7 120 FTG ECG PE 0.9 PUMP 0.0 SRCE 98.3 (N/A) 0.005 TL 94.00 PV 0.1 NOTES: 1) Calculations were performed by the HASS 7.3 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 Lavista Road Tucker, GA 30084 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 6 D&E: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\SHADE.SDF JOB TITLE: Lowe's Sanford,Flordia Shade Structure 2) The system has been calculated to provide an average imbalance at each node of 0.004 gpm and a maximum imbalance at any node of 0.131 gpm. 3) velocity pressures are printed for information only and are not used in balancing the system. Maximum water.velocity is 28.0 ft/sec at pipe 21. 4) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP PAGE: A MATERIAL: S40 HWC: 120 Diameter Equivalent Fittin PAGE: B MATERIAL: THNWL g in) E T L C Ell Tee LngEll Chkvlv 1.610 4.00 8.00 2.00 9.00 2.067 5.00 10.00 3.00 11.00 3.068 7.00 15.00 5.00 16.00 4.026 10.00 20.00 6.00 22.00 PAGE: B MATERIAL: THNWL Diameter Equivalent in) E T L Ell Tee LngEll 6.357 18.00 38.00 11.00 8.249 20.00 39.00 15.00 Lengths in Feet B G A Bfyvly Gatvly Almchk 6.00 1.00 10.00 6.00 1.00 10.00 10.00 1.00 13.00 12.00 2.00 20.00 HWC: 120 Fitting Lengths in Feet D N DPvly NPTee 10.00 8.00 10.00 10.00 10.00 15.00 10.00 20.00 C B G A D N Chkvlv BfyVly Gatvly A1mChk DPV1V NPTee 40.00 13.00 4.00 35.00 24.00 38.00 50.00 13.00 4.00 39.00 30.00 39.00 HWC: 120 Fitting Lengths in Feet D N DPvly NPTee 10.00 8.00 10.00 10.00 10.00 15.00 10.00 20.00 C B G A D N Chkvlv BfyVly Gatvly A1mChk DPV1V NPTee 40.00 13.00 4.00 35.00 24.00 38.00 50.00 13.00 4.00 39.00 30.00 39.00 C B G A D N Chkvlv BfyVly Gatvly A1mChk DPV1V NPTee 40.00 13.00 4.00 35.00 24.00 38.00 50.00 13.00 4.00 39.00 30.00 39.00 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 7 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\SHAUE.SDfi_," JOB TITLE: Lowers Sanford,Flordia Shade Structure WATER SUPPLY ANALYSIS 180.0 all G A U G120.0 E P R E S 90.0 S U R E p s i 1 1 30.0 Static: 170.00 psi Resid: 116.00 psi Flow: 1875.0 gpm LEGEND 1 Available pressure 159.44 psi @ 776.2 t 2j Required pressure 98.25 psi @ 776.2 gF 2 40(600 800 1000 1200 1400 1600 1800 2000 FLOW (GPM) REED FIRE PROTECTION 5168 MOBILE SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX HYDRAULIC CALCULATIONS FOR LOWES of Sanford FLori da Receiving Area Zone #4` FILE NUMBER: ESFR4REC.SDF DATE: AUG 1, 2002 DESIGN DATA - OCCUPANCY CLASSIFICATION: DENSITY: AREA OF APPLICATION: COVERAGE PER SPRINKLER: NUMBER OF SPRINKLERS CALCULATED: TOTAL SPRINKLER WATER FLOW REQUIRED: TOTAL WATER REQUIRED (including hose): FLOW AND PRESSURE (@ BOR): SPRINKLER ORIFICE SIZE: NAME OF CONTRACTOR: MERCANTILE 15 PSI PER HEAD 3 BRANCHLINES WITH 4 HEADS EACH 95 sq . ft . 12 sprinklers 1289.0 gpm 1389.0 gpm 1389.0 gpm @ 105.42 psi ESFR-25 DESIGN/LAYOUT BY: MEH AUTHORITY HAVING JURISDICTION: LOWERS CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION NUMBER: Florida Permit No. 466077000199 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ReC sfP OOT SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 1 DATE: 8/l/2002 " C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF,4 JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving WATER SUPPLY DATA SOURCE STATIC RESID. FLOW NODE PRESS. PRESS. @ TAG PSI) PSI) (GPM) PUMP 170.0 116.0 1875.0 AGGREGATE FLOW ANALYSIS: AVAIL. TOTAL REQ'D PRESS. @ DEMAND PRESS. PSI) (GPM) (PSI) 139.0 1389.0 105.4 TOTAL FLOW AT SOURCE 1389.0 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 1289.0 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) S1 25.0 K=25.20 18.0 107.0 S2 25.0 K=25.20 18.3 107.9 S3 25.0 K=25.20 15.0 97.6 S4 25.0 K=25.20 15.3 98.4 S5 25.0 K=25.20 16.2 101.3 S6 25.0 K=25.20 18.3 107.9 S7 25.0 K=25.20 18.6 108.8 S8 25.0 K=25.20 15.3 98.4 S9 25.0 K=25.20 15.5 99.2 S10 25.0 K=25.20 16.4 102.2 Sil 25.0 K=25.20 25.4 127.0 S12 25.0 K=25.20 27.9 133.1 AT1 25.0 71.3 AT2 25.0 71.3 AT3 25.0 71.3 AT4 25.0 71.3 AT5 25.0 71.3 AT6 25.0 71.3 AT7 25.0 71.3 AT8 25.0 71.6 AT9 25.0 71.9 AT10 25.0 72.3 AT11 25.0 72.6 AT12 25.0 73.0 AT13 25.0 73.4 AT14 25.0 73.8 AT15 25.0 74.2 AB1 23.0 72.1 AB2 23.0 72.1 AB3 23.0 72.1 AB4 23.0:, 72.1 AB5 23.0 72.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 DATE: 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving NODE ANALYSIS DATA (cont.) NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) AB6 23.0 72.1 AB7 23.0 72.1 AB8 23.0 72.4 AB9 23.0 72.8 AB10 23.0 73.2 AB11 23.0 73.5 AB12 23.0 73.9 AB13 23.0 74.3 AB14 23.0 74.7 AB15 23.0 75.2 BT1 25.0 71.8 BT2 25.0 71.8 BT3 25.0 71.8 BT4 25.0 71.8 BT5 25.0 71.8 BT6 25.0 71.8 BT7 25.0 71.9 BT8 25.0 71.9 BT9 25.0 72.0 BT10 25.0 72.1 BT11 25.0 72.1 BT12 25.0 72.2 BT13 25.0 72.2 BT14 25.0 72.3 BT15 25.0 72.3 B01 23.0 72.7 BB2 23.0 72.7 BB3 23.0 72.7 BB4 23.0 72.7 BB5 23.0 72.7 B66 23.0 72.7 BB7 23.0 72.8 BB8 23.0 72.8 BB9 23.0 72.9 BB10 23.0 72.9 BB11 23.0 72.9 BB12 23.0 73.0 BB13 23.0 73.0 BB14 23.0 73.0 BB15 23.0 73.0 TOR 23.0 89.6 BOR 2.0 HOSE STREAM 103.3 100.0 PUMP 0.0 SOURCE 105.4 1389.0 RT1 25.0 20.8 RT2 25.0 21.2 RT3 25.0 31.2 RB1 23.0 32.9 RB2 23.0 33.4 RB3 23.0 35.3 R5 23.0 72.1 R4 25.0 28.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 3 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF,,, JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving PIPE DATA PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 1 16.5 2.157 PL 2.00 PF 0.0 AB1 23.0 0.0 72.1 0.0 1.5 120 FTG T PE 0.9 AT1 25.0 0.0 71.3 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 2 16.5 2.157 PL 169.00 PF 0.5 AT1 25.0 0.0 71.3 0.0 1.5 120 FTG 2T PE 0.0 BT1 25.0 0.0 71.8 0.0 0.003 TL 193.00 PV 0.0 Pipe: 3 16.5 2.157 PL 2.00 PF 0.0 BT1 25.0 0.0 71.8 0.0 1.5 120 FTG T PE 0.9 BB1 23.0 0.0 72.7 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 4 16.6 2.157 PL 2.00 PF 0.0 AB2 23.0 0.0 72.1 0.0 1.5 120 FTG T PE 0.9 AT2 25.0 0.0 71.3 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 5 16.6 2.157 PL 169.00 PF 0.5 AT2 25.0 0.0 71.3 0.0 1.5 120 FTG 2T PE 0.0 BT2 25.0 0.0 71.8 0.0 0.003 TL 193.00 Pv 0.0 Pipe: 6 16.6 2.157 PL 2.00 PF 0.0 BT2 25.0 0.0 71.8 0.0 1.5 120 FTG T PE 0.9 BB2 23.0 0.0 72.7 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 7 16.6 2.157 PL 2.00 PF 0.0 AB3 23.0 0.0 72.1 0.0 1.5 120 FTG T PE 0.9 AT3 25.0 0.0 71.3 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 8 16.6 2.157 PL 169.00 PF 0.5 AT3 25.0 0.0 71.3 0.0 1.5 120 FTG 2T PE 0.0 BT3 25.0 0.0 71.8 0.0 0.003 TL 193.00 Pv 0.0 Pipe: 9 16.6 2.157 PL 2.00 PF 0.0 BT3 25.0 0.0 71.8 0.0 1.5 120 FTG T PE 0.9 BB3 23.0 0.0 72.7 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 10 16.7 2.157 PL 2.00 PF 0.0 AB4 23.0 0.0 72.1 0.0 1.5 120 FTG T PE 0.9 AT4 25.0 0.0 71.3 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 11 16.7 2.157 PL 169.00 PF 0.5 AT4 25.0 0.0 71.3 0.0 1.5 120 FTG 2T PE 0.0 BT4 25.0 0.0 71.8 0.0 0.003 TL 193.00 PV 0.0 Pipe: 12 16.7 2.157 PL 2.00 PF 0.0 BT4 25.0 0.0 71.8 0.0 1.5 120 FTG T PE 0.9 B84 23.0 0.0 72.7 0.0 0.003 TL 14.00 PV 0.0 Pipe: 13 16.9 2.157 PL 2.00 PF 0.0 AB5 23.0 0.0 72.1 0.0 1.5 120 FTG T PE 0.9 AT5 25.0 0.0 71.3 0.0 0.003 TL 14.00 Pv 0.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 DATE: 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF JOB TITLE: Lowe`s Sanford,Florida Esfr System 4 Receiving PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT Psi) Pipe: 14 16.9 2.157 PL 169.00 PF 0.6 AT5 25.0 0.0 71.3 0.0 1.5 120 FTG 2T PE 0.0 BT5 25.0 0.0 71.8 0.0 0.003 TL 193.00 Pv 0.0 Pipe: 15 16.9 2.157 PL 2.00 PF 0.0 BT5 25.0 0.0 71.8 0.0 1.5 120 FTG T PE 0.9 BB5 23.0 0.0 72.7 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 16 17.3 2.157 PL 2.00 PF 0.0 A86 23.0 0.0 72.1 0.0 1.5 120 FTG T PE 0.9 AT6 25.0 0.0 71.3 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 17 17.3 2.157 PL 169.00 PF 0.6 AT6 25.0 0.0 71.3 0.0 1.5 120 FTG . 2T PE 0.0 BT6 25.0 0.0 71.8 0.0 0.003 TL 193.00 PV 0.0 Pipe: 18 17.3 2.157 PL 2.00 PF 0.0 BT6 25.0 0.0 71.8 0.0 1.5 120 FTG T PE 0.9 BB6 23.0 0.0 72.7 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 19 17.7 2.157 PL 2.00 PF 0.0 AB7 23.0 0.0 72.1 0.0 1.6 120 FTG T PE 0.9 AT7 25.0 0.0 71.3 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 20 17.7 2.157 PL 169.00 PF 0.6 AT7 25.0 0.0 71.3 0.0 1.6 120 FTG 2T PE 0.0 BT7 25.0 0.0 71.9 0.0 0.003 TL 193.00 Pv 0.0 Pipe: 21 17.7 2.157 PL 2.00 PF 0.0 BT7 25.0 0.0 71.9 0.0 1.6 120 FTG T PE 0.9 BB7 23.0 0.0 72.8 0.0 0.003 TL 14.00 Pv 0.0 Pipe: 22 12.9 2.157 PL 2.00 PF 0.0 AB8 23.0 0.0 72.4 0.0 1.1 120 FTG T PE 0.9 AT8 25.0 0.0 71.6 0.0 0.002 TL 14.00 PV 0.0 Pipe: 23 12.9 2.157 PL 169.00 PF 0.3 AT8 25.0 0.0 71.6 0.0 1.1 120 FTG 2T PE 0.0 BT8 25.0 0.0 71.9 0.0 0.002 TL 193.00 PV 0.0 Pipe: 24 12.9 2.157 PL 2.00 PF 0.0 BT8 25.0 0.0 71.9 0.0 1.1 120 FTG T PE 0.9 BB8 23.0 0.0 72.8 0.0 0.002 TL 14.00 PV 0.0 Pipe: 25 4.5 2.157 PL 2.00 PF 0.0 AB9 23.0 0.0 72.8 0.0 0.4 120 FTG T PE 0.9 AT9 25.0 0.0 71.9 0.0 0.000 TL 14.00 Pv 0.0 Pipe: 26 4.5 2.157 PL 169.00 PF 0.0 AT9 25.0 0.0 71.9 0.0 0.4 120 FTG 2T PE 0.0 BT9 25.0 0.0 72:0 0.0 0.000 TL 193.00 PV 0.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 5 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF„ JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 27 4.5 2.157 PL 2.00 PF 0.0 BT9 25.0 0.0 72.0 0.0 0.4 120 FTG T PE 0.9 BB9 23.0 0.0 72.9 0.0 0.000 TL 14.00 PV 0.0 Pipe: 28 10.6 2.157 PL 2.00 PF 0.0 AB10 23.0 0.0 73.2 0.0 0.9 120 FTG T PE 0.9 AT10 25.0 0.0 72.3 0.0 0.001 TL 14.00 Pv 0.0 Pipe: 29 10.6 2.157 PL 169.00 PF 0.2 AT10 25.0 0.0 72.3 0.0 0.9 120 FTG 2T PE 0.0 BT10 25.0 0.0 72.1 0.0 0.001 TL 193.00 PV 0.0 Pipe: 30 10.6 2.157 PL 2.00 PF 0.0 BT10 25.0 0.0 72.1 0.0 0.9 120 FTG T PE 0.9 BB10 23.0 0.0 72.9 0.0 0.001 TL 14.00 PV 0.0 Pipe: 31 16.5 2.157 PL 2.00 PF 0.0 AB11 23.0 0.0 73.5 0.0 1.4 120 FTG T PE 0.9 AT11 25.0 0.0 72.6 0.0 0.003 TL 14.00 PV 0.0 Pipe: 32 16.5 2.157 PL 169.00 PF 0.5 AT11 25.0 0.0 72.6 0.0 1.4 120 FTG 2T PE 0.0 BT11 25.0 0.0 72.1 0.0 0.003 TL 193.00 PV 0.0 Pipe: 33 16.5 2.157 PL 2.00 PF 0.0 BT11 25.0 0.0 72.1 0.0 1.4 120 FTG T PE 0.9 BB11 23.0 0.0 72.9 0.0 0.003 TL 14.00 PV 0.0 Pipe: 33A 21.2 2.157 PL 2.00 PF 0.1 AB12 23.0 0.0 73.9 0.0 1.9 120 FTG T PE 0.9 AT12 25.0 0.0 73.0 0.0 0.004 TL 14.00 PV 0.0 Pipe: 34 21.2 2.157 PL 169.00 PF 0.8 AT12 25.0 0.0 73.0 0.0 1.9 120 FTG 2T PE 0.0 BT12 25.0 0.0 72.2 0.0 0.004 TL 193.00 PV 0.0 Pipe: 35 21.2 2.157 PL 2.00 PF 0.1 BT12 25.0 0.0 72.2 0.0 1.9 120 FTG T PE 0.9 BB12 23.0 0.0 73.0 0.0 0.004 TL 14.00 PV 0.0 Pipe: 36 25.3 2.157 PL 2.00 PF 0.1 AB13 23.0 0.0 74.3 0.0 2.2 120 FTG T PE 0.9 AT13 25.0 0.0 73.4 0.0 0.006 TL 14.00 PV 0.0 Pipe: 37 25.3 2.157 PL 169.00 PF 1.2 AT13 25.0 0.0 73.4 0.0 2.2 120 FTG 2T PE 0.0 BT13 25.0 0.0 72.2 0.0 0.006 TL 193.00 PV 0.0 Pipe: 38 25.3 2.157 PL 2.00 PF 0.1 BT13 25.0 0.0 72.2 0.0 2.2 120 FTG T PE 0.9 BB13 23.0 0.0 73.0 0.0 0.006 TL 14.00 PV 0.0 j,,DATi:' SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 6 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) i Pipe: 39 29.2 2.157 PL 2.00 PF 0.1 AB14 23.0 0.0 74.7 0.0 20 120 FTG T PE 0.9 AT14 25.0 0.0 73.8 0.0 0.008 TL 14.00 PV 0.0 Pipe: 40 29.2 2.157 PL 169.00 PF 1.5 AT14 25.0 0.0 73.8 0.0 2.6 120 FTG 2T PE 0.0 BT14 25.0 0.0 72.3 0.0 0.008 TL 193.00 PV 0.0 Pipe: 41 29.2 2.157 PL 2.00 PF 0.1 BT14 25.0 0.0 72.3 0.0 2.6 120 FTG T PE 0.9 BB14 23.0 0.0 73.0 0.0 0.008 TL 14.00 PV 0.0 Pipe: 42 33.0 2.157 PL 2.00 PF 0.1 AB15 23.0 0.0 75.2 0.0 2.9 120 FTG T PE 0.9 AT15 25.0 0.0 74.2 0.0 0.010 TL 14.00 PV 0.1 Pipe: 43 33.0 2.157 PL 169.00 PF 1.9 AT15 25.0 0.0 74.2 0.0 2.9 120 FTG 2T PE 0.0 BT15 25.0 0.0 72.3 0.0 0.010 TL 193.00 PV 0.1 Pipe: 44 33.0 2.157 PL 2.00 PF 0.1 BT15 25.0 0.0 72.3 0.0 2.9 120 FTG T PE 0.9 BB15 23.0 0.0 73.0 0.0 0.010 TL 14.00 PV 0.1 Pipe: 45 16.5 6.357 PL 9.00 PF 0.0 AB1 23.0 0.0 72.1 0.0 0.2 120 FTG PE 0.0 AB2 23.0 0.0 72.1 0.0 0.000 TL 9.00 PV 0.0 Pipe: 46 33.1 6.357 PL 9.00 PF 0.0 AB2 23.0 0.0 72.1 0.0 0.3 120 FTG PE 0.0 AB3 23.0 0.0 72.1 0.0 0.000 TL 9.00 PV 0.0 Pipe: 47 49.7 6.357 PL 9.00 PF 0.0 AB3 23.0 0.0 72.1 0.0 0.5 120 FTG PE 0.0 AB4 23.0 0.0 72.1 0.0 0.000 TL 9.00 PV 0.0 Pipe: 48 66.4 6.357 PL 9.00 PF 0.0 AB4 23.0 0.0 72.1 0.0 0.7 120 FTG PE 0.0 i AB5 i 23.0 0.0 72.1 0.0 0.000 TL 9.00 PV 0.0 Pipe: 49 83.4 6.357 PL 10.17 PF 0.0 AB5 23.0 0.0 72.1 0.0 0.8 120 FTG PE 0.0 AB6 23.0 0.0 72.1 0.0 0.000 TL 10.17 PV 0.0 Pipe: 50 100.6 6.357 PL 10.17 PF 0.0 AB6 23.0 0.0 72.1 0.0 1.0 120 FTG PE 0.0 AB7 23.0 0.0 72.1 0.0 0.000 TL 10.17 Pv 0.0 Pipe: 51 118.3 6.357 PL 1.00 PF 0.0 AB7 23.0 0.0 72.1 0.0 1.2 120 FTG PE 0.0 R5 23.0 0.0 72.1 0.0 0.001 TL 1.00 PV 0.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 7 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF4 JOB TITLE: LOWS Sanford,Florida Esfr System 4 Receiving PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 52 1170.7 6.357 PL 9.17 PF 0.3 R5 23.0 0.0 72.1 0-0 11.8 120 FTG PE 0.0 AB8 23.0 0.0 72.4 0.0 0.037 TL 9.17 PV 0.9 Pipe: 53 1157.8 6.357 PL 10.17 PF 0.4 AB8 23.0 0.0 72.4 0.0 11.7 120 FTG PE 0.0 AB9 23.0 0.0 72.8 0.0 0.037 TL 10.17 PV 0.9 Pipe: 54 1153.2 6.357 PL 10.17 PF 0.4 AB9 23.0 0.0 72.8 0.0 11.7 120 FTG PE 0.0 A010 23.0 0.0 73.2 0.0 0.036 TL 10.17 PV 0.9 Pipe: 55 1163.8 6.357 PL 10.17 PF 0.4 A010 23.0 0.0 73.2 0.0 11.8 120 FTG PE 0.0 AB11 23.0 0.0 73.5 0.0 0.037 TL 10.17 PV 0.9 Pipe: 56 1180.3 6.357 PL 10.17 PF 0.4 AB11 23.0 0.0 73.5 0.0 11.9 120 FTG PE 0.0 AB12 23.0 0.0 73.9 0.0 0.038 TL 10.17 Pv 1.0 Pipe: 57 1201.5 6.357 PL 10.17 PF 0.4 AB12 23.0 0.0 73.9 0.0 12.1 120 FTG PE 0.0 AB13 23.0 0.0 74.3 0.0 0.039 TL 10.17 Pv 1.0 Pipe: 58 1226.8 6.357 PL 10.17 PF 0.4 A013 23.0 0.0 74.3 0.0 12.4 120 FTG PE 0.0 A014 23.0 0.0 74.7 0.0 0.041 TL 10.17 PV 1.0 Pipe: 59 1256.0 6.357 PL 10.17 PF 0.4 AB14 23.0 0.0 74.7 0.0 12.7 120 FTG PE 0.0 AB15 23.0 0.0 75.2 0.0 0.043 TL 10.17 PV 1.1 Pipe: 60 16.5 4.260 PL 9.00 PF 0.0 BB1 23.0 0.0 72.7 0.0 0.4 120 FTG PE 0.0 BB2 23.0 0.0 72.7 0.0 0.000 TL 9.00 PV 0.0 Pipe: 61 33.1 4.260 PL 9.00 PF 0.0 BB2 23.0 0.0 72.7 0.0 0.7 120 FTG PE 0.0 BB3 23.0 0.0 72.7 0.0 0.000 TL 9.00 PV 0.0 Pipe: 62 49.7 4.260 PL 9.00 PF 0.0 BB3 23.0 0.0 72.7 0.0 1.1 120 FTG PE 0.0 BB4 23.0 0.0 72.7 0.0 0.001 TL 9.00 PV 0.0 Pipe: 63 66.4 4.260 PL 9.00 PF 0.0 BB4 23.0 0.0 72.7 0.0 1.5 120 FTG PE 0.0 BB5 23.0 0.0 72.7 0.0 0.001 TL 9.00 PV 0.0 Pipe: 64 83.4 4.260 PL 10.17 PF 0.0 BB5 23.0 0.0 72.7 0.0 1.9 120 FTG PE 0.0 BB6 23.0 0.0 72.7 0.0 0.002 TL 10.17 PV 0.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 8 DATE:' 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 65 -100.6 4.260 PL 10.17 PF 0.0 BB6 23.0 0.0 72.7 0.0 2.3 120 FTG ---- PE 0.0 BB7 23.0 0.0 72.8 0.0 0.003 TL 10.17 Pv 0.0 Pipe: 66 -118.3 4.260 PL 10.17 PF 0.0 BB7 23.0 0.0 72.8 0.0 2.7 120 FTG ---- PE 0.0 BB8 23.0 0.0 72.8 0.0 0.004 TL 10.17 Pv 0.0 Pipe: 67 -131.2 4.260 PL 10.17 PF 0.0 BB8 23.0 0.0 72.8 0.0 3.0 120 FTG ---- PE 0.0 BB9 23.0 0.0 72.9 0.0 0.005 TL 10.17 Pv 0.1 Pipe: 68 -135.8 4.260 PL 10.17 PF 0.0 BB9 23.0 0.0 72.9 0.0 3.1 120 FTG ---- PE 0.0 BB10 23.0 0.0 72.9 0.0 0.005 TL 10.17 PV 0.1 Pipe: 69 -125.2 4.260 PL 10.17 PF 0.0 BB10 23.0 0.0 72.9 0.0 2.8 120 FTG ---- PE 0.0 BB11 23.0 0.0 72.9 0.0 0.004 TL 10.17 Pv 0.1 Pipe: 70 -108.7 4.260 PL 10.17 PF 0.0 BB11 23.0 0.0 72.9 0.0 2.4 120 FTG ---- PE 0.0 BB12 23.0 0.0 73.0 0.0 0.003 TL 10.17 Pv 0.0 Pipe: 71 ' -87.5 4.260 PL 10.17 PF 0.0 BB12 23.0 0.0 73.0 0.0 2.0 120 FTG ---- PE 0.0 BB13 23.0 0.0 73.0 0.0 0.002 TL 10.17 Pv 0.0 Pipe: 72 -62.2 4.260 PL 10.17 PF 0.0 BB13 23.0 0.0 73.0 0.0 1.4 120 FTG ---- PE 0.0 B014 23.0 0.0 73.0 0.0 0.001 TL 10.17 Pv 0.0 Pipe: 73 -33.0 4.260 PL 10.17 PF 0.0 BB14 23.0 0.0 73.0 0.0 0.7 120 FTG ---- PE 0.0 BB15 23.0 0.0 73.0 0.0 0.000 TL 10.17 PV 0.0 Pipe: 74-1289.0 6.357 PL 215.00 PF 14.5 AB15 23.0 0.0 75.2 0.0 13.0 120 FTG 6E PE 0.0 TOR 23.0 0.0 89.6 0.0 0.045 TL 323.00 PV 1.1 Pipe: 75-1289.0 6.357 PL 21.00 PF 4.6 TOR 23.0 0.0 89.6 0.0 13.0 120 FTG TCG PE 9.1 BOR 2.0 H.S. 103.3 100.0 0.045 TL 103.00 PV 1.1 Pipe: 76-1389.0 8.249 PL 10.00 PF 1.2 BOR 2.0 H.S. 103.3 100.0 8.3 120 FTG ECG PE 0.9 PUMP 0.0 SRCE 105.4 (N/A) 0.014 TL 84.00 PV 0.5 Pipe: 77 -107.0 2.635 PL 9.00 PF 0.3 S1 25.0 25.2 18.0 107.0 6.3 120 FTG ---- PE 0.0 S2 25.0 25.2 18.3 107.9 0.033 TL 9.00 PV 0.3 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 9 DATE: 8/l/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF., JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 78 -214.9 2.635 PL 4.00 PF 2.5 S2 25.0 25.2 18.3 107.9 12.6 120 FTG T PE 0.0 RT1 25.0 0.0 20.8 0.0 0.119 TL 21.00 PV 1.1 Pipe: 79 -97.6 2.635 PL 9.33 PF 0.3 S3 25.0 25.2 15.0 97.6 5.7 120 FTG ---- PE 0.0 S4 25.0 25.2 15.3 98.4 0.028 TL 9.33 PV 0.2 Pipe: 80 -196.0 2.635 PL 9.17 PF 0.9 S4 25.0 25.2 15.3 98.4 11.5 120 FTG ---- PE 0.0 S5 25.0 25.2 16.2 101.3 0.100 TL 9.17 PV 0.9 Pipe: 81 -297.4 2.635 PL 4.50 PF 4.6 S5 25.0 25.2 16.2 101.3 17.5 120 FTG T PE 0.0 RT1 25.0 0.0 20.8 0.0 0.216 TL 21.50 PV 2.1 Pipe: 82 -107.9 2.635 PL 9.00 PF 0.3 S6 25.0 25.2 18.3 107.9 6.3 120 FTG ---- PE 0.0 S7 25.0 25.2 18.6 108.8 0.033 TL 9.00 PV 0.3 Pipe: 83 -216.7 2.635 PL 4.00 PF 2.5 S7 25.0 25.2 18.6 108.8 12.7 120 FTG T PE 0.0 RT2 25.0 0.0 21.2 0.0 0.120 TL 21.00 PV 1.1 Pipe: 84 -98.4 2.635 PL 9.33 PF 0.3 S8 25.0 25.2 15.3 98.4 5.8 120 FTG ---- PE 0.0 S9 25.0 25.2 15.5 99.2 0.028 TL 9.33 PV 0.2 Pipe: 85 -197.7 2.635 PL 9.17 PF 0.9 S9 25.0 25.2 15.5 99.2 11.6 120 FTG ---- PE 0.0 S10 25.0 25.2 16.4 102.2 0.102 TL 9.17 PV 0.9 Pipe: 86 -299.8 2.635 PL 4.50 PF 4.7 S10 25.0 25.2 16.4 102.2 17.6 120 FTG T PE 0.0 RT2 25.0 0.0 21.2 0.0 0.220 TL 21.50 PV 2.1 Pipe: 87 -127.0 2.635 PL 16.18 PF 2.6 Sil 25.0 25.2 25.4 127.0 7.5 120 FTG AT PE 0.0 R4 25.0 0.0 28.0 0.0 0.045 TL 57.18 PV 0.4 Pipe: 88 -133.1 2.635 PL 1.25 PF 0.1 S12 25.0 25.2 27.9 133.1 7.8 120 FTG ---- PE 0.0 R4 25.0 0.0 28.0 0.0 0.049 TL 1.25 PV 0.4 Pipe: 89 -260.1 2.635 PL 2.33 PF 3.3 R4 25.0 0.0 28.0 0.0 15.3 120 FTG T PE 0.0 RT3 25.0 0.0 31.2 0.0 0.169 TL 19.33 PV 1.6 Pipe: 90 -512.3 2.635 PL 2.00 PF 11.2 RT1 25.0 - 0.0 20.8 0.0 30.1 120 FTG T PE 0.9 RB1 23.0 0.0 32.9 0.0 0.592 TL 19.00 Pv 6.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 10 DATE: 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) sum. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 91 516.5 2.635 PL 2.00 PF 11.4 RT2 25.0 0.0 21.2 0.0 30.4 120 FTG T PE 0.9 RB2 23.0 0.0 33.4 0.0 0.601 TL 19.00 PV 6.2 Pipe: 92 260.1 2.635 PL 2.00 PF 3.2 RT3 25.0 0.0 31.2 0.0 15.3 120 FTG T PE 0.9 RB3 23.0 0.0 35.3 0.0 0.169 TL 19.00 PV 1.6 Pipe: 93 512.3 4.260 PL 9.00 PF 0.5 RB1 23.0 0.0 32.9 0.0 11.5 120 FTG ---- PE 0.0 R82 23.0 0.0 33.4 0.0 0.057 TL 9.00 PV 0.9 Pipe: 94 1028.9 4.260 PL 9.00 PF 1.9 RB2 23.0 0.0 33.4 0.0 23.2 120 FTG ---- PE 0.0 RB3 23.0 0.0 35.3 0.0 0.207 TL 9.00 PV 3.6 Pipe: 95 1289.0 4.260 PL 78.00 PF 36.8 RB3 23.0 0.0 35.3 0.0 29.0 120 FTG ET PE 0.0 R5 23.0 0.0 72.1 0.0 0.314 TL 117.00 PV 5.7 NOTES: 1) Calculations were performed by the HASS 7.3 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 Lavista Road Tucker, GA 30084 2) The system has been calculated to provide an average imbalance at each node of 0.002 gpm and a maximum imbalance at any node of 0.142 gpm. 3) velocity pressures are printed for information only and are not used in balancing the system. Maximum water velocity is 30.4 ft/sec at pipe 91. 4) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP PAGE: B MATERIAL: THNWL HWC: 120 Diameter Equivalent Fitting Lengths in Feet in) E T L C B G A D N Ell Tee LngEll ChkVly BfyVly Gately A1mChk DPVlV NPTee 2.157 6.00 12.00 4.00 14.00 7.00 1.00 12.00 12.00 12.00 2.635 8.00 17.00 6.00 19.00 10.00 1.00 14.00 14.00 17.00 4.260 13.00 26.00 8.00 29.00 16.00 3.00 26.00 13.00 26.00 6.357 18.00 38.00 11.00 40.00 13.00 4.00 35.00 24.00 38.00 8.249 20.00 39.00 15.00 50.00 13.00 4.00 39.00 30.00 39.00 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 11 DATE: 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF., JOB TITLE: Lowers Sanford,Florida Esfr System 4 Receiving WATER SUPPLY ANALYSIS 180.0 150.0 G U G120.0 E P R E S 90.0 S U R E p s i 1 1 30.0 static: 170.00 psi Resid: 116.00 psi Flow: 1875.0 gpm LEGEND 1 Available pressure 139.00 psi @ 1389.0 21 Required pressure 105.42 psi @ 1389.0 E 40(600 800 1000 1200 1400 1600 1800 2000 FLOW (GPM) SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 12 DATE: 8/1/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\ESFR4REC.SDF JOB TITLE: Lowe's Sanford,Florida Esfr System 4 Receiving REED FIRE PROTECTION 5168 MOBILE SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX HYDRAULIC CALCULATIONS FOR tdo LOWES OF .Sanford FL Garden Center FILE NUMBER: GARDEN.SDF DATE: JUL 25, 2002 DESIGN DATA - OCCUPANCY CLASSIFICATION: DENSITY: AREA OF APPLICATION: COVERAGE PER SPRINKLER: NUMBER OF SPRINKLERS CALCULATED: TOTAL SPRINKLER WATER FLOW REQUIRED: TOTAL WATER REQUIRED (including hose): FLOW AND PRESSURE (@ BOR): SPRINKLER ORIFICE SIZE: NAME OF CONTRACTOR: MERCHANTILE 0.60 gpm/sq. ft. 2600 sq. ft. 90 sq. ft. 19 sprinklers 1815.1 gpm 1915.0 gpm 1915.0 gpm @ 88.18 psi 17/32 inch DESIGN/LAYOUT BY: MEH AUTHORITY HAVING JURISDICTION: LOWERS CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION NUMBER: Florida Permit No. 466077000199 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ) HRS SYSTEMS, INC. ATLANTA, GA RECEI SEP;OZ02 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page'1 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\GARDEN.SDF. JOB TITLE: Lowe's Sanford,Florida Garden Center WATER SUPPLY DATA SOURCE STATIC RESID. FLOW AVAIL. TOTAL REQ'D NODE PRESS. PRESS. @ PRESS. @ DEMAND PRESS. TAG PSI) PSI) (GPM) PSI) GPM) PSI) PUMP 170.0 116.0 1875.0 113.8 1915.0 88.2 AGGREGATE FLOW ANALYSIS: TOTAL FLOW AT SOURCE 1915.0 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 1815.0 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) Si 25.0 K=25.20 12.5 89.1 S2 25.0 K=25.20 12.9 90.3 S3 25.0 K=25.20 14.3 95.4 S4 25.0 K=25.20 15:8 100.2 S5 25.0 K=25.20 15.3 98.6 S6 25.0 K=25.20 12.5 89.0 S7 25.0 K=25.20 12.8 90.2 S8 25.0 K=25.20 14.3 95.3 S9 25.0 K=25.20 15.8 100.0 S10 25.0 K=25.20 15.3 98.5 S11 25.0 K=25.20 12.5 89.0 S12 25.0 K=25.20 12.8 90.2 S13 25.0 K=25.20 14.3 95.3 S14 25.0 K=25.20 15.8 100.1 S15 25.0 K=25.20 15.3 98.5 S16 25.0 K=25.20 13.4 92.4 S17 25.0 K=25.20 13.8 93.6 S18 25.0 K=25.20 15.4 98.9 S19 25.0 K=25.20 19.2 110.4 CT1 25.0 18.7 CT2 25.0 18.6 CT3 25.0 18.7 CT4 25.0 20.1 CB1 23.0 23.7 CB2 23.0 23.6 CB3 23.0 23.6 CB4 23.0 23.8 A 23.0 24.1 B 23.0 25.8 C 23.0 28.3 D ' ,y 23:0-, 253 ABY 23.0 52.1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\GARDEN.SDF JOB TITLE: Lowe's Sanford,Florida Garden Center NODE ANALYSIS DATA (cont.) NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) ABx 23.0 58.5 TOR 23.0 68.4 BOR 2.0 HOSE STREAM 84.9 100.0 PUMP 0.0 SOURCE 88.2 1915.0 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page •3 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\GARDEN.SDF_, JOB TITLE: Lowe's Sanford,Florida Garden Center PIPE DATA PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 1 89.1 2.635 PL 10.50 PF 0.3 S1 25.0 25.2 12.5 89.1 5.2 100 FTG PE 0.0 A 25.0 25.2 12.9 90.3 0.033 TL 10.50 Pv 0.2 Pipe: 2 179.5 2.635 PL 12.50 PF 1.5 S2 25.0 25.2 12.9 90.3 10.6 100 FTG PE 0.0 A 25.0 25.2 14.3 95.4 0.119 TL 12.50 Pv 0.8 Pipe: 3 274.9 2.635 PL 4.50 PF 4.4 A 25.0 25.2 14.3 95.4 16.2 100 FTG T PE 0.0 CT1 25.0 0.0 18.7 0.0 0.262 TL 16.63 Pv 1.8 Pipe: 4 198.8 2.635 PL 8.00 PF 2.9 CT1 25.0 0.0 18.7 0.0 11.7 100 FTG T PE 0.0 S4 25.0 25.2 15.8 100.2 0.144 TL 20.13 Pv 0.9 Pipe: 5 98.6 2.635 PL 12.50 PF 0.5 S4 25.0 25.2 15.8 100.2 5.8 100 FTG PE 0.0 55 25.0 25.2 15.3 98.6 0.039 TL 12.50 Pv 0.2 Pipe: 6 89.0 2.635 PL 10.50 PF 0.3 S6 25.0 25.2 12.5 89.0 5.2 100 FTG PE 0.0 S7 25.0 25.2 12.8 90.2 0.033 TL 10.50 Pv 0.2 Pipe: 7 179.2 2.635 PL 12.50 PF 1.5 57 25.0 25.2 12.8 90.2 10.5 100 FTG PE 0.0 S8 25.0 25.2 14.3 95.3 0.119 TL 12.50 Pv 0.7 Pipe: 8 274.5 2.635 PL 4.50 PF 4.3 S8 25.0 25.2 14.3 95.3 16.2 100 FTG T PE 0.0 CT2 25.0 0.0 18.6 0.0 0.261 TL 16.63 Pv 1.8 Pipe: 9 198.5 2.635 PL 8.00 PF 2.9 CT2 25.0 0.0 18.6 0.0 11.7 100 FTG T PE 0.0 S9 25.0 25.2 15.8 100.0 0.143 TL 20.13 Pv 0.9 Pipe: 10 98.5 2.635 PL 12.50 PF 0.5 S9 25.0 25.2 15.8 100.0 5.8 100 FTG PE 0.0 S10 25.0 25.2 15.3 98.5 0.039 TL 12.50 Pv 0.2 Pipe: 11 89.0 2.635 PL 10.50 PF 0.3 S11 25.0 25.2 12.5 89.0 5.2 100 FTG PE 0.0 S12 25.0 25.2 12.8 90.2 0.033 TL 10.50 Pv 0.2 Pipe: 12 179.3 2.635 PL 12.50 PF 1.5 S12 25.0 25.2 12.8 90.2 10.5 100 FTG PE 0.0 S13 25.0 25.2 14.3 95.3 0.119 TL 12.50 Pv 0.7 Pipe: 13 274.6 2.635 PL 4.50 PF 4.3 S13 25.0 25.2 14.3 95.3 16.2 100 FTG T PE 0.0 CT3 25.0 0.0 18.7 0.0 0.261 TL 16.63 Pv 1.8 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\GARDEN.SDF JOB TITLE: Lowe's Sanford,Florida Garden Center PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 14 198.5 2.635 PL 8.00 PF 2.9 CT3 25.0 0.0 18.7 0.0 11.7 100 FTG T PE 0.0 S14 25.0 25.2 15.8 100.1 0.144 TL 20.13 Pv 0.9 Pipe: 15 98.5 2.635 PL 12.50 PF 0.5 S14 25.0 25.2 15.8 100.1 5.8 100 FTG PE 0.0 S15 25.0 25.2 15.3 98.5 0.039 TL 12.50 Pv 0.2 Pipe: 16 92.4 2.635 PL 10.50 PF 0.4 S16 25.0 25.2 13.4 92.4 5.4 100 FTG PE 0.0 S17 25.0 25.2 13.8 93.6 0.035 TL 10.50 Pv 0.2 Pipe: 17 186.0 2.635 PL 12.50 PF 1.6 S17 25.0 25.2 13.8 93.6 10.9 100 FTG PE 0.0 S18 25.0 25.2 15.4 98.9 0.127 TL 12.50 Pv 0.8 Pipe: 18 284.9 2.635 PL 4.50 PF 4.7 S18 25.0 25.2 15.4 98.9 16.8 100 FTG T PE 0.0 CT4 25.0 0.0 20.1 0.0 0.280 TL 16.63 Pv 1.9 Pipe: 19 110.4 2.635 PL 8.00 PF 0.9 CT4 25.0 0.0 20.1 0.0 6.5 120 FTG T PE 0.0 S19 25.0 25.2 19.2 110.4 0.035 TL 25.00 Pv 0.3 Pipe: 20 473.7 3.260 PL 2.00 PF 4.1 CA 25.0 0.0 18.7 0.0 18.2 100 FTG T PE 0.9 CB1 23.0 0.0 23.7 0.0 0.254 TL 16.27 Pv 2.2 Pipe: 21 473.0 3.260 PL 2.00 PF 4.1 CT2 25.0 0.0 18.6 0.0 18.2 100 FTG T PE 0.9 CB2 23.0 0.0 23.6 0.0 0.254 TL 16.27 Pv 2.2 Pipe: 22 473.1 3.260 PL 2.00 PF 4.1 CT3 25.0 0.0 18.7 0.0 18.2 100 FTG T PE 0.9 CB3 23.0 0.0 23.6 0.0 0.254 TL 16.27 Pv 2.2 Pipe: 23 395.3 3.260 PL 2.00 PF 2.9 CT4 25.0 0.0 20.1 0.0 15.2 120 FTG T PE 0.9 CB4 23.0 0.0 23.8 0.0 0.130 TL 22.00 Pv 1.6 Pipe: 24 348.0 6.357 PL 11.75 PF 0.1 CB1 23.0 0.0 23.7 0.0 3.5 100 FTG PE 0.0 CB2 23.0 0.0 23.6 0.0 0.006 TL 11.75 Pv 0.1 Pipe: 25 125.0 6.357 PL 11.75 PF 0.0 CB2 23.0 0.0 23.6 0.0 1.3 100 FTG PE 0.0 CB3 23.0 0.0 23.6 0.0 0.001 TL 11.75 Pv 0.0 Pipe: 26 598.1 6.357 PL 11.75 PF 0.1 CB3 23.0 0.0 23.6 0.0 6.0 120 FTG PE 0.0 CB4 23.0 0.0 23.8 0.0 0.011 TL 11.75 Pv 0.2 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 5 DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\GARDEN.SDF JOB TITLE: Lowe's Sanford,Florida Garden Center PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 27 -993.4 6.357 PL 27.00 PF 1.5 CB4 23.0 0.0 23.8 0.0 10.0 100 FTG E PE 0.0 D 23.0 0.0 25.3 0.0 0.039 TL 39.85 PV 0.7 Pipe: 28 -993.4 6.357 PL 50.00 PF 3.0 D 23.0 0.0 25.3 0.0 10.0 100 FTG T PE 0.0 C 23.0 0.0 28.3 0.0 0.039 TL 77.12 Pv 0.7 Pipe: 29 -821.7 6.357 PL 3.00 PF 0.4 CB1 23.0 0.0 23.7 0.0 8.3 100 FTG E PE 0.0 A 23.0 0.0 24.1 0.0 0.027 TL 15.85 PV 0.5 Pipe: 30 -821.7 6.357 PL 50.00 PF 1.7 A 23.0 0.0 24.1 0.0 8.3 100 FTG E PE 0.0 B 23.0 0.0 25.8 0.0 0.027 TL 62.85 PV 0.5 Pipe: 31 -821.7 6.357 PL 63.00 PF 2.5 B 23.0 0.0 25.8 0.0 8.3 100 FTG T PE 0.0 C 23.0 0.0 28.3 0.0 0.027 TL 90.12 Pv 0.5 Pipe: 32-1815.1 6.357 PL 186.00 PF 23.8 C 23.0 0.0 28.3 0.0 18.3 .120 FTG ETC PE 0.0 ABY 23.0 0.0 52.1 0.0 0.084 TL 282.00 Pv 2.3 Pipe: 33-1815.1 6.357 PL 58.00 PF 6.4 ABY 23.0 0.0 52.1 0.0 18.3 120 FTG E PE 0.0 ABX 23.0 0.0 58.5 0.0 0.084 TL 76.00 Pv 2.3 Pipe: 34-1815.1 6.357 PL 44.00 PF 9.9 ABX 23.0 0.0 58.5 0.0 18.3 120 FTG 2ET PE 0.0 TOR 23.0 0.0 68.4 0.0 0.084 TL 118.00 PV 2.3 Pipe: 35-1815.1 6.357 PL 21.00 PF 7.3 TOR 23.0 0.0 68.4 0.0 18.3 120 FTG TGD PE 9.1 BOR 2.0 H.S. 84.9 100.0 0.084 TL 87.00 PV 2.3 Pipe: 36-1915.0 8.249 PL 20.00 PF 2.5 BOR 2.0 H.S. 84.9 100.0 11.5 120 FTG ECG PE 0.9 PUMP 0.0 SRCE 88.2 (N/A) 0.026 TL 94.00 Pv 0.9 NOTES: 1) Calculations were performed by the HASS 7.3 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 Lavista Road Tucker, GA 30084 2) The system has been calculated to provide an average imbalance at each node of 0.005 gpm and a maximum imbalance at any node of 0.184 gpm. N SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 6 r DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\GARDEN.SDF JOB TITLE: Lowe's Sanford,Florida Garden Center 3) velocity pressures are printed for information only and are not used in balancing the system. Maximum water velocity is 18.3 ft/sec at pipe 35. 4) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP PAGE: B MATERIAL: THNWL Diameter Equivalent in) E T L Ell Tee LngEll 2.635 8.00 17.00 6.00 3.260 9.00 20.00 7.00 6.357 18.00 38.00 11.00 8.249 20.00 39.00 15.00 HWC: 120 Fitting Lengths in Feet C B G A D N Chkvly Bfyvly Gatvly A1mChk DPvly NPTee 19.00 10.00 1.00 14.00 14.00 17.00 22.00 13.00 1.00 18.00 13.00 20.00 40.00 13.00 4.00 35.00 24.00 38.00 50.00 13.00 4.00 39.00 30.00 39.00 I SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 17—. DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\GARDEN.SDF, JOB TITLE: Lowe's Sanford,Florida Garden Center WATER SUPPLY ANALYSIS 180.0 150.0 G A U G120.0 E P R E S 90.0 S U R E Am, p s i 30.0 m Static: 170.00 psi Resid: 116.00 psi Flow: 1875.0 gpm LEGEND 1g Available pressure 113.85 psi @ 1915.0 2 Required pressure 88.18 psi @ 1915.0 c 2 40(600 800 1000 1200 1400 1600 1800 2000 FLOW (GPM) 1 V"f* REED FIRE PROTECTION 5168 MOBILE SOUTH STREET THEODORE ALABAMA 36582 251-653-4711 OFFICE 251-653-8348 FAX HYDRAULIC CALCULATIONS FOR LOWES of Sanford Florida Customer Loading Canopy FILE NUMBER: LOADING.SDF DATE: JUL 25, 2002 DESIGN DATA - OCCUPANCY CLASSIFICATION: MERCANTILE DENSITY: 0.20 gpm/sq. ft. AREA OF APPLICATION: 1950 sq. ft. COVERAGE PER SPRINKLER: 120 sq. ft. NUMBER OF SPRINKLERS CALCULATED: 17 sprinklers TOTAL SPRINKLER WATER FLOW REQUIRED: 513.9 gpm TOTAL WATER REQUIRED (including hose): 613.9 gpm FLOW AND PRESSURE (@ BOR): SPRINKLER ORIFICE SIZE: NAME OF CONTRACTOR: DESIGN/LAYOUT BY: MEH 613.9 gpm @ 104.43 psi 17/32 AUTHORITY HAVING JURISDICTION: LOWERS CO. & SCHIRMER ENGINEERING CORP. CONTRACTOR CERTIFICATION NUMBER: Florida Permit No. 466077000199 CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ) CALCULATIONS BY HASS COMPUTER PROGRAM (LICENSE # 721H381 ) REC SEP2020 1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS P e "" DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\LOADIN.:r JOB TITLE: Lowe's Sanford Florida Customer Loading Canopy WATER SUPPLY DATA SOURCE STATIC RESID. FLOW NODE PRESS. PRESS. @ TAG PSI) PSI) (GPM) PUMP 170.0 116.0 1875.0 AGGREGATE FLOW ANALYSIS: AVAIL. TOTAL REQ'D PRESS. @ DEMAND PRESS. PSI) (GPM) (PSI) 163.2 613.9 104.4 TOTAL FLOW AT SOURCE 613.9 GPM TOTAL HOSE STREAM ALLOWANCE AT SOURCE 0.0 GPM OTHER HOSE STREAM ALLOWANCES 100.0 GPM TOTAL DISCHARGE FROM ACTIVE SPRINKLERS 513.9 GPM NODE ANALYSIS DATA NODE TAG ELEVATION NODE TYPE PRESSURE DISCHARGE FT) PSI) GPM) S1 25.0 K= 5.60 21.6 26.0 S2 25.0 K= 5.60 21.9 26.2 S3 25.0 K= 5.60 22.9 26.8 S4 25.0 K= 5.60 25.2 28.1 S5 25.0 K= 5.60 29.5 30.4 S6 25.0 K= 5.60 35.3 33.3 S7 25.0 K= 5.60 34.9 33.1 S8 25.0 K= 5.60 22.2 26.4 S9 25.0 K= 5.60 22.5 26.6 S10 25.0 K= 5.60 23.6 27.2 S11 25.0 K= 5.60 25.9 28.5 S12 25.0 K= 5.60 30.3 30.8 S13 25.0 K= 5.60 36.3 33.7 S14 25.0 K= 5.60 35.8 33.5 S15 25.0 K= 5.60 36.9 34.0 S16 25.0 K= 5.60 37.4 34.2 S17 25.0 K= 5.60 39.3 35.1 AT1 25.0 37.3 AT2 25.0 38.3 AT3 25.0 43.9 AB1 23.0 40.4 AB2 23.0 41.4 AB3 23.0 45.4 AB4 23.0 51.3 ABx 23.0 92.3 TOR 23.0 93.4 BOR 2.0 HOSE STREAM 103.3 100.0 PUMP 0.0 SOURCE 104.4 613.9 tiJ r r. SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 2 ti A71: 7/25/2002C:\HASSCA-1\2505 LOWES SANFORD FL\LOADING.SDF JOB TITLE: Lowe's Sanford Florida Customer Loading Canopy PIPE DATA PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) FT) SUM. NODES FT) K) PSI) GPM) FL/FT PSI) Pipe: 1 26.0 1.610 PL 8.33 PF 0.3 S1 25.0 5.6 21.6 26.0 4.1 100 FTG PE 0.0 S2 25.0 5.6 21.9 26.2 0.037 TL 8.33 Pv 0.1 Pipe: 2 52.2 1.610 PL 8.00 PF 1.1 S2 25.0 5.6 21.9 26.2 8.2 100 FTG PE 0.0 S3 25.0 5.6 22.9 26.8 0.133 TL 8.00 Pv 0.5 Pipe: 3 79.0 1.610 PL 7.75 PF 2.2 S3 25.0 5.6 22.9 26.8 12.4 100 FTG PE 0.0 S4 25.0 5.6 25.2 28.1 0.287 TL 7.75 Pv 1.0 Pipe: 4 107.1 1.610 PL 8.66 PF 4.4 S4 25.0 5.6 25.2 28.1 16.9 100 FTG PE 0.0 S5 25.0 5.6 29.5 30.4 0.505 TL 8.66 Pv 1.9 Pipe: 5 137.5 1.610 PL 4.00 PF 7.8 S5 25.0 5.6 29.5 30.4 21.7 100 FTG T PE 0.0 AT1 25.0 0.0 37.3 0.0 0.801 TL 9.71 Pv 3.2 Pipe: 6 66.3 1.610 PL 4.00 PF 2.0 AT1 25.0 0.0 37.3 0.0 10.5 100 FTG T PE 0.0 S6 25.0 5.6 35.3 33.3 0.208 TL 9.71 Pv 0.7 Pipe: 7 33.1 1.610 PL 7.33 PF 0.4 S6 25.0 5.6 35.3 33.3 5.2 100 FTG PE 0.0 S7 25.0 5.6 34.9 33.1 0.057 TL 7.33 Pv 0.2 Pipe: 8 26.4 1.610 PL 8.33 PF 0.3 S8 25.0 5.6 22.2 26.4 4.2 100 FTG PE 0.0 S9 25.0 5.6 22.5 26.6 0.038 TL 8.33 Pv 0.1 Pipe: 9 52.9 1.610 PL 8.00 PF 1.1 S9 25.0 5.6 22.5 26.6 8.3 100 FTG PE 0.0 S10 25.0 5.6 23.6 27.2 0.137 TL 8.00 Pv 0.5 Pipe: 10 80.1 1.610 PL 7.75 PF 2.3 S10 25.0 5.6 23.6 27.2 12.6 100 FTG PE 0.0 S11 25.0 5.6 25.9 28.5 0.295 TL 7.75 Pv 1.1 Pipe: 11 108.6 1.610 PL 8.66 PF 4.5 Sil 25.0 5.6 25.9 28.5 17.1 100 FTG PE 0.0 S12 25.0 5.6 30.3 30.8 0.518 TL 8.66 Pv 2.0 Pipe: 12 139.4 1.610 PL 4.00 PF 8.0 S12 25.0 5.6 30.3 30.8 22.0 100 FTG T PE 0.0 AT2 25.0 0.0 38.3 0.0 0.822 TL 9.71 Pv 3.2 Pipe: 13 67.2 1.610 PL 4.00 PF 2.1 AT2 25.0 0.0 38.3 0.0 10.6 100 FTG T PE 0.0 S13 25.0 5.6 36.3 33.7 0.213 TL 9.71 Pv 0.8 1 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Pam" I DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\LOADINS& JOB TITLE: Lowers Sanford Florida Customer Loading Canopy I PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 14 33.5 1.610 PL 7.33 PF 0.4 S13 25.0 5.6 36.3 33.7 5.3 100 FTG ---- PE 0.0 S14 25.0 5.6 35.8 33.5 0.059 TL 7.33 Pv 0.2 Pipe: 15 -34.0 1.610 PL 7.75 PF 0.5 S15 25.0 5.6 36.9 34.0 5.4 100 FTG ---- PE 0.0 S16 25.0 5.6 37.4 34.2 0.060 TL 7.75 Pv 0.2 Pipe: 16 -68.3 1.610 PL 8.66 PF 1.9 S16 25.0 5.6 37.4 34.2 10.8 100 FTG ---- PE 0.0 S17 25.0 5.6 39.3 35.1 0.219 TL 8.66 Pv 0.8 Pipe: 17 -103.4 1.610 PL 4.00 PF 4.6 S17 25.0 5.6 39.3 35.1 16.3 100 FTG T PE 0.0 AT3 25.0 0.0 43.9 0.0 0.473 TL 9.71 Pv 1.8 Pipe: 18 -203.8 2.469 PL 2.00 PF 2.2 AT1 25.0 0.0 37.3 0.0 13.7 100 FTG T PE 0.9 AB1 23.0 0.0 40.4 0.0 0.207 TL 10.56 Pv 1.3 Pipe: 19 -206.7 2.469 PL 2.00 PF 2.2 AT2 25.0 0.0 38.3 0.0 13.8 100 FTG T PE 0.9 AB2 23.0 0.0 41.4 0.0 0.212 TL 10.56 Pv 1.3 Pipe: 20 -103.4 2.469 PL 2.00 PF 0.6 AT3 25.0 0.0 43.9 0.0 6.9 100 FTG T PE 0.9 AB3 23.0 0.0 45.4 0.0 0.059 TL 10.56 Pv 0.3 Pipe: 21 -203.8 3.068 PL 15.00 PF 1.1 AB1 23.0 0.0 40.4 0.0 8.8 100 FTG ---- PE 0.0 AB2 23.0 0.0 41.4 0.0 0.072 TL 15.00 Pv 0.5 Pipe: 22 -410.5 3.068 PL 15.00 PF 3.9 AB2 23.0 0.0 41.4 0.0 17.8 100 FTG ---- PE 0.0 AB3 23.0 0.0 45.4 0.0 0.262 TL 15.00 Pv 2.1 Pipe: 23 -513.9 4.026 PL 35.00 PF 6.0 AB3 23.0 0.0 45.4 0.0 13.0 100 FTG ET PE 0.0 AB4 23.0 0.0 51.3 0.0 0.106 TL 56.41 Pv 1.1 Pipe: 24 -513.9 4.026 PL 357.00 PF 40.9 AB4 23.0 0.0 51.3 0.0 13.0 100 FTG TC PE 0.0 ARK 23.0 0.0 92.3 0.0 0.106 TL 386.98 Pv 1.1 Pipe: 25 -513.9 6.357 PL 44.00 PF 1.1 ARK 23.0 0.0 92.3 0.0 5.2 100 FTG 2ET PE 0.0 TOR 23.0 0.0 93.4 0.0 0.011 TL 96.81 Pv 0.2 Pipe: 26 -513.9 6.357 PL 21.00 PF 0.8 TOR 23.0 0.0 93.4 0.0 5.2 100 FTG TGD PE 9.1 BOR 2.0 H.S. 103.3 100.0 0.011 TL 68.10 Pv 0.2 r i. SPRINKLER SYSTEM HYDRAULIC ANALYSIS Page 4 i 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\LOADING.SDF JOB TITLE: Lowe's Sanford Florida Customer Loading Canopy PIPE TAG Q(GPM) DIA(IN) LENGTH PRESS. END ELEV. NOZ. PT DISC. VEL(FPS) HW(C) (FT) SUM. NODES (FT) (K) (PSI) (GPM) FL/FT (PSI) Pipe: 27 -613.9 8.249 PL 20.00 PF 0.3 BOR 2.0 H.S. 103.3 100.0 3.7 120 FTG ECG PE 0.9 PUMP 0.0 SRCE 104.4 (N/A) 0.003 TL 94.00 Pv 0.1 NOTES: 1) Calculations were performed by the HASS 7.3 computer program under license no. 27080381 granted by HRS Systems, Inc. 4792 Lavista Road Tucker, GA 30084 2) The system has been calculated to provide an average imbalance at each node of 0.004 gpm and a maximum imbalance at any node of 0.103 gpm. 3) velocity pressures are printed for information only and are not used in balancing the system. Maximum water velocity is 22.0 ft/sec at pipe 12. 4) PIPE FITTINGS TABLE Pipe Table Name: STANDARD.PIP PAGE: A MATERIAL: SO HWC: 120 Diameter Equivalent Fitting in) Ell Tee LngEll Chkvlv 1.610 4.00 8.00 2.00 9.00 2.469 6.00 12.00 4.00 14.00 3.068 7.00 15.00 5.00 16.00 4.026 10.00 20.00 6.00 22.00 PAGE: B MATERIAL: THNWL Diameter Equivalent in) Ell Tee LngEll 6.357 18.00 38.00 11.00 8.249 20.00 39.00 15.00 Lengths in Feet B G BfyVly GatVly 6.00 1.00 7.00 1.00 10.00 1.00 12.00 2.00 A D N AlmChk DPVlV NPTee 10.00 10.00 8.00 10.00 10.00 12.00 13.00 10.00 15.00 20.00 10.00 20.00 HWC: 120 Fitting Lengths in Feet C B G A D N Chkvly BfyVly Gatvly AlmChk DPVlV NPTee 40.00 13.00 4.00 35.00 24.00 38.00 50.00 13.00 4.00 39.00 30.00 39.00 SPRINKLER SYSTEM HYDRAULIC ANALYSIS Pale• DATE: 7/25/2002 C:\HASSCA-1\2505 LOWES SANFORD FL\LOADING.5XXS;••_ JOB TITLE: Lowe's Sanford Florida Customer Loading Canopy it WATER SUPPLY ANALYSIS Static: 170.00 psi Resid: 116.00 psi F1oW: 1875.0 gpm 11*1XI 150.0 G A U G120.0 E P R E S 90.0 S U R E 60.0 p s i 30.0 Coal 2 FA 2 40(600 800 1000 1200 1400 1600 1800 2000 FLOW (GPM) LEGEND Available pressure 163.16 psi @ 613.9 c Required pressure 104.43 psi @ 613.9 c CITY'OF SANFORD PLUMBING PERMIT APPLICATION Partnit Number: 02- bolo Da*. A 1.q 01, The undersigned hereby applies for a permit to install the fopowing plumbing: Owner's Name: L— . C s \ - --- c `n• n..,.,--e A_ Address of Job: 37 D 01 t A. 6Y (Vt Plumbing Contractor. E )(-CLC+ ' uJYJ.) i Residential: Non -Residential: Number Amount Addition Alteration. Re if Non -Residential) New Residential: One Water Closet . Additional Wader Closet Commercial: MlNmum Permit Fee U5.Qo Fbdu Floor Trapb Sewer Pipingi Water Piping Gas Pi 'n Manufactured oWkft Desoption of Work t4 Application Fee: 31 .00 TOTAL DUE: By Signing this application 1 am stating that 1 am in compliance w¢Ii1\ity os\SaMord Plumbing Code. Lioense Number